(data stored in ACNUC17686 zone)

EMBL: AE017334

ID   AE017334; SV 2; circular; genomic DNA; STD; PRO; 5227419 BP.
AC   AE017334;
PR   Project:PRJNA10784;
DT   20-MAY-2004 (Rel. 79, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 10)
DE   Bacillus anthracis str. 'Ames Ancestor', complete genome.
KW   .
OS   Bacillus anthracis str. 'Ames Ancestor'
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
RN   [1]
RP   1-5227419
RX   DOI; 10.1128/JB.01347-08.
RX   PUBMED; 18952800.
RA   Ravel J., Jiang L., Stanley S.T., Wilson M.R., Decker R.S., Read T.D.,
RA   Worsham P., Keim P.S., Salzberg S.L., Fraser-Liggett C.M., Rasko D.A.;
RT   "The complete genome sequence of Bacillus anthracis Ames "Ancestor"";
RL   J. Bacteriol. 191(1):445-446(2009).
RN   [2]
RP   1-5227419
RA   Ravel J., Rasko D.A., Shumway M.F., Jiang L., Cer R.Z., Federova N.B.,
RA   Salzberg S., Fraser C.M.;
RT   ;
RL   Submitted (17-MAY-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [3]
RC   Sequence update by submitter
RP   1-5227419
RA   Ravel J., Rasko D.A., Shumway M.F., Jiang L., Cer R.Z., Federova N.B.,
RA   Wilson M., Stanley S., Decker S., Read T.D., Salzberg S., Fraser C.M.;
RT   ;
RL   Submitted (09-JUL-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
RN   [4]
RC   Protein update by submitter
RP   1-5227419
RA   Ravel J., Rasko D.A., Rosovitz M., Shumway M.F., Jiang L., Cer R.Z.,
RA   Dodson R.J., Fraser-Liggett C.;
RT   ;
RL   Submitted (14-AUG-2007) to the INSDC.
RL   J. Craig Venter Institute, 9712 Medical Center Dr, Rockville, MD 20850, USA
DR   MD5; 409ca40d9cfff2303d836a16bffe2932.
DR   BioSample; SAMN02603433.
DR   EnsemblGenomes-Gn; EBG00001133423.
DR   EnsemblGenomes-Gn; EBG00001133424.
DR   EnsemblGenomes-Gn; EBG00001133425.
DR   EnsemblGenomes-Gn; EBG00001133426.
DR   EnsemblGenomes-Gn; EBG00001133427.
DR   EnsemblGenomes-Gn; EBG00001133428.
DR   EnsemblGenomes-Gn; EBG00001133429.
DR   EnsemblGenomes-Gn; EBG00001133430.
DR   EnsemblGenomes-Gn; EBG00001133431.
DR   EnsemblGenomes-Gn; EBG00001133432.
DR   EnsemblGenomes-Gn; EBG00001133433.
DR   EnsemblGenomes-Gn; EBG00001133434.
DR   EnsemblGenomes-Gn; EBG00001133435.
DR   EnsemblGenomes-Gn; EBG00001133436.
DR   EnsemblGenomes-Gn; EBG00001133437.
DR   EnsemblGenomes-Gn; EBG00001133438.
DR   EnsemblGenomes-Gn; EBG00001133439.
DR   EnsemblGenomes-Gn; EBG00001133440.
DR   EnsemblGenomes-Gn; EBG00001133441.
DR   EnsemblGenomes-Gn; EBG00001133442.
DR   EnsemblGenomes-Gn; EBG00001133443.
DR   EnsemblGenomes-Gn; EBG00001133444.
DR   EnsemblGenomes-Gn; EBG00001133445.
DR   EnsemblGenomes-Gn; EBG00001133446.
DR   EnsemblGenomes-Gn; EBG00001133447.
DR   EnsemblGenomes-Gn; EBG00001133448.
DR   EnsemblGenomes-Gn; EBG00001133449.
DR   EnsemblGenomes-Gn; EBG00001133450.
DR   EnsemblGenomes-Gn; EBG00001133451.
DR   EnsemblGenomes-Gn; EBG00001133452.
DR   EnsemblGenomes-Gn; EBG00001133453.
DR   EnsemblGenomes-Gn; EBG00001133454.
DR   EnsemblGenomes-Gn; EBG00001133455.
DR   EnsemblGenomes-Gn; EBG00001133456.
DR   EnsemblGenomes-Gn; EBG00001133457.
DR   EnsemblGenomes-Gn; EBG00001133458.
DR   EnsemblGenomes-Gn; EBG00001133459.
DR   EnsemblGenomes-Gn; EBG00001133460.
DR   EnsemblGenomes-Gn; EBG00001133461.
DR   EnsemblGenomes-Gn; EBG00001133462.
DR   EnsemblGenomes-Gn; EBG00001133463.
DR   EnsemblGenomes-Gn; EBG00001133464.
DR   EnsemblGenomes-Gn; EBG00001133465.
DR   EnsemblGenomes-Gn; EBG00001133466.
DR   EnsemblGenomes-Gn; EBG00001133467.
DR   EnsemblGenomes-Gn; EBG00001133468.
DR   EnsemblGenomes-Gn; EBG00001133469.
DR   EnsemblGenomes-Gn; EBG00001133470.
DR   EnsemblGenomes-Gn; EBG00001133471.
DR   EnsemblGenomes-Gn; EBG00001133472.
DR   EnsemblGenomes-Gn; EBG00001133473.
DR   EnsemblGenomes-Gn; EBG00001133474.
DR   EnsemblGenomes-Gn; EBG00001133475.
DR   EnsemblGenomes-Gn; EBG00001133476.
DR   EnsemblGenomes-Gn; EBG00001133477.
DR   EnsemblGenomes-Gn; EBG00001133478.
DR   EnsemblGenomes-Gn; EBG00001133479.
DR   EnsemblGenomes-Gn; EBG00001133480.
DR   EnsemblGenomes-Gn; EBG00001133481.
DR   EnsemblGenomes-Gn; EBG00001133482.
DR   EnsemblGenomes-Gn; EBG00001133483.
DR   EnsemblGenomes-Gn; EBG00001133484.
DR   EnsemblGenomes-Gn; EBG00001133485.
DR   EnsemblGenomes-Gn; EBG00001133486.
DR   EnsemblGenomes-Gn; EBG00001133487.
DR   EnsemblGenomes-Gn; EBG00001133488.
DR   EnsemblGenomes-Gn; EBG00001133489.
DR   EnsemblGenomes-Gn; EBG00001133490.
DR   EnsemblGenomes-Gn; EBG00001133491.
DR   EnsemblGenomes-Gn; EBG00001133492.
DR   EnsemblGenomes-Gn; EBG00001133493.
DR   EnsemblGenomes-Gn; EBG00001133494.
DR   EnsemblGenomes-Gn; EBG00001133495.
DR   EnsemblGenomes-Gn; EBG00001133496.
DR   EnsemblGenomes-Gn; EBG00001133497.
DR   EnsemblGenomes-Gn; EBG00001133498.
DR   EnsemblGenomes-Gn; EBG00001133499.
DR   EnsemblGenomes-Gn; EBG00001133500.
DR   EnsemblGenomes-Gn; EBG00001133501.
DR   EnsemblGenomes-Gn; EBG00001133502.
DR   EnsemblGenomes-Gn; EBG00001133503.
DR   EnsemblGenomes-Gn; EBG00001133504.
DR   EnsemblGenomes-Gn; EBG00001133505.
DR   EnsemblGenomes-Gn; EBG00001133506.
DR   EnsemblGenomes-Gn; EBG00001133507.
DR   EnsemblGenomes-Gn; EBG00001133508.
DR   EnsemblGenomes-Gn; EBG00001133509.
DR   EnsemblGenomes-Gn; EBG00001133510.
DR   EnsemblGenomes-Gn; EBG00001133511.
DR   EnsemblGenomes-Gn; EBG00001133512.
DR   EnsemblGenomes-Gn; EBG00001133513.
DR   EnsemblGenomes-Gn; EBG00001133514.
DR   EnsemblGenomes-Gn; EBG00001133515.
DR   EnsemblGenomes-Gn; EBG00001133516.
DR   EnsemblGenomes-Gn; EBG00001133517.
DR   EnsemblGenomes-Gn; EBG00001133518.
DR   EnsemblGenomes-Gn; EBG00001133519.
DR   EnsemblGenomes-Gn; EBG00001133520.
DR   EnsemblGenomes-Gn; EBG00001133521.
DR   EnsemblGenomes-Gn; EBG00001133522.
DR   EnsemblGenomes-Gn; EBG00001133523.
DR   EnsemblGenomes-Gn; EBG00001133524.
DR   EnsemblGenomes-Gn; EBG00001133525.
DR   EnsemblGenomes-Gn; EBG00001133526.
DR   EnsemblGenomes-Gn; EBG00001133527.
DR   EnsemblGenomes-Gn; EBG00001133528.
DR   EnsemblGenomes-Gn; EBG00001133529.
DR   EnsemblGenomes-Gn; EBG00001133530.
DR   EnsemblGenomes-Gn; EBG00001133531.
DR   EnsemblGenomes-Gn; EBG00001133532.
DR   EnsemblGenomes-Gn; EBG00001133533.
DR   EnsemblGenomes-Gn; EBG00001133534.
DR   EnsemblGenomes-Gn; EBG00001133535.
DR   EnsemblGenomes-Gn; EBG00001133536.
DR   EnsemblGenomes-Gn; EBG00001133537.
DR   EnsemblGenomes-Gn; EBG00001133538.
DR   EnsemblGenomes-Gn; EBG00001133539.
DR   EnsemblGenomes-Gn; EBG00001133540.
DR   EnsemblGenomes-Gn; EBG00001133541.
DR   EnsemblGenomes-Gn; EBG00001133542.
DR   EnsemblGenomes-Gn; EBG00001133543.
DR   EnsemblGenomes-Gn; EBG00001133544.
DR   EnsemblGenomes-Gn; EBG00001133545.
DR   EnsemblGenomes-Gn; EBG00001133546.
DR   EnsemblGenomes-Gn; EBG00001133547.
DR   EnsemblGenomes-Gn; EBG00001133548.
DR   EnsemblGenomes-Gn; EBG00001133549.
DR   EnsemblGenomes-Gn; EBG00001133550.
DR   EnsemblGenomes-Gn; EBG00001133551.
DR   EnsemblGenomes-Gn; EBG00001133552.
DR   EnsemblGenomes-Gn; EBG00001133553.
DR   EnsemblGenomes-Gn; EBG00001133554.
DR   EnsemblGenomes-Gn; EBG00001133555.
DR   EnsemblGenomes-Gn; EBG00001133556.
DR   EnsemblGenomes-Gn; EBG00001133557.
DR   EnsemblGenomes-Gn; EBG00001133558.
DR   EnsemblGenomes-Gn; EBG00001133559.
DR   EnsemblGenomes-Gn; EBG00001133560.
DR   EnsemblGenomes-Gn; EBG00001133561.
DR   EnsemblGenomes-Gn; EBG00001133562.
DR   EnsemblGenomes-Gn; EBG00001133563.
DR   EnsemblGenomes-Gn; EBG00001133564.
DR   EnsemblGenomes-Gn; EBG00001133565.
DR   EnsemblGenomes-Gn; EBG00001133566.
DR   EnsemblGenomes-Gn; EBG00001133567.
DR   EnsemblGenomes-Gn; EBG00001133568.
DR   EnsemblGenomes-Gn; EBG00001133569.
DR   EnsemblGenomes-Gn; EBG00001133570.
DR   EnsemblGenomes-Gn; EBG00001133571.
DR   EnsemblGenomes-Gn; EBG00001133572.
DR   EnsemblGenomes-Gn; EBG00001133573.
DR   EnsemblGenomes-Gn; EBG00001133574.
DR   EnsemblGenomes-Gn; EBG00001133575.
DR   EnsemblGenomes-Gn; EBG00001133576.
DR   EnsemblGenomes-Gn; EBG00001133577.
DR   EnsemblGenomes-Gn; EBG00001133578.
DR   EnsemblGenomes-Gn; EBG00001133579.
DR   EnsemblGenomes-Gn; EBG00001133580.
DR   EnsemblGenomes-Gn; EBG00001133581.
DR   EnsemblGenomes-Gn; EBG00001133582.
DR   EnsemblGenomes-Gn; EBG00001133583.
DR   EnsemblGenomes-Gn; EBG00001133584.
DR   EnsemblGenomes-Gn; EBG00001133585.
DR   EnsemblGenomes-Gn; EBG00001133586.
DR   EnsemblGenomes-Gn; EBG00001133587.
DR   EnsemblGenomes-Gn; EBG00001133588.
DR   EnsemblGenomes-Gn; EBG00001133589.
DR   EnsemblGenomes-Gn; EBG00001133590.
DR   EnsemblGenomes-Gn; GBAA_5863.
DR   EnsemblGenomes-Gn; GBAA_5864.
DR   EnsemblGenomes-Gn; GBAA_5865.
DR   EnsemblGenomes-Gn; GBAA_5866.
DR   EnsemblGenomes-Gn; GBAA_5867.
DR   EnsemblGenomes-Gn; GBAA_5868.
DR   EnsemblGenomes-Gn; GBAA_5869.
DR   EnsemblGenomes-Gn; GBAA_5870.
DR   EnsemblGenomes-Gn; GBAA_5871.
DR   EnsemblGenomes-Gn; GBAA_5872.
DR   EnsemblGenomes-Gn; GBAA_5873.
DR   EnsemblGenomes-Gn; GBAA_5874.
DR   EnsemblGenomes-Gn; GBAA_5875.
DR   EnsemblGenomes-Gn; GBAA_5876.
DR   EnsemblGenomes-Gn; GBAA_5877.
DR   EnsemblGenomes-Gn; GBAA_5878.
DR   EnsemblGenomes-Gn; GBAA_5879.
DR   EnsemblGenomes-Gn; GBAA_5880.
DR   EnsemblGenomes-Gn; GBAA_5881.
DR   EnsemblGenomes-Gn; GBAA_5882.
DR   EnsemblGenomes-Gn; GBAA_5883.
DR   EnsemblGenomes-Gn; GBAA_5884.
DR   EnsemblGenomes-Gn; GBAA_5885.
DR   EnsemblGenomes-Gn; GBAA_5886.
DR   EnsemblGenomes-Gn; GBAA_5887.
DR   EnsemblGenomes-Gn; GBAA_5888.
DR   EnsemblGenomes-Gn; GBAA_5889.
DR   EnsemblGenomes-Gn; GBAA_5890.
DR   EnsemblGenomes-Gn; GBAA_5891.
DR   EnsemblGenomes-Gn; GBAA_5892.
DR   EnsemblGenomes-Gn; GBAA_5893.
DR   EnsemblGenomes-Gn; GBAA_5894.
DR   EnsemblGenomes-Gn; GBAA_5895.
DR   EnsemblGenomes-Gn; GBAA_5896.
DR   EnsemblGenomes-Gn; GBAA_5897.
DR   EnsemblGenomes-Gn; GBAA_5898.
DR   EnsemblGenomes-Gn; GBAA_5899.
DR   EnsemblGenomes-Gn; GBAA_5900.
DR   EnsemblGenomes-Gn; GBAA_5901.
DR   EnsemblGenomes-Gn; GBAA_5902.
DR   EnsemblGenomes-Gn; GBAA_5903.
DR   EnsemblGenomes-Gn; GBAA_5904.
DR   EnsemblGenomes-Gn; GBAA_5905.
DR   EnsemblGenomes-Gn; GBAA_5906.
DR   EnsemblGenomes-Gn; GBAA_5907.
DR   EnsemblGenomes-Gn; GBAA_5908.
DR   EnsemblGenomes-Gn; GBAA_5909.
DR   EnsemblGenomes-Gn; GBAA_5910.
DR   EnsemblGenomes-Gn; GBAA_5911.
DR   EnsemblGenomes-Gn; GBAA_5912.
DR   EnsemblGenomes-Gn; GBAA_5913.
DR   EnsemblGenomes-Gn; GBAA_5914.
DR   EnsemblGenomes-Gn; GBAA_5915.
DR   EnsemblGenomes-Gn; GBAA_5916.
DR   EnsemblGenomes-Gn; GBAA_5917.
DR   EnsemblGenomes-Gn; GBAA_5918.
DR   EnsemblGenomes-Gn; GBAA_5919.
DR   EnsemblGenomes-Gn; GBAA_5920.
DR   EnsemblGenomes-Gn; GBAA_5921.
DR   EnsemblGenomes-Gn; GBAA_5922.
DR   EnsemblGenomes-Gn; GBAA_5923.
DR   EnsemblGenomes-Gn; GBAA_5924.
DR   EnsemblGenomes-Gn; GBAA_5925.
DR   EnsemblGenomes-Gn; GBAA_5926.
DR   EnsemblGenomes-Gn; GBAA_5927.
DR   EnsemblGenomes-Gn; GBAA_5928.
DR   EnsemblGenomes-Gn; GBAA_5929.
DR   EnsemblGenomes-Gn; GBAA_5930.
DR   EnsemblGenomes-Gn; GBAA_5931.
DR   EnsemblGenomes-Gn; GBAA_5932.
DR   EnsemblGenomes-Gn; GBAA_5933.
DR   EnsemblGenomes-Gn; GBAA_5934.
DR   EnsemblGenomes-Gn; GBAA_5935.
DR   EnsemblGenomes-Gn; GBAA_5936.
DR   EnsemblGenomes-Gn; GBAA_5937.
DR   EnsemblGenomes-Gn; GBAA_5938.
DR   EnsemblGenomes-Gn; GBAA_5939.
DR   EnsemblGenomes-Gn; GBAA_5940.
DR   EnsemblGenomes-Gn; GBAA_5941.
DR   EnsemblGenomes-Gn; GBAA_5942.
DR   EnsemblGenomes-Gn; GBAA_5943.
DR   EnsemblGenomes-Gn; GBAA_5944.
DR   EnsemblGenomes-Gn; GBAA_5945.
DR   EnsemblGenomes-Gn; GBAA_5946.
DR   EnsemblGenomes-Gn; GBAA_5947.
DR   EnsemblGenomes-Gn; GBAA_5948.
DR   EnsemblGenomes-Gn; GBAA_5949.
DR   EnsemblGenomes-Gn; GBAA_5950.
DR   EnsemblGenomes-Gn; GBAA_5951.
DR   EnsemblGenomes-Gn; GBAA_5952.
DR   EnsemblGenomes-Gn; GBAA_5953.
DR   EnsemblGenomes-Gn; GBAA_5954.
DR   EnsemblGenomes-Gn; GBAA_5955.
DR   EnsemblGenomes-Gn; GBAA_5956.
DR   EnsemblGenomes-Gn; GBAA_5957.
DR   EnsemblGenomes-Gn; GBAA_5958.
DR   EnsemblGenomes-Gn; GBAA_5959.
DR   EnsemblGenomes-Gn; GBAA_5960.
DR   EnsemblGenomes-Gn; GBAA_5961.
DR   EnsemblGenomes-Gn; GBAA_5962.
DR   EnsemblGenomes-Gn; GBAA_5963.
DR   EnsemblGenomes-Gn; GBAA_5964.
DR   EnsemblGenomes-Gn; GBAA_5965.
DR   EnsemblGenomes-Gn; GBAA_5966.
DR   EnsemblGenomes-Gn; GBAA_5967.
DR   EnsemblGenomes-Gn; GBAA_5968.
DR   EnsemblGenomes-Gn; GBAA_5969.
DR   EnsemblGenomes-Gn; GBAA_5970.
DR   EnsemblGenomes-Gn; GBAA_5971.
DR   EnsemblGenomes-Gn; GBAA_5972.
DR   EnsemblGenomes-Gn; GBAA_5973.
DR   EnsemblGenomes-Gn; GBAA_5974.
DR   EnsemblGenomes-Gn; GBAA_5975.
DR   EnsemblGenomes-Gn; GBAA_5976.
DR   EnsemblGenomes-Gn; GBAA_5977.
DR   EnsemblGenomes-Gn; GBAA_5978.
DR   EnsemblGenomes-Gn; GBAA_5979.
DR   EnsemblGenomes-Gn; GBAA_5980.
DR   EnsemblGenomes-Gn; GBAA_5981.
DR   EnsemblGenomes-Gn; GBAA_5982.
DR   EnsemblGenomes-Gn; GBAA_5983.
DR   EnsemblGenomes-Gn; GBAA_5984.
DR   EnsemblGenomes-Gn; GBAA_5985.
DR   EnsemblGenomes-Gn; GBAA_5986.
DR   EnsemblGenomes-Gn; GBAA_5987.
DR   EnsemblGenomes-Gn; GBAA_5988.
DR   EnsemblGenomes-Gn; GBAA_5989.
DR   EnsemblGenomes-Gn; GBAA_5990.
DR   EnsemblGenomes-Gn; GBAA_5991.
DR   EnsemblGenomes-Tr; EBT00001724417.
DR   EnsemblGenomes-Tr; EBT00001724418.
DR   EnsemblGenomes-Tr; EBT00001724419.
DR   EnsemblGenomes-Tr; EBT00001724420.
DR   EnsemblGenomes-Tr; EBT00001724421.
DR   EnsemblGenomes-Tr; EBT00001724422.
DR   EnsemblGenomes-Tr; EBT00001724423.
DR   EnsemblGenomes-Tr; EBT00001724424.
DR   EnsemblGenomes-Tr; EBT00001724425.
DR   EnsemblGenomes-Tr; EBT00001724426.
DR   EnsemblGenomes-Tr; EBT00001724427.
DR   EnsemblGenomes-Tr; EBT00001724428.
DR   EnsemblGenomes-Tr; EBT00001724429.
DR   EnsemblGenomes-Tr; EBT00001724430.
DR   EnsemblGenomes-Tr; EBT00001724431.
DR   EnsemblGenomes-Tr; EBT00001724432.
DR   EnsemblGenomes-Tr; EBT00001724433.
DR   EnsemblGenomes-Tr; EBT00001724434.
DR   EnsemblGenomes-Tr; EBT00001724435.
DR   EnsemblGenomes-Tr; EBT00001724436.
DR   EnsemblGenomes-Tr; EBT00001724437.
DR   EnsemblGenomes-Tr; EBT00001724438.
DR   EnsemblGenomes-Tr; EBT00001724439.
DR   EnsemblGenomes-Tr; EBT00001724440.
DR   EnsemblGenomes-Tr; EBT00001724441.
DR   EnsemblGenomes-Tr; EBT00001724442.
DR   EnsemblGenomes-Tr; EBT00001724443.
DR   EnsemblGenomes-Tr; EBT00001724444.
DR   EnsemblGenomes-Tr; EBT00001724445.
DR   EnsemblGenomes-Tr; EBT00001724446.
DR   EnsemblGenomes-Tr; EBT00001724447.
DR   EnsemblGenomes-Tr; EBT00001724448.
DR   EnsemblGenomes-Tr; EBT00001724449.
DR   EnsemblGenomes-Tr; EBT00001724450.
DR   EnsemblGenomes-Tr; EBT00001724451.
DR   EnsemblGenomes-Tr; EBT00001724452.
DR   EnsemblGenomes-Tr; EBT00001724453.
DR   EnsemblGenomes-Tr; EBT00001724454.
DR   EnsemblGenomes-Tr; EBT00001724455.
DR   EnsemblGenomes-Tr; EBT00001724456.
DR   EnsemblGenomes-Tr; EBT00001724457.
DR   EnsemblGenomes-Tr; EBT00001724458.
DR   EnsemblGenomes-Tr; EBT00001724459.
DR   EnsemblGenomes-Tr; EBT00001724460.
DR   EnsemblGenomes-Tr; EBT00001724461.
DR   EnsemblGenomes-Tr; EBT00001724462.
DR   EnsemblGenomes-Tr; EBT00001724463.
DR   EnsemblGenomes-Tr; EBT00001724464.
DR   EnsemblGenomes-Tr; EBT00001724465.
DR   EnsemblGenomes-Tr; EBT00001724466.
DR   EnsemblGenomes-Tr; EBT00001724467.
DR   EnsemblGenomes-Tr; EBT00001724468.
DR   EnsemblGenomes-Tr; EBT00001724469.
DR   EnsemblGenomes-Tr; EBT00001724470.
DR   EnsemblGenomes-Tr; EBT00001724471.
DR   EnsemblGenomes-Tr; EBT00001724472.
DR   EnsemblGenomes-Tr; EBT00001724473.
DR   EnsemblGenomes-Tr; EBT00001724474.
DR   EnsemblGenomes-Tr; EBT00001724475.
DR   EnsemblGenomes-Tr; EBT00001724476.
DR   EnsemblGenomes-Tr; EBT00001724477.
DR   EnsemblGenomes-Tr; EBT00001724478.
DR   EnsemblGenomes-Tr; EBT00001724479.
DR   EnsemblGenomes-Tr; EBT00001724480.
DR   EnsemblGenomes-Tr; EBT00001724481.
DR   EnsemblGenomes-Tr; EBT00001724482.
DR   EnsemblGenomes-Tr; EBT00001724483.
DR   EnsemblGenomes-Tr; EBT00001724484.
DR   EnsemblGenomes-Tr; EBT00001724485.
DR   EnsemblGenomes-Tr; EBT00001724486.
DR   EnsemblGenomes-Tr; EBT00001724487.
DR   EnsemblGenomes-Tr; EBT00001724488.
DR   EnsemblGenomes-Tr; EBT00001724489.
DR   EnsemblGenomes-Tr; EBT00001724490.
DR   EnsemblGenomes-Tr; EBT00001724491.
DR   EnsemblGenomes-Tr; EBT00001724492.
DR   EnsemblGenomes-Tr; EBT00001724493.
DR   EnsemblGenomes-Tr; EBT00001724494.
DR   EnsemblGenomes-Tr; EBT00001724495.
DR   EnsemblGenomes-Tr; EBT00001724496.
DR   EnsemblGenomes-Tr; EBT00001724497.
DR   EnsemblGenomes-Tr; EBT00001724498.
DR   EnsemblGenomes-Tr; EBT00001724499.
DR   EnsemblGenomes-Tr; EBT00001724500.
DR   EnsemblGenomes-Tr; EBT00001724501.
DR   EnsemblGenomes-Tr; EBT00001724502.
DR   EnsemblGenomes-Tr; EBT00001724503.
DR   EnsemblGenomes-Tr; EBT00001724504.
DR   EnsemblGenomes-Tr; EBT00001724505.
DR   EnsemblGenomes-Tr; EBT00001724506.
DR   EnsemblGenomes-Tr; EBT00001724507.
DR   EnsemblGenomes-Tr; EBT00001724508.
DR   EnsemblGenomes-Tr; EBT00001724509.
DR   EnsemblGenomes-Tr; EBT00001724510.
DR   EnsemblGenomes-Tr; EBT00001724511.
DR   EnsemblGenomes-Tr; EBT00001724512.
DR   EnsemblGenomes-Tr; EBT00001724513.
DR   EnsemblGenomes-Tr; EBT00001724514.
DR   EnsemblGenomes-Tr; EBT00001724515.
DR   EnsemblGenomes-Tr; EBT00001724516.
DR   EnsemblGenomes-Tr; EBT00001724517.
DR   EnsemblGenomes-Tr; EBT00001724518.
DR   EnsemblGenomes-Tr; EBT00001724519.
DR   EnsemblGenomes-Tr; EBT00001724520.
DR   EnsemblGenomes-Tr; EBT00001724521.
DR   EnsemblGenomes-Tr; EBT00001724522.
DR   EnsemblGenomes-Tr; EBT00001724523.
DR   EnsemblGenomes-Tr; EBT00001724524.
DR   EnsemblGenomes-Tr; EBT00001724525.
DR   EnsemblGenomes-Tr; EBT00001724526.
DR   EnsemblGenomes-Tr; EBT00001724527.
DR   EnsemblGenomes-Tr; EBT00001724528.
DR   EnsemblGenomes-Tr; EBT00001724529.
DR   EnsemblGenomes-Tr; EBT00001724530.
DR   EnsemblGenomes-Tr; EBT00001724531.
DR   EnsemblGenomes-Tr; EBT00001724532.
DR   EnsemblGenomes-Tr; EBT00001724533.
DR   EnsemblGenomes-Tr; EBT00001724534.
DR   EnsemblGenomes-Tr; EBT00001724535.
DR   EnsemblGenomes-Tr; EBT00001724536.
DR   EnsemblGenomes-Tr; EBT00001724537.
DR   EnsemblGenomes-Tr; EBT00001724538.
DR   EnsemblGenomes-Tr; EBT00001724539.
DR   EnsemblGenomes-Tr; EBT00001724540.
DR   EnsemblGenomes-Tr; EBT00001724541.
DR   EnsemblGenomes-Tr; EBT00001724542.
DR   EnsemblGenomes-Tr; EBT00001724543.
DR   EnsemblGenomes-Tr; EBT00001724544.
DR   EnsemblGenomes-Tr; EBT00001724545.
DR   EnsemblGenomes-Tr; EBT00001724546.
DR   EnsemblGenomes-Tr; EBT00001724547.
DR   EnsemblGenomes-Tr; EBT00001724548.
DR   EnsemblGenomes-Tr; EBT00001724549.
DR   EnsemblGenomes-Tr; EBT00001724550.
DR   EnsemblGenomes-Tr; EBT00001724551.
DR   EnsemblGenomes-Tr; EBT00001724552.
DR   EnsemblGenomes-Tr; EBT00001724553.
DR   EnsemblGenomes-Tr; EBT00001724554.
DR   EnsemblGenomes-Tr; EBT00001724555.
DR   EnsemblGenomes-Tr; EBT00001724556.
DR   EnsemblGenomes-Tr; EBT00001724557.
DR   EnsemblGenomes-Tr; EBT00001724558.
DR   EnsemblGenomes-Tr; EBT00001724559.
DR   EnsemblGenomes-Tr; EBT00001724560.
DR   EnsemblGenomes-Tr; EBT00001724561.
DR   EnsemblGenomes-Tr; EBT00001724562.
DR   EnsemblGenomes-Tr; EBT00001724563.
DR   EnsemblGenomes-Tr; EBT00001724564.
DR   EnsemblGenomes-Tr; EBT00001724565.
DR   EnsemblGenomes-Tr; EBT00001724566.
DR   EnsemblGenomes-Tr; EBT00001724567.
DR   EnsemblGenomes-Tr; EBT00001724568.
DR   EnsemblGenomes-Tr; EBT00001724569.
DR   EnsemblGenomes-Tr; EBT00001724570.
DR   EnsemblGenomes-Tr; EBT00001724571.
DR   EnsemblGenomes-Tr; EBT00001724572.
DR   EnsemblGenomes-Tr; EBT00001724573.
DR   EnsemblGenomes-Tr; EBT00001724574.
DR   EnsemblGenomes-Tr; EBT00001724575.
DR   EnsemblGenomes-Tr; EBT00001724576.
DR   EnsemblGenomes-Tr; EBT00001724577.
DR   EnsemblGenomes-Tr; EBT00001724578.
DR   EnsemblGenomes-Tr; EBT00001724579.
DR   EnsemblGenomes-Tr; EBT00001724580.
DR   EnsemblGenomes-Tr; EBT00001724581.
DR   EnsemblGenomes-Tr; EBT00001724582.
DR   EnsemblGenomes-Tr; EBT00001724583.
DR   EnsemblGenomes-Tr; EBT00001724584.
DR   EnsemblGenomes-Tr; GBAA_5863-1.
DR   EnsemblGenomes-Tr; GBAA_5864-1.
DR   EnsemblGenomes-Tr; GBAA_5865-1.
DR   EnsemblGenomes-Tr; GBAA_5866-1.
DR   EnsemblGenomes-Tr; GBAA_5867-1.
DR   EnsemblGenomes-Tr; GBAA_5868-1.
DR   EnsemblGenomes-Tr; GBAA_5869-1.
DR   EnsemblGenomes-Tr; GBAA_5870-1.
DR   EnsemblGenomes-Tr; GBAA_5871-1.
DR   EnsemblGenomes-Tr; GBAA_5872-1.
DR   EnsemblGenomes-Tr; GBAA_5873-1.
DR   EnsemblGenomes-Tr; GBAA_5874-1.
DR   EnsemblGenomes-Tr; GBAA_5875-1.
DR   EnsemblGenomes-Tr; GBAA_5876-1.
DR   EnsemblGenomes-Tr; GBAA_5877-1.
DR   EnsemblGenomes-Tr; GBAA_5878-1.
DR   EnsemblGenomes-Tr; GBAA_5879-1.
DR   EnsemblGenomes-Tr; GBAA_5880-1.
DR   EnsemblGenomes-Tr; GBAA_5881-1.
DR   EnsemblGenomes-Tr; GBAA_5882-1.
DR   EnsemblGenomes-Tr; GBAA_5883-1.
DR   EnsemblGenomes-Tr; GBAA_5884-1.
DR   EnsemblGenomes-Tr; GBAA_5885-1.
DR   EnsemblGenomes-Tr; GBAA_5886-1.
DR   EnsemblGenomes-Tr; GBAA_5887-1.
DR   EnsemblGenomes-Tr; GBAA_5888-1.
DR   EnsemblGenomes-Tr; GBAA_5889-1.
DR   EnsemblGenomes-Tr; GBAA_5890-1.
DR   EnsemblGenomes-Tr; GBAA_5891-1.
DR   EnsemblGenomes-Tr; GBAA_5892-1.
DR   EnsemblGenomes-Tr; GBAA_5893-1.
DR   EnsemblGenomes-Tr; GBAA_5894-1.
DR   EnsemblGenomes-Tr; GBAA_5895-1.
DR   EnsemblGenomes-Tr; GBAA_5896-1.
DR   EnsemblGenomes-Tr; GBAA_5897-1.
DR   EnsemblGenomes-Tr; GBAA_5898-1.
DR   EnsemblGenomes-Tr; GBAA_5899-1.
DR   EnsemblGenomes-Tr; GBAA_5900-1.
DR   EnsemblGenomes-Tr; GBAA_5901-1.
DR   EnsemblGenomes-Tr; GBAA_5902-1.
DR   EnsemblGenomes-Tr; GBAA_5903-1.
DR   EnsemblGenomes-Tr; GBAA_5904-1.
DR   EnsemblGenomes-Tr; GBAA_5905-1.
DR   EnsemblGenomes-Tr; GBAA_5906-1.
DR   EnsemblGenomes-Tr; GBAA_5907-1.
DR   EnsemblGenomes-Tr; GBAA_5908-1.
DR   EnsemblGenomes-Tr; GBAA_5909-1.
DR   EnsemblGenomes-Tr; GBAA_5910-1.
DR   EnsemblGenomes-Tr; GBAA_5911-1.
DR   EnsemblGenomes-Tr; GBAA_5912-1.
DR   EnsemblGenomes-Tr; GBAA_5913-1.
DR   EnsemblGenomes-Tr; GBAA_5914-1.
DR   EnsemblGenomes-Tr; GBAA_5915-1.
DR   EnsemblGenomes-Tr; GBAA_5916-1.
DR   EnsemblGenomes-Tr; GBAA_5917-1.
DR   EnsemblGenomes-Tr; GBAA_5918-1.
DR   EnsemblGenomes-Tr; GBAA_5919-1.
DR   EnsemblGenomes-Tr; GBAA_5920-1.
DR   EnsemblGenomes-Tr; GBAA_5921-1.
DR   EnsemblGenomes-Tr; GBAA_5922-1.
DR   EnsemblGenomes-Tr; GBAA_5923-1.
DR   EnsemblGenomes-Tr; GBAA_5924-1.
DR   EnsemblGenomes-Tr; GBAA_5925-1.
DR   EnsemblGenomes-Tr; GBAA_5926-1.
DR   EnsemblGenomes-Tr; GBAA_5927-1.
DR   EnsemblGenomes-Tr; GBAA_5928-1.
DR   EnsemblGenomes-Tr; GBAA_5929-1.
DR   EnsemblGenomes-Tr; GBAA_5930-1.
DR   EnsemblGenomes-Tr; GBAA_5931-1.
DR   EnsemblGenomes-Tr; GBAA_5932-1.
DR   EnsemblGenomes-Tr; GBAA_5933-1.
DR   EnsemblGenomes-Tr; GBAA_5934-1.
DR   EnsemblGenomes-Tr; GBAA_5935-1.
DR   EnsemblGenomes-Tr; GBAA_5936-1.
DR   EnsemblGenomes-Tr; GBAA_5937-1.
DR   EnsemblGenomes-Tr; GBAA_5938-1.
DR   EnsemblGenomes-Tr; GBAA_5939-1.
DR   EnsemblGenomes-Tr; GBAA_5940-1.
DR   EnsemblGenomes-Tr; GBAA_5941-1.
DR   EnsemblGenomes-Tr; GBAA_5942-1.
DR   EnsemblGenomes-Tr; GBAA_5943-1.
DR   EnsemblGenomes-Tr; GBAA_5944-1.
DR   EnsemblGenomes-Tr; GBAA_5945-1.
DR   EnsemblGenomes-Tr; GBAA_5946-1.
DR   EnsemblGenomes-Tr; GBAA_5947-1.
DR   EnsemblGenomes-Tr; GBAA_5948-1.
DR   EnsemblGenomes-Tr; GBAA_5949-1.
DR   EnsemblGenomes-Tr; GBAA_5950-1.
DR   EnsemblGenomes-Tr; GBAA_5951-1.
DR   EnsemblGenomes-Tr; GBAA_5952-1.
DR   EnsemblGenomes-Tr; GBAA_5953-1.
DR   EnsemblGenomes-Tr; GBAA_5954-1.
DR   EnsemblGenomes-Tr; GBAA_5955-1.
DR   EnsemblGenomes-Tr; GBAA_5956-1.
DR   EnsemblGenomes-Tr; GBAA_5957-1.
DR   EnsemblGenomes-Tr; GBAA_5958-1.
DR   EnsemblGenomes-Tr; GBAA_5959-1.
DR   EnsemblGenomes-Tr; GBAA_5960-1.
DR   EnsemblGenomes-Tr; GBAA_5961-1.
DR   EnsemblGenomes-Tr; GBAA_5962-1.
DR   EnsemblGenomes-Tr; GBAA_5963-1.
DR   EnsemblGenomes-Tr; GBAA_5964-1.
DR   EnsemblGenomes-Tr; GBAA_5965-1.
DR   EnsemblGenomes-Tr; GBAA_5966-1.
DR   EnsemblGenomes-Tr; GBAA_5967-1.
DR   EnsemblGenomes-Tr; GBAA_5968-1.
DR   EnsemblGenomes-Tr; GBAA_5969-1.
DR   EnsemblGenomes-Tr; GBAA_5970-1.
DR   EnsemblGenomes-Tr; GBAA_5971-1.
DR   EnsemblGenomes-Tr; GBAA_5972-1.
DR   EnsemblGenomes-Tr; GBAA_5973-1.
DR   EnsemblGenomes-Tr; GBAA_5974-1.
DR   EnsemblGenomes-Tr; GBAA_5975-1.
DR   EnsemblGenomes-Tr; GBAA_5976-1.
DR   EnsemblGenomes-Tr; GBAA_5977-1.
DR   EnsemblGenomes-Tr; GBAA_5978-1.
DR   EnsemblGenomes-Tr; GBAA_5979-1.
DR   EnsemblGenomes-Tr; GBAA_5980-1.
DR   EnsemblGenomes-Tr; GBAA_5981-1.
DR   EnsemblGenomes-Tr; GBAA_5982-1.
DR   EnsemblGenomes-Tr; GBAA_5983-1.
DR   EnsemblGenomes-Tr; GBAA_5984-1.
DR   EnsemblGenomes-Tr; GBAA_5985-1.
DR   EnsemblGenomes-Tr; GBAA_5986-1.
DR   EnsemblGenomes-Tr; GBAA_5987-1.
DR   EnsemblGenomes-Tr; GBAA_5988-1.
DR   EnsemblGenomes-Tr; GBAA_5989-1.
DR   EnsemblGenomes-Tr; GBAA_5990-1.
DR   EnsemblGenomes-Tr; GBAA_5991-1.
DR   EuropePMC; PMC1183370; 16085855.
DR   EuropePMC; PMC1287610; 16269689.
DR   EuropePMC; PMC1475869; 16600039.
DR   EuropePMC; PMC1489381; 16820519.
DR   EuropePMC; PMC2238731; 18215273.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2504315; 18587153.
DR   EuropePMC; PMC2612425; 18952800.
DR   EuropePMC; PMC2653229; 19283072.
DR   EuropePMC; PMC2936356; 20723231.
DR   EuropePMC; PMC3039983; 21340017.
DR   EuropePMC; PMC3210476; 21962024.
DR   EuropePMC; PMC3235112; 22174783.
DR   EuropePMC; PMC3295808; 22413024.
DR   EuropePMC; PMC3414016; 22840345.
DR   EuropePMC; PMC4023602; 24734872.
DR   EuropePMC; PMC4534099; 26266934.
DR   EuropePMC; PMC4552859; 26317972.
DR   EuropePMC; PMC4653780; 26586878.
DR   EuropePMC; PMC4702213; 26732659.
DR   EuropePMC; PMC5930959; 29716659.
DR   EuropePMC; PMC6190687; 28622090.
DR   EuropePMC; PMC6258423; 30418972.
DR   EuropePMC; PMC6290263; 30574557.
DR   EuropePMC; PMC6328647; 30643874.
DR   GOA; P59873.
DR   GOA; P60534.
DR   GOA; P60540.
DR   GOA; Q6I3T8.
DR   GOA; Q6I4Q2.
DR   GOA; Q81QA7.
DR   InterPro; IPR002501; PsdUridine_synth_N.
DR   InterPro; IPR013765; DNA_recomb/repair_RecA.
DR   InterPro; IPR020095; PsdUridine_synth_TruA_C.
DR   InterPro; IPR020103; PsdUridine_synth_cat_dom_sf.
DR   InterPro; IPR020584; DNA_recomb/repair_RecA_CS.
DR   InterPro; IPR020587; RecA_monomer-monomer_interface.
DR   InterPro; IPR023400; RecA_C.
DR   InterPro; IPR023952; IolE.
DR   InterPro; IPR026660; PRA-CH.
DR   InterPro; IPR030823; IolE/MocC.
DR   InterPro; IPR036237; Xyl_isomerase-like_sf.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AE017334.
DR   SILVA-SSU; AE017334.
DR   UniProtKB/Swiss-Prot; P59873; TRUB_BACAN.
DR   UniProtKB/Swiss-Prot; P60534; HIS2_BACAN.
DR   UniProtKB/Swiss-Prot; P60540; HIS3_BACAN.
DR   UniProtKB/Swiss-Prot; Q6HYJ1; IOLE_BACAN.
DR   UniProtKB/Swiss-Prot; Q6I3T8; TRUA2_BACAN.
DR   UniProtKB/Swiss-Prot; Q6I4Q2; TRUA1_BACAN.
DR   UniProtKB/Swiss-Prot; Q81QA7; Y2525_BACAN.
DR   UniProtKB/Swiss-Prot; Q9APZ2; RECA_BACAN.
CC   On Jul 9, 2004 this sequence version replaced gi:47500402.
FH   Key             Location/Qualifiers
FT   source          1..5227419
FT                   /organism="Bacillus anthracis str. 'Ames Ancestor'"
FT                   /strain="Ames Ancestor; A2084"
FT                   /mol_type="genomic DNA"
FT                   /note="MLVA types GT62 and A3.b"
FT                   /db_xref="taxon:261594"
FT   gene            407..1747
FT                   /gene="dnaA"
FT                   /locus_tag="GBAA_0001"
FT                   /old_locus_tag="GBAA0001"
FT   CDS_pept        407..1747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="GBAA_0001"
FT                   /old_locus_tag="GBAA0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29079"
FT                   /db_xref="GOA:Q81W35"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W35"
FT                   /protein_id="AAT29079.1"
FT   gene            1926..3065
FT                   /gene="dnaN1"
FT                   /locus_tag="GBAA_0002"
FT                   /old_locus_tag="GBAA0002"
FT   CDS_pept        1926..3065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="GBAA_0002"
FT                   /old_locus_tag="GBAA0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29080"
FT                   /db_xref="GOA:A0A0F7R8K8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8K8"
FT                   /protein_id="AAT29080.1"
FT   gene            3193..3405
FT                   /locus_tag="GBAA_0003"
FT                   /old_locus_tag="GBAA0003"
FT   CDS_pept        3193..3405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0003"
FT                   /old_locus_tag="GBAA0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02988"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29081"
FT                   /db_xref="GOA:A0A0J1HKN0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HKN0"
FT                   /protein_id="AAT29081.2"
FT   gene            3418..4545
FT                   /gene="recF"
FT                   /locus_tag="GBAA_0004"
FT                   /old_locus_tag="GBAA0004"
FT   CDS_pept        3418..4545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="GBAA_0004"
FT                   /old_locus_tag="GBAA0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29082"
FT                   /db_xref="GOA:Q6I535"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I535"
FT                   /protein_id="AAT29082.1"
FT   gene            4584..6506
FT                   /gene="gyrB"
FT                   /locus_tag="GBAA_0005"
FT                   /old_locus_tag="GBAA0005"
FT   CDS_pept        4584..6506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="GBAA_0005"
FT                   /old_locus_tag="GBAA0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29083"
FT                   /db_xref="GOA:Q9X3Y6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9X3Y6"
FT                   /protein_id="AAT29083.1"
FT                   KNLDI"
FT   gene            6595..9066
FT                   /gene="gyrA"
FT                   /locus_tag="GBAA_0006"
FT                   /old_locus_tag="GBAA0006"
FT   CDS_pept        6595..9066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="GBAA_0006"
FT                   /old_locus_tag="GBAA0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29084"
FT                   /db_xref="GOA:A0A1S0QV11"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QV11"
FT                   /protein_id="AAT29084.1"
FT                   EETSEEVSSEE"
FT   gene            9335..10841
FT                   /gene="rrsA"
FT                   /locus_tag="GBAA_5958"
FT   rRNA            9335..10841
FT                   /gene="rrsA"
FT                   /locus_tag="GBAA_5958"
FT                   /product="16S ribosomal RNA"
FT   gene            10992..11068
FT                   /locus_tag="GBAA_5863"
FT   tRNA            10992..11068
FT                   /locus_tag="GBAA_5863"
FT                   /product="tRNA-Ile"
FT   gene            11077..11152
FT                   /locus_tag="GBAA_5864"
FT   tRNA            11077..11152
FT                   /locus_tag="GBAA_5864"
FT                   /product="tRNA-Ala"
FT   gene            11247..14154
FT                   /gene="rrlA"
FT                   /locus_tag="GBAA_5959"
FT   rRNA            11247..14154
FT                   /gene="rrlA"
FT                   /locus_tag="GBAA_5959"
FT                   /product="23S ribosomal RNA"
FT   gene            14203..14318
FT                   /gene="rrfA"
FT                   /locus_tag="GBAA_5960"
FT   rRNA            14203..14318
FT                   /gene="rrfA"
FT                   /locus_tag="GBAA_5960"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14353..15352)
FT                   /pseudo
FT                   /locus_tag="GBAA_0007"
FT                   /old_locus_tag="GBAA0007"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAU20221.1"
FT   gene            15468..16931
FT                   /gene="guaB"
FT                   /locus_tag="GBAA_0008"
FT                   /old_locus_tag="GBAA0008"
FT   CDS_pept        15468..16931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="GBAA_0008"
FT                   /old_locus_tag="GBAA0008"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM PF03060; match to protein family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29088"
FT                   /db_xref="GOA:A0A0J1HJU0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="PDB:3TSB"
FT                   /db_xref="PDB:3TSD"
FT                   /db_xref="PDB:3USB"
FT                   /db_xref="PDB:4MJM"
FT                   /db_xref="PDB:4MY1"
FT                   /db_xref="PDB:4MY8"
FT                   /db_xref="PDB:4MY9"
FT                   /db_xref="PDB:4MYA"
FT                   /db_xref="PDB:4MYX"
FT                   /db_xref="PDB:4QM1"
FT                   /db_xref="PDB:5URR"
FT                   /db_xref="PDB:5URS"
FT                   /db_xref="PDB:5UUV"
FT                   /db_xref="PDB:5UUW"
FT                   /db_xref="PDB:5UUZ"
FT                   /db_xref="PDB:6MGU"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HJU0"
FT                   /protein_id="AAT29088.1"
FT   gene            17045..18352
FT                   /gene="dacA"
FT                   /locus_tag="GBAA_0009"
FT                   /old_locus_tag="GBAA0009"
FT   CDS_pept        17045..18352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="GBAA_0009"
FT                   /old_locus_tag="GBAA0009"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase DacA"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF07943"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29089"
FT                   /db_xref="GOA:Q81W28"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q81W28"
FT                   /protein_id="AAT29089.1"
FT   gene            18514..19401
FT                   /locus_tag="GBAA_0010"
FT                   /old_locus_tag="GBAA0010"
FT   CDS_pept        18514..19401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0010"
FT                   /old_locus_tag="GBAA0010"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29090"
FT                   /db_xref="GOA:Q81W27"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W27"
FT                   /protein_id="AAT29090.1"
FT                   STLLPEQRMQERGW"
FT   gene            19420..20010
FT                   /locus_tag="GBAA_0011"
FT                   /old_locus_tag="GBAA0011"
FT   CDS_pept        19420..20010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0011"
FT                   /old_locus_tag="GBAA0011"
FT                   /product="glutamine amidotransferase, SNO family"
FT                   /note="identified by match to protein family HMM PF01174;
FT                   match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29091"
FT                   /db_xref="GOA:Q81W26"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W26"
FT                   /protein_id="AAT29091.1"
FT   gene            20338..21612
FT                   /gene="serS"
FT                   /locus_tag="GBAA_0012"
FT                   /old_locus_tag="GBAA0012"
FT   CDS_pept        20338..21612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="GBAA_0012"
FT                   /old_locus_tag="GBAA0012"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29092"
FT                   /db_xref="GOA:Q81W25"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W25"
FT                   /protein_id="AAT29092.1"
FT   gene            21769..21861
FT                   /locus_tag="GBAA_5865"
FT   tRNA            21769..21861
FT                   /locus_tag="GBAA_5865"
FT                   /product="tRNA-Ser"
FT   gene            21869..22420
FT                   /locus_tag="GBAA_0013"
FT                   /old_locus_tag="GBAA0013"
FT   CDS_pept        21869..22420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0013"
FT                   /old_locus_tag="GBAA0013"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29093"
FT                   /db_xref="GOA:A0A0F7R3E4"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR024256"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R3E4"
FT                   /protein_id="AAT29093.1"
FT   gene            complement(22456..23124)
FT                   /locus_tag="GBAA_0014"
FT                   /old_locus_tag="GBAA0014"
FT   CDS_pept        complement(22456..23124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0014"
FT                   /old_locus_tag="GBAA0014"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29094"
FT                   /db_xref="GOA:A0A1Q4M4H7"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4M4H7"
FT                   /protein_id="AAT29094.1"
FT                   "
FT   gene            complement(23127..23762)
FT                   /locus_tag="GBAA_0015"
FT                   /old_locus_tag="GBAA0015"
FT   CDS_pept        complement(23127..23762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0015"
FT                   /old_locus_tag="GBAA0015"
FT                   /product="deoxynucleoside kinase family protein"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01712"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29095"
FT                   /db_xref="GOA:A0A0J1KC17"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1KC17"
FT                   /protein_id="AAT29095.1"
FT   gene            complement(23888..24427)
FT                   /locus_tag="GBAA_0016"
FT                   /old_locus_tag="GBAA0016"
FT   CDS_pept        complement(23888..24427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0016"
FT                   /old_locus_tag="GBAA0016"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29096"
FT                   /db_xref="GOA:A0A1J9VDK4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VDK4"
FT                   /protein_id="AAT29096.1"
FT                   TTLKANIVPSSQIKFN"
FT   gene            24405..24545
FT                   /locus_tag="GBAA_0017"
FT                   /old_locus_tag="GBAA0017"
FT   CDS_pept        24405..24545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0017"
FT                   /old_locus_tag="GBAA0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35249"
FT                   /db_xref="GOA:A0A0J1HJT0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HJT0"
FT                   /protein_id="AAT35249.1"
FT                   T"
FT   gene            24535..25035
FT                   /locus_tag="GBAA_0018"
FT                   /old_locus_tag="GBAA0018"
FT   CDS_pept        24535..25035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0018"
FT                   /old_locus_tag="GBAA0018"
FT                   /product="cytidine/deoxycytidylate deaminase zinc-binding
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00383"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29097"
FT                   /db_xref="GOA:A0A1J9VDN5"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VDN5"
FT                   /protein_id="AAT29097.1"
FT                   NEN"
FT   gene            25512..27200
FT                   /gene="dnaX"
FT                   /locus_tag="GBAA_0019"
FT                   /old_locus_tag="GBAA0019"
FT   CDS_pept        25512..27200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="GBAA_0019"
FT                   /old_locus_tag="GBAA0019"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29098"
FT                   /db_xref="GOA:A0A0F7R3D8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R3D8"
FT                   /protein_id="AAT29098.1"
FT   gene            27223..27552
FT                   /locus_tag="GBAA_0020"
FT                   /old_locus_tag="GBAA0020"
FT   CDS_pept        27223..27552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0020"
FT                   /old_locus_tag="GBAA0020"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29099"
FT                   /db_xref="GOA:Q81W17"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W17"
FT                   /protein_id="AAT29099.1"
FT                   PGGMF"
FT   gene            27567..28163
FT                   /gene="recR"
FT                   /locus_tag="GBAA_0021"
FT                   /old_locus_tag="GBAA0021"
FT   CDS_pept        27567..28163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="GBAA_0021"
FT                   /old_locus_tag="GBAA0021"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29100"
FT                   /db_xref="GOA:Q81W16"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W16"
FT                   /protein_id="AAT29100.1"
FT   gene            28178..28399
FT                   /locus_tag="GBAA_0022"
FT                   /old_locus_tag="GBAA0022"
FT   CDS_pept        28178..28399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0022"
FT                   /old_locus_tag="GBAA0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29101"
FT                   /db_xref="GOA:A0A0F7R8J0"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8J0"
FT                   /protein_id="AAT29101.1"
FT   gene            28614..28883
FT                   /gene="bofA"
FT                   /locus_tag="GBAA_0024"
FT                   /old_locus_tag="GBAA0024"
FT   CDS_pept        28614..28883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="GBAA_0024"
FT                   /old_locus_tag="GBAA0024"
FT                   /product="sigma-k factor processing regulatory protein
FT                   BofA"
FT                   /note="identified by match to protein family HMM PF07441;
FT                   match to protein family HMM TIGR02862"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29102"
FT                   /db_xref="GOA:A0A1Q4M4J7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4M4J7"
FT                   /protein_id="AAT29102.1"
FT   gene            29129..30635
FT                   /gene="rrsB"
FT                   /locus_tag="GBAA_5961"
FT   rRNA            29129..30635
FT                   /gene="rrsB"
FT                   /locus_tag="GBAA_5961"
FT                   /product="16S ribosomal RNA"
FT   gene            30786..30862
FT                   /locus_tag="GBAA_5866"
FT   tRNA            30786..30862
FT                   /locus_tag="GBAA_5866"
FT                   /product="tRNA-Ile"
FT   gene            30871..30946
FT                   /locus_tag="GBAA_5867"
FT   tRNA            30871..30946
FT                   /locus_tag="GBAA_5867"
FT                   /product="tRNA-Ala"
FT   gene            31041..33948
FT                   /gene="rrlB"
FT                   /locus_tag="GBAA_5962"
FT   rRNA            31041..33948
FT                   /gene="rrlB"
FT                   /locus_tag="GBAA_5962"
FT                   /product="23S ribosomal RNA"
FT   gene            33997..34112
FT                   /gene="rrfB"
FT                   /locus_tag="GBAA_5963"
FT   rRNA            33997..34112
FT                   /gene="rrfB"
FT                   /locus_tag="GBAA_5963"
FT                   /product="5S ribosomal RNA"
FT   gene            34303..34482
FT                   /locus_tag="GBAA_0025"
FT                   /old_locus_tag="GBAA0025"
FT   CDS_pept        34303..34482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0025"
FT                   /old_locus_tag="GBAA0025"
FT                   /product="putative csfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29105"
FT                   /db_xref="GOA:A0A1Q4MAB0"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAB0"
FT                   /protein_id="AAT29105.1"
FT                   YYLKQLRKLEVSYF"
FT   gene            34554..35975
FT                   /locus_tag="GBAA_0026"
FT                   /old_locus_tag="GBAA0026"
FT   CDS_pept        34554..35975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0026"
FT                   /old_locus_tag="GBAA0026"
FT                   /product="Orn/Lys/Arg decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF01276;
FT                   match to protein family HMM PF03711"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29106"
FT                   /db_xref="GOA:A0A0F7R8N5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8N5"
FT                   /protein_id="AAT29106.1"
FT                   GSRKYMKVYDIESRF"
FT   gene            35977..36603
FT                   /gene="tmk"
FT                   /locus_tag="GBAA_0027"
FT                   /old_locus_tag="GBAA0027"
FT   CDS_pept        35977..36603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="GBAA_0027"
FT                   /old_locus_tag="GBAA0027"
FT                   /product="thymidylate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29107"
FT                   /db_xref="GOA:Q81W11"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W11"
FT                   /protein_id="AAT29107.1"
FT   gene            36639..37622
FT                   /gene="holB"
FT                   /locus_tag="GBAA_0028"
FT                   /old_locus_tag="GBAA0028"
FT   CDS_pept        36639..37622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="GBAA_0028"
FT                   /old_locus_tag="GBAA0028"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29108"
FT                   /db_xref="GOA:A0A0F7R9T5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9T5"
FT                   /protein_id="AAT29108.2"
FT   gene            37619..38455
FT                   /locus_tag="GBAA_0029"
FT                   /old_locus_tag="GBAA0029"
FT   CDS_pept        37619..38455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0029"
FT                   /old_locus_tag="GBAA0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04468"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29109"
FT                   /db_xref="GOA:A0A2A9AQ99"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A9AQ99"
FT                   /protein_id="AAT29109.1"
FT   gene            38470..38820
FT                   /locus_tag="GBAA_0030"
FT                   /old_locus_tag="GBAA0030"
FT   CDS_pept        38470..38820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0030"
FT                   /old_locus_tag="GBAA0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06156"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29110"
FT                   /db_xref="GOA:Q6I511"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I511"
FT                   /protein_id="AAT29110.2"
FT                   DCLFCLSFLNKK"
FT   gene            38941..39681
FT                   /locus_tag="GBAA_0031"
FT                   /old_locus_tag="GBAA0031"
FT   CDS_pept        38941..39681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0031"
FT                   /old_locus_tag="GBAA0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29111"
FT                   /db_xref="GOA:A0A0F7R8N1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8N1"
FT                   /protein_id="AAT29111.1"
FT   gene            39668..39958
FT                   /locus_tag="GBAA_0032"
FT                   /old_locus_tag="GBAA0032"
FT   CDS_pept        39668..39958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0032"
FT                   /old_locus_tag="GBAA0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:O31414; match to
FT                   protein family HMM PF01541"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29112"
FT                   /db_xref="GOA:Q81W06"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W06"
FT                   /protein_id="AAT29112.1"
FT   gene            39927..40802
FT                   /locus_tag="GBAA_0033"
FT                   /old_locus_tag="GBAA0033"
FT   CDS_pept        39927..40802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0033"
FT                   /old_locus_tag="GBAA0033"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29113"
FT                   /db_xref="GOA:A0A1S0QQW6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QQW6"
FT                   /protein_id="AAT29113.1"
FT                   VYQIYHVDKK"
FT   gene            complement(40823..41107)
FT                   /gene="abrB"
FT                   /locus_tag="GBAA_0034"
FT                   /old_locus_tag="GBAA0034"
FT   CDS_pept        complement(40823..41107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="GBAA_0034"
FT                   /old_locus_tag="GBAA0034"
FT                   /product="transition state transcriptional regulatory
FT                   protein AbrB"
FT                   /note="identified by similarity to SP:P08874; match to
FT                   protein family HMM PF04014; match to protein family HMM
FT                   TIGR01439"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29114"
FT                   /db_xref="GOA:Q81W04"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:Q81W04"
FT                   /protein_id="AAT29114.1"
FT   gene            41598..43580
FT                   /gene="metS"
FT                   /locus_tag="GBAA_0036"
FT                   /old_locus_tag="GBAA0036"
FT   CDS_pept        41598..43580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="GBAA_0036"
FT                   /old_locus_tag="GBAA0036"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF01588; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00398;
FT                   match to protein family HMM TIGR00399"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29115"
FT                   /db_xref="GOA:Q81W03"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W03"
FT                   /protein_id="AAT29115.2"
FT   gene            43746..44513
FT                   /locus_tag="GBAA_0037"
FT                   /old_locus_tag="GBAA0037"
FT   CDS_pept        43746..44513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0037"
FT                   /old_locus_tag="GBAA0037"
FT                   /product="deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29116"
FT                   /db_xref="GOA:A0A0J1HL23"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL23"
FT                   /protein_id="AAT29116.1"
FT   gene            44728..45285
FT                   /locus_tag="GBAA_0038"
FT                   /old_locus_tag="GBAA0038"
FT   CDS_pept        44728..45285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0038"
FT                   /old_locus_tag="GBAA0038"
FT                   /product="primase-related protein"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM TIGR00334"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29117"
FT                   /db_xref="GOA:Q81W01"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W01"
FT                   /protein_id="AAT29117.1"
FT   gene            45282..46160
FT                   /gene="ksgA"
FT                   /locus_tag="GBAA_0039"
FT                   /old_locus_tag="GBAA0039"
FT   CDS_pept        45282..46160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="GBAA_0039"
FT                   /old_locus_tag="GBAA0039"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29118"
FT                   /db_xref="GOA:Q81W00"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81W00"
FT                   /protein_id="AAT29118.1"
FT                   LSNALVLHKLS"
FT   gene            46271..47134
FT                   /locus_tag="GBAA_0040"
FT                   /old_locus_tag="GBAA0040"
FT   CDS_pept        46271..47134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0040"
FT                   /old_locus_tag="GBAA0040"
FT                   /product="yabG protein"
FT                   /note="identified by match to protein family HMM PF05582;
FT                   match to protein family HMM TIGR02855"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29119"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9UVM1"
FT                   /protein_id="AAT29119.1"
FT                   FQHYEE"
FT   gene            47373..47633
FT                   /locus_tag="GBAA_0041"
FT                   /old_locus_tag="GBAA0041"
FT   CDS_pept        47373..47633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0041"
FT                   /old_locus_tag="GBAA0041"
FT                   /product="veg protein"
FT                   /note="identified by match to protein family HMM PF06257"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29120"
FT                   /db_xref="GOA:A0A0J1HL34"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL34"
FT                   /protein_id="AAT29120.1"
FT   gene            47725..47904
FT                   /gene="sspF"
FT                   /locus_tag="GBAA_0042"
FT                   /old_locus_tag="GBAA0042"
FT   CDS_pept        47725..47904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="GBAA_0042"
FT                   /old_locus_tag="GBAA0042"
FT                   /product="small, acid-soluble spore protein"
FT                   /note="identified by match to protein family HMM PF00269"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29121"
FT                   /db_xref="GOA:A0A1T3UU57"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UU57"
FT                   /protein_id="AAT29121.2"
FT                   AIEIAEQQLMKQNQ"
FT   gene            48101..48970
FT                   /gene="ispE"
FT                   /locus_tag="GBAA_0043"
FT                   /old_locus_tag="GBAA0043"
FT   CDS_pept        48101..48970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="GBAA_0043"
FT                   /old_locus_tag="GBAA0043"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29122"
FT                   /db_xref="GOA:Q81VZ6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ6"
FT                   /protein_id="AAT29122.2"
FT                   LGERETLE"
FT   gene            49025..49873
FT                   /gene="purR"
FT                   /locus_tag="GBAA_0044"
FT                   /old_locus_tag="GBAA0044"
FT   CDS_pept        49025..49873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="GBAA_0044"
FT                   /old_locus_tag="GBAA0044"
FT                   /product="pur operon repressor"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF09182; match to protein
FT                   family HMM TIGR01743"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29123"
FT                   /db_xref="GOA:A0A1Q4MAA7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAA7"
FT                   /protein_id="AAT29123.1"
FT                   E"
FT   gene            49860..49979
FT                   /locus_tag="GBAA_0045"
FT                   /old_locus_tag="GBAA0045"
FT   CDS_pept        49860..49979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0045"
FT                   /old_locus_tag="GBAA0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35250"
FT                   /db_xref="GOA:Q81VZ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VZ4"
FT                   /protein_id="AAT35250.1"
FT   gene            49996..50370
FT                   /locus_tag="GBAA_0046"
FT                   /old_locus_tag="GBAA0046"
FT   CDS_pept        49996..50370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0046"
FT                   /old_locus_tag="GBAA0046"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042;
FT                   match to protein family HMM TIGR00004"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29124"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9X3B1"
FT                   /protein_id="AAT29124.1"
FT   gene            50523..50816
FT                   /gene="spoVG"
FT                   /locus_tag="GBAA_0047"
FT                   /old_locus_tag="GBAA0047"
FT   CDS_pept        50523..50816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="GBAA_0047"
FT                   /old_locus_tag="GBAA0047"
FT                   /product="stage V sporulation protein G"
FT                   /note="identified by match to protein family HMM PF04026"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29125"
FT                   /db_xref="GOA:Q81VZ2"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ2"
FT                   /protein_id="AAT29125.2"
FT   gene            51139..52518
FT                   /gene="gcaD"
FT                   /locus_tag="GBAA_0048"
FT                   /old_locus_tag="GBAA0048"
FT   CDS_pept        51139..52518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="GBAA_0048"
FT                   /old_locus_tag="GBAA0048"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29126"
FT                   /db_xref="GOA:Q81VZ1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ1"
FT                   /protein_id="AAT29126.1"
FT                   S"
FT   gene            52537..53490
FT                   /gene="prsA"
FT                   /locus_tag="GBAA_0049"
FT                   /old_locus_tag="GBAA0049"
FT   CDS_pept        52537..53490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="GBAA_0049"
FT                   /old_locus_tag="GBAA0049"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29127"
FT                   /db_xref="GOA:Q81VZ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VZ0"
FT                   /protein_id="AAT29127.1"
FT   gene            53563..54123
FT                   /gene="spoVC"
FT                   /locus_tag="GBAA_0050"
FT                   /old_locus_tag="GBAA0050"
FT   CDS_pept        53563..54123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="GBAA_0050"
FT                   /old_locus_tag="GBAA0050"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29128"
FT                   /db_xref="GOA:Q81VY9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VY9"
FT                   /protein_id="AAT29128.1"
FT   gene            54194..54418
FT                   /locus_tag="GBAA_0051"
FT                   /old_locus_tag="GBAA0051"
FT   CDS_pept        54194..54418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0051"
FT                   /old_locus_tag="GBAA0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29129"
FT                   /db_xref="GOA:A0A1J9WZU1"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WZU1"
FT                   /protein_id="AAT29129.1"
FT   gene            54524..58054
FT                   /gene="mfd"
FT                   /locus_tag="GBAA_0052"
FT                   /old_locus_tag="GBAA0052"
FT   CDS_pept        54524..58054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="GBAA_0052"
FT                   /old_locus_tag="GBAA0052"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM PF04851; match to protein
FT                   family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29130"
FT                   /db_xref="GOA:Q81VY7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VY7"
FT                   /protein_id="AAT29130.1"
FT                   PDVKKEVINA"
FT   gene            58190..58726
FT                   /gene="spoVT"
FT                   /locus_tag="GBAA_0053"
FT                   /old_locus_tag="GBAA0053"
FT   CDS_pept        58190..58726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="GBAA_0053"
FT                   /old_locus_tag="GBAA0053"
FT                   /product="stage V sporulation protein T"
FT                   /note="identified by match to protein family HMM PF04014;
FT                   match to protein family HMM TIGR01439; match to protein
FT                   family HMM TIGR02851"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29131"
FT                   /db_xref="GOA:A0A0F7R8L2"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8L2"
FT                   /protein_id="AAT29131.1"
FT                   AVNTAASFLAKQMEQ"
FT   gene            58957..60558
FT                   /locus_tag="GBAA_0054"
FT                   /old_locus_tag="GBAA0054"
FT   CDS_pept        58957..60558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0054"
FT                   /old_locus_tag="GBAA0054"
FT                   /product="polysaccharide synthase family protein"
FT                   /note="identified by match to protein family HMM PF01943"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29132"
FT                   /db_xref="GOA:Q81VY5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VY5"
FT                   /protein_id="AAT29132.1"
FT                   TVMKKEKKEGSLKKSG"
FT   gene            60571..62031
FT                   /locus_tag="GBAA_0055"
FT                   /old_locus_tag="GBAA0055"
FT   CDS_pept        60571..62031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0055"
FT                   /old_locus_tag="GBAA0055"
FT                   /product="tetrapyrrole methylase family protein/MazG family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF03819; match to protein
FT                   family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29133"
FT                   /db_xref="GOA:A0A1J9WJC9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WJC9"
FT                   /protein_id="AAT29133.2"
FT   gene            62046..62321
FT                   /locus_tag="GBAA_0056"
FT                   /old_locus_tag="GBAA0056"
FT   CDS_pept        62046..62321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0056"
FT                   /old_locus_tag="GBAA0056"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29134"
FT                   /db_xref="GOA:A0A1J9X3B9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9X3B9"
FT                   /protein_id="AAT29134.1"
FT   gene            62380..62688
FT                   /gene="yabP"
FT                   /locus_tag="GBAA_0057"
FT                   /old_locus_tag="GBAA0057"
FT   CDS_pept        62380..62688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="GBAA_0057"
FT                   /old_locus_tag="GBAA0057"
FT                   /product="sporulation protein YabP"
FT                   /note="identified by match to protein family HMM PF07873;
FT                   match to protein family HMM TIGR02892"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29135"
FT                   /db_xref="GOA:Q81VY2"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VY2"
FT                   /protein_id="AAT29135.2"
FT   gene            62685..63338
FT                   /gene="yabQ"
FT                   /locus_tag="GBAA_0058"
FT                   /old_locus_tag="GBAA0058"
FT   CDS_pept        62685..63338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="GBAA_0058"
FT                   /old_locus_tag="GBAA0058"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="identified by match to protein family HMM TIGR02893"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29136"
FT                   /db_xref="GOA:A0A1Q4MAD2"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAD2"
FT                   /protein_id="AAT29136.1"
FT   gene            63335..63694
FT                   /gene="divIC1"
FT                   /locus_tag="GBAA_0059"
FT                   /old_locus_tag="GBAA0059"
FT   CDS_pept        63335..63694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC1"
FT                   /locus_tag="GBAA_0059"
FT                   /old_locus_tag="GBAA0059"
FT                   /product="cell division protein DivIC"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29137"
FT                   /db_xref="GOA:A0A0J1HL39"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL39"
FT                   /protein_id="AAT29137.1"
FT                   YFFSGKGEIIFPVSK"
FT   gene            63782..64264
FT                   /locus_tag="GBAA_0060"
FT                   /old_locus_tag="GBAA0060"
FT   CDS_pept        63782..64264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0060"
FT                   /old_locus_tag="GBAA0060"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29138"
FT                   /db_xref="GOA:A0A1J9VSV5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VSV5"
FT                   /protein_id="AAT29138.1"
FT   gene            64425..64498
FT                   /locus_tag="GBAA_5868"
FT   tRNA            64425..64498
FT                   /locus_tag="GBAA_5868"
FT                   /product="tRNA-Met"
FT   gene            64512..64583
FT                   /locus_tag="GBAA_5869"
FT   tRNA            64512..64583
FT                   /locus_tag="GBAA_5869"
FT                   /product="tRNA-Glu"
FT   gene            64936..67314
FT                   /gene="spoIIE"
FT                   /locus_tag="GBAA_0061"
FT                   /old_locus_tag="GBAA0061"
FT   CDS_pept        64936..67314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="GBAA_0061"
FT                   /old_locus_tag="GBAA0061"
FT                   /product="stage II sporulation protein E"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF07228;
FT                   match to protein family HMM TIGR02865"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29139"
FT                   /db_xref="GOA:Q81VX8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VX8"
FT                   /protein_id="AAT29139.1"
FT   gene            67548..68978
FT                   /gene="tilS"
FT                   /locus_tag="GBAA_0062"
FT                   /old_locus_tag="GBAA0062"
FT   CDS_pept        67548..68978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="GBAA_0062"
FT                   /old_locus_tag="GBAA0062"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR02432; match to protein family HMM
FT                   TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29140"
FT                   /db_xref="GOA:Q81VX7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX7"
FT                   /protein_id="AAT29140.1"
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            68978..69517
FT                   /gene="hpt"
FT                   /locus_tag="GBAA_0063"
FT                   /old_locus_tag="GBAA0063"
FT   CDS_pept        68978..69517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="GBAA_0063"
FT                   /old_locus_tag="GBAA0063"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29141"
FT                   /db_xref="GOA:B9ZW32"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="PDB:3HVU"
FT                   /db_xref="PDB:3KB8"
FT                   /db_xref="PDB:6D9Q"
FT                   /db_xref="PDB:6D9R"
FT                   /db_xref="PDB:6D9S"
FT                   /db_xref="UniProtKB/TrEMBL:B9ZW32"
FT                   /protein_id="AAT29141.2"
FT                   RNLPYVGVLKPSVYSN"
FT   gene            69603..71504
FT                   /gene="ftsH"
FT                   /locus_tag="GBAA_0064"
FT                   /old_locus_tag="GBAA0064"
FT   CDS_pept        69603..71504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="GBAA_0064"
FT                   /old_locus_tag="GBAA0064"
FT                   /product="cell division protein FtsH"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29142"
FT                   /db_xref="GOA:A0A0J1HL43"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL43"
FT                   /protein_id="AAT29142.1"
FT   gene            71729..72517
FT                   /locus_tag="GBAA_0065"
FT                   /old_locus_tag="GBAA0065"
FT   CDS_pept        71729..72517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0065"
FT                   /old_locus_tag="GBAA0065"
FT                   /product="putative transcriptional activator, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29143"
FT                   /db_xref="GOA:Q81VX4"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="PDB:2H3G"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX4"
FT                   /protein_id="AAT29143.2"
FT   gene            72524..73399
FT                   /gene="hslO"
FT                   /locus_tag="GBAA_0066"
FT                   /old_locus_tag="GBAA0066"
FT   CDS_pept        72524..73399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="GBAA_0066"
FT                   /old_locus_tag="GBAA0066"
FT                   /product="chaperonin, 33 kDa"
FT                   /note="identified by match to protein family HMM PF01430"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29144"
FT                   /db_xref="GOA:Q81VX3"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VX3"
FT                   /protein_id="AAT29144.1"
FT                   EDITNLIENL"
FT   gene            73504..74427
FT                   /gene="cysK1"
FT                   /locus_tag="GBAA_0067"
FT                   /old_locus_tag="GBAA0067"
FT   CDS_pept        73504..74427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="GBAA_0067"
FT                   /old_locus_tag="GBAA0067"
FT                   /product="cysteine synthase A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR01136; match to protein
FT                   family HMM TIGR01139"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29145"
FT                   /db_xref="GOA:A0A1S0QPD6"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QPD6"
FT                   /protein_id="AAT29145.1"
FT   gene            74648..76045
FT                   /gene="pabB"
FT                   /locus_tag="GBAA_0068"
FT                   /old_locus_tag="GBAA0068"
FT   CDS_pept        74648..76045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="GBAA_0068"
FT                   /old_locus_tag="GBAA0068"
FT                   /product="para-aminobenzoate synthase, component I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29146"
FT                   /db_xref="GOA:A0A1Q4MAE2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAE2"
FT                   /protein_id="AAT29146.1"
FT                   RSEETVR"
FT   gene            76051..76638
FT                   /gene="pabA"
FT                   /locus_tag="GBAA_0069"
FT                   /old_locus_tag="GBAA0069"
FT   CDS_pept        76051..76638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="GBAA_0069"
FT                   /old_locus_tag="GBAA0069"
FT                   /product="para-aminobenzoate synthase, glutamine
FT                   amidotransferase component"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29147"
FT                   /db_xref="GOA:A0A0J1HL48"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HL48"
FT                   /protein_id="AAT29147.1"
FT   gene            76632..77504
FT                   /gene="pabC"
FT                   /locus_tag="GBAA_0070"
FT                   /old_locus_tag="GBAA0070"
FT   CDS_pept        76632..77504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="GBAA_0070"
FT                   /old_locus_tag="GBAA0070"
FT                   /product="4-amino-4-deoxychorismate lyase PabC"
FT                   /note="identified by match to protein family HMM PF01063"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29148"
FT                   /db_xref="GOA:A0A0F7R9M6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9M6"
FT                   /protein_id="AAT29148.1"
FT                   RNELRRGDV"
FT   gene            77497..78339
FT                   /gene="folP"
FT                   /locus_tag="GBAA_0071"
FT                   /old_locus_tag="GBAA0071"
FT   CDS_pept        77497..78339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="GBAA_0071"
FT                   /old_locus_tag="GBAA0071"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29149"
FT                   /db_xref="GOA:Q81VW8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="PDB:1TWS"
FT                   /db_xref="PDB:1TWW"
FT                   /db_xref="PDB:1TWZ"
FT                   /db_xref="PDB:1TX0"
FT                   /db_xref="PDB:1TX2"
FT                   /db_xref="PDB:3H21"
FT                   /db_xref="PDB:3H22"
FT                   /db_xref="PDB:3H23"
FT                   /db_xref="PDB:3H24"
FT                   /db_xref="PDB:3H26"
FT                   /db_xref="PDB:3H2A"
FT                   /db_xref="PDB:3H2C"
FT                   /db_xref="PDB:3H2E"
FT                   /db_xref="PDB:3H2F"
FT                   /db_xref="PDB:3H2M"
FT                   /db_xref="PDB:3H2N"
FT                   /db_xref="PDB:3H2O"
FT                   /db_xref="PDB:3TYA"
FT                   /db_xref="PDB:3TYB"
FT                   /db_xref="PDB:3TYC"
FT                   /db_xref="PDB:3TYD"
FT                   /db_xref="PDB:3TYE"
FT                   /db_xref="PDB:4D8A"
FT                   /db_xref="PDB:4D8Z"
FT                   /db_xref="PDB:4D9P"
FT                   /db_xref="PDB:4DAF"
FT                   /db_xref="PDB:4DAI"
FT                   /db_xref="PDB:4DB7"
FT                   /db_xref="PDB:4NHV"
FT                   /db_xref="PDB:4NIL"
FT                   /db_xref="PDB:4NIR"
FT                   /db_xref="PDB:4NL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VW8"
FT                   /protein_id="AAT29149.1"
FT   gene            78340..78702
FT                   /gene="folB"
FT                   /locus_tag="GBAA_0072"
FT                   /old_locus_tag="GBAA0072"
FT   CDS_pept        78340..78702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="GBAA_0072"
FT                   /old_locus_tag="GBAA0072"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02152;
FT                   match to protein family HMM TIGR00525; match to protein
FT                   family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29150"
FT                   /db_xref="GOA:A0A1S0QSG1"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="PDB:5F3M"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QSG1"
FT                   /protein_id="AAT29150.2"
FT                   PGHYRAVAVEITRERP"
FT   gene            78699..79214
FT                   /gene="folK"
FT                   /locus_tag="GBAA_0073"
FT                   /old_locus_tag="GBAA0073"
FT   CDS_pept        78699..79214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="GBAA_0073"
FT                   /old_locus_tag="GBAA0073"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29151"
FT                   /db_xref="GOA:A0A1S0QT16"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QT16"
FT                   /protein_id="AAT29151.1"
FT                   DAFVLFEN"
FT   gene            79166..79369
FT                   /locus_tag="GBAA_0074"
FT                   /old_locus_tag="GBAA0074"
FT   CDS_pept        79166..79369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0074"
FT                   /old_locus_tag="GBAA0074"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29152"
FT                   /db_xref="GOA:A0A1J9W3B5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W3B5"
FT                   /protein_id="AAT29152.1"
FT   gene            79417..80391
FT                   /locus_tag="GBAA_0075"
FT                   /old_locus_tag="GBAA0075"
FT   CDS_pept        79417..80391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0075"
FT                   /old_locus_tag="GBAA0075"
FT                   /product="putative TIM-barrel protein, NifR3 family"
FT                   /note="identified by match to protein family HMM PF01207;
FT                   match to protein family HMM TIGR00737"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29153"
FT                   /db_xref="GOA:D1MPU9"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D1MPU9"
FT                   /protein_id="AAT29153.1"
FT   gene            80551..82050
FT                   /gene="lysS"
FT                   /locus_tag="GBAA_0076"
FT                   /old_locus_tag="GBAA0076"
FT   CDS_pept        80551..82050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="GBAA_0076"
FT                   /old_locus_tag="GBAA0076"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29154"
FT                   /db_xref="GOA:Q81VW3"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW3"
FT                   /protein_id="AAT29154.1"
FT   gene            82451..83957
FT                   /gene="rrsC"
FT                   /locus_tag="GBAA_5964"
FT   rRNA            82451..83957
FT                   /gene="rrsC"
FT                   /locus_tag="GBAA_5964"
FT                   /product="16S ribosomal RNA"
FT   gene            84136..87043
FT                   /gene="rrlC"
FT                   /locus_tag="GBAA_5965"
FT   rRNA            84136..87043
FT                   /gene="rrlC"
FT                   /locus_tag="GBAA_5965"
FT                   /product="23S ribosomal RNA"
FT   gene            87093..87208
FT                   /gene="rrfC"
FT                   /locus_tag="GBAA_5966"
FT   rRNA            87093..87208
FT                   /gene="rrfC"
FT                   /locus_tag="GBAA_5966"
FT                   /product="5S ribosomal RNA"
FT   gene            87415..87876
FT                   /gene="ctsR"
FT                   /locus_tag="GBAA_0077"
FT                   /old_locus_tag="GBAA0077"
FT   CDS_pept        87415..87876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="GBAA_0077"
FT                   /old_locus_tag="GBAA0077"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="identified by match to protein family HMM PF05848"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29157"
FT                   /db_xref="GOA:A0A1J9VQ35"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VQ35"
FT                   /protein_id="AAT29157.1"
FT   gene            88050..88598
FT                   /locus_tag="GBAA_0078"
FT                   /old_locus_tag="GBAA0078"
FT   CDS_pept        88050..88598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0078"
FT                   /old_locus_tag="GBAA0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02151"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29158"
FT                   /db_xref="GOA:Q81VW1"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VW1"
FT                   /protein_id="AAT29158.1"
FT   gene            88603..89667
FT                   /locus_tag="GBAA_0079"
FT                   /old_locus_tag="GBAA0079"
FT   CDS_pept        88603..89667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0079"
FT                   /old_locus_tag="GBAA0079"
FT                   /product="phosphotransferase domain protein"
FT                   /note="identified by match to protein family HMM PF00217"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29159"
FT                   /db_xref="GOA:Q81VW0"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VW0"
FT                   /protein_id="AAT29159.1"
FT                   RATLIRERLRIEKN"
FT   gene            89690..92125
FT                   /locus_tag="GBAA_0080"
FT                   /old_locus_tag="GBAA0080"
FT   CDS_pept        89690..92125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0080"
FT                   /old_locus_tag="GBAA0080"
FT                   /product="negative regulator of genetic competence
FT                   ClpC/MecB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861; match to protein family HMM PF07724;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29160"
FT                   /db_xref="GOA:A0A0J1HLL8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLL8"
FT                   /protein_id="AAT29160.1"
FT   gene            92222..93598
FT                   /gene="radA"
FT                   /locus_tag="GBAA_0081"
FT                   /old_locus_tag="GBAA0081"
FT   CDS_pept        92222..93598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="GBAA_0081"
FT                   /old_locus_tag="GBAA0081"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29161"
FT                   /db_xref="GOA:A0A2A8KN63"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KN63"
FT                   /protein_id="AAT29161.1"
FT                   "
FT   gene            93602..94675
FT                   /locus_tag="GBAA_0082"
FT                   /old_locus_tag="GBAA0082"
FT   CDS_pept        93602..94675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0082"
FT                   /old_locus_tag="GBAA0082"
FT                   /product="putative DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29162"
FT                   /db_xref="GOA:Q81VV7"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV7"
FT                   /protein_id="AAT29162.1"
FT                   REGLKRIQEHLYMSRHN"
FT   gene            94836..95945
FT                   /locus_tag="GBAA_0083"
FT                   /old_locus_tag="GBAA0083"
FT   CDS_pept        94836..95945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0083"
FT                   /old_locus_tag="GBAA0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01850;
FT                   match to protein family HMM PF01938"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29163"
FT                   /db_xref="GOA:A0A1J9VQU0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VQU0"
FT                   /protein_id="AAT29163.1"
FT   gene            95962..96642
FT                   /gene="ispD"
FT                   /locus_tag="GBAA_0084"
FT                   /old_locus_tag="GBAA0084"
FT   CDS_pept        95962..96642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="GBAA_0084"
FT                   /old_locus_tag="GBAA0084"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29164"
FT                   /db_xref="GOA:Q81VV5"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV5"
FT                   /protein_id="AAT29164.1"
FT                   VQKK"
FT   gene            96757..97233
FT                   /gene="ispF"
FT                   /locus_tag="GBAA_0085"
FT                   /old_locus_tag="GBAA0085"
FT   CDS_pept        96757..97233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="GBAA_0085"
FT                   /old_locus_tag="GBAA0085"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29165"
FT                   /db_xref="GOA:Q81VV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV4"
FT                   /protein_id="AAT29165.1"
FT   gene            97323..98780
FT                   /gene="gltX"
FT                   /locus_tag="GBAA_0086"
FT                   /old_locus_tag="GBAA0086"
FT   CDS_pept        97323..98780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="GBAA_0086"
FT                   /old_locus_tag="GBAA0086"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29166"
FT                   /db_xref="GOA:Q81VV3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV3"
FT                   /protein_id="AAT29166.1"
FT   gene            99213..99878
FT                   /gene="cysE"
FT                   /locus_tag="GBAA_0088"
FT                   /old_locus_tag="GBAA0088"
FT   CDS_pept        99213..99878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="GBAA_0088"
FT                   /old_locus_tag="GBAA0088"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01172"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29167"
FT                   /db_xref="GOA:A0A1S0QPL9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QPL9"
FT                   /protein_id="AAT29167.1"
FT   gene            99859..101256
FT                   /gene="cysS"
FT                   /locus_tag="GBAA_0089"
FT                   /old_locus_tag="GBAA0089"
FT   CDS_pept        99859..101256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="GBAA_0089"
FT                   /old_locus_tag="GBAA0089"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29168"
FT                   /db_xref="GOA:Q81VV1"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VV1"
FT                   /protein_id="AAT29168.1"
FT                   GTRWKRG"
FT   gene            101259..101666
FT                   /locus_tag="GBAA_0090"
FT                   /old_locus_tag="GBAA0090"
FT   CDS_pept        101259..101666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0090"
FT                   /old_locus_tag="GBAA0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00636"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29169"
FT                   /db_xref="GOA:A0A1Q4MAS7"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAS7"
FT                   /protein_id="AAT29169.1"
FT   gene            101663..102406
FT                   /locus_tag="GBAA_0091"
FT                   /old_locus_tag="GBAA0091"
FT   CDS_pept        101663..102406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0091"
FT                   /old_locus_tag="GBAA0091"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29170"
FT                   /db_xref="GOA:Q81VU9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VU9"
FT                   /protein_id="AAT29170.1"
FT   gene            102410..102922
FT                   /locus_tag="GBAA_0092"
FT                   /old_locus_tag="GBAA0092"
FT   CDS_pept        102410..102922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0092"
FT                   /old_locus_tag="GBAA0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05991"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29171"
FT                   /db_xref="GOA:A0A1Q4MAL3"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAL3"
FT                   /protein_id="AAT29171.1"
FT                   KLRRGER"
FT   gene            102990..103646
FT                   /gene="sigH"
FT                   /locus_tag="GBAA_0093"
FT                   /old_locus_tag="GBAA0093"
FT   CDS_pept        102990..103646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="GBAA_0093"
FT                   /old_locus_tag="GBAA0093"
FT                   /product="RNA polymerase sigma-30 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02859; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29172"
FT                   /db_xref="GOA:A0A0J1HLT1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLT1"
FT                   /protein_id="AAT29172.1"
FT   gene            103778..103924
FT                   /gene="rpmG1"
FT                   /locus_tag="GBAA_0094"
FT                   /old_locus_tag="GBAA0094"
FT   CDS_pept        103778..103924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG1"
FT                   /locus_tag="GBAA_0094"
FT                   /old_locus_tag="GBAA0094"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35251"
FT                   /db_xref="GOA:Q81VU6"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU6"
FT                   /protein_id="AAT35251.1"
FT                   ETK"
FT   gene            103957..104136
FT                   /locus_tag="GBAA_0095"
FT                   /old_locus_tag="GBAA0095"
FT   CDS_pept        103957..104136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0095"
FT                   /old_locus_tag="GBAA0095"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29173"
FT                   /db_xref="GOA:A0A0J1HLT7"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLT7"
FT                   /protein_id="AAT29173.1"
FT                   VDMGISSLIRLILG"
FT   gene            104268..104801
FT                   /gene="nusG"
FT                   /locus_tag="GBAA_0096"
FT                   /old_locus_tag="GBAA0096"
FT   CDS_pept        104268..104801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="GBAA_0096"
FT                   /old_locus_tag="GBAA0096"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM PF02357; match to protein
FT                   family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29174"
FT                   /db_xref="GOA:A0A0J1HLN0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLN0"
FT                   /protein_id="AAT29174.2"
FT                   ETPVELDFHQIEKL"
FT   gene            104969..105394
FT                   /gene="rplK"
FT                   /locus_tag="GBAA_0097"
FT                   /old_locus_tag="GBAA0097"
FT   CDS_pept        104969..105394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="GBAA_0097"
FT                   /old_locus_tag="GBAA0097"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29175"
FT                   /db_xref="GOA:Q81VU3"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU3"
FT                   /protein_id="AAT29175.2"
FT   gene            105572..106264
FT                   /gene="rplA"
FT                   /locus_tag="GBAA_0098"
FT                   /old_locus_tag="GBAA0098"
FT   CDS_pept        105572..106264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="GBAA_0098"
FT                   /old_locus_tag="GBAA0098"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29176"
FT                   /db_xref="GOA:Q81VU2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU2"
FT                   /protein_id="AAT29176.1"
FT                   RVDVSTLA"
FT   gene            106497..106997
FT                   /gene="rplJ"
FT                   /locus_tag="GBAA_0099"
FT                   /old_locus_tag="GBAA0099"
FT   CDS_pept        106497..106997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="GBAA_0099"
FT                   /old_locus_tag="GBAA0099"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29178"
FT                   /db_xref="GOA:Q81VU1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU1"
FT                   /protein_id="AAT29178.1"
FT                   QGA"
FT   gene            107065..107424
FT                   /gene="rplL"
FT                   /locus_tag="GBAA_0100"
FT                   /old_locus_tag="GBAA0100"
FT   CDS_pept        107065..107424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="GBAA_0100"
FT                   /old_locus_tag="GBAA0100"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29179"
FT                   /db_xref="GOA:Q81VU0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VU0"
FT                   /protein_id="AAT29179.1"
FT                   IKAKLEEVGAAVEVK"
FT   gene            107499..108098
FT                   /locus_tag="GBAA_0101"
FT                   /old_locus_tag="GBAA0101"
FT   CDS_pept        107499..108098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0101"
FT                   /old_locus_tag="GBAA0101"
FT                   /product="ybxB protein"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29180"
FT                   /db_xref="GOA:A0A0F7R9K2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9K2"
FT                   /protein_id="AAT29180.1"
FT   gene            108391..111924
FT                   /gene="rpoB"
FT                   /locus_tag="GBAA_0102"
FT                   /old_locus_tag="GBAA0102"
FT   CDS_pept        108391..111924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="GBAA_0102"
FT                   /old_locus_tag="GBAA0102"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565; match to protein
FT                   family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT70113"
FT                   /db_xref="GOA:Q81VT8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT8"
FT                   /protein_id="AAT70113.1"
FT                   KLNVEVETTKE"
FT   gene            111989..115573
FT                   /gene="rpoC"
FT                   /locus_tag="GBAA_0103"
FT                   /old_locus_tag="GBAA0103"
FT   CDS_pept        111989..115573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="GBAA_0103"
FT                   /old_locus_tag="GBAA0103"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29183"
FT                   /db_xref="GOA:P77819"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:P77819"
FT                   /protein_id="AAT29183.1"
FT   gene            115687..115935
FT                   /locus_tag="GBAA_0104"
FT                   /old_locus_tag="GBAA0104"
FT   CDS_pept        115687..115935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0104"
FT                   /old_locus_tag="GBAA0104"
FT                   /product="ribosomal protein L7A family"
FT                   /note="identified by match to protein family HMM PF01248"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29184"
FT                   /db_xref="GOA:A0A1J9W5Q2"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W5Q2"
FT                   /protein_id="AAT29184.2"
FT   gene            116050..116472
FT                   /gene="rpsL"
FT                   /locus_tag="GBAA_0105"
FT                   /old_locus_tag="GBAA0105"
FT   CDS_pept        116050..116472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="GBAA_0105"
FT                   /old_locus_tag="GBAA0105"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29185"
FT                   /db_xref="GOA:Q81VT5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT5"
FT                   /protein_id="AAT29185.1"
FT   gene            116502..116972
FT                   /gene="rpsG"
FT                   /locus_tag="GBAA_0106"
FT                   /old_locus_tag="GBAA0106"
FT   CDS_pept        116502..116972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="GBAA_0106"
FT                   /old_locus_tag="GBAA0106"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29186"
FT                   /db_xref="GOA:Q81VT4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT4"
FT                   /protein_id="AAT29186.1"
FT   gene            117180..119258
FT                   /gene="fusA"
FT                   /locus_tag="GBAA_0107"
FT                   /old_locus_tag="GBAA0107"
FT   CDS_pept        117180..119258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="GBAA_0107"
FT                   /old_locus_tag="GBAA0107"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29187"
FT                   /db_xref="GOA:Q81VT3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT3"
FT                   /protein_id="AAT29187.1"
FT   gene            119376..120563
FT                   /gene="tuf"
FT                   /locus_tag="GBAA_0108"
FT                   /old_locus_tag="GBAA0108"
FT   CDS_pept        119376..120563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="GBAA_0108"
FT                   /old_locus_tag="GBAA0108"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29188"
FT                   /db_xref="GOA:Q81VT2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT2"
FT                   /protein_id="AAT29188.1"
FT   gene            120962..121270
FT                   /gene="rpsJ"
FT                   /locus_tag="GBAA_0109"
FT                   /old_locus_tag="GBAA0109"
FT   CDS_pept        120962..121270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="GBAA_0109"
FT                   /old_locus_tag="GBAA0109"
FT                   /product="ribosomal protein S10"
FT                   /note="identified by match to protein family HMM PF00338;
FT                   match to protein family HMM TIGR01049"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29189"
FT                   /db_xref="GOA:Q81VT1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT1"
FT                   /protein_id="AAT29189.1"
FT   gene            121305..121937
FT                   /gene="rplC"
FT                   /locus_tag="GBAA_0110"
FT                   /old_locus_tag="GBAA0110"
FT   CDS_pept        121305..121937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="GBAA_0110"
FT                   /old_locus_tag="GBAA0110"
FT                   /product="ribosomal protein L3"
FT                   /note="identified by match to protein family HMM PF00297"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29190"
FT                   /db_xref="GOA:Q81VT0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VT0"
FT                   /protein_id="AAT29190.1"
FT   gene            121963..122586
FT                   /gene="rplD"
FT                   /locus_tag="GBAA_0111"
FT                   /old_locus_tag="GBAA0111"
FT   CDS_pept        121963..122586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="GBAA_0111"
FT                   /old_locus_tag="GBAA0111"
FT                   /product="ribosomal protein L4"
FT                   /note="identified by match to protein family HMM PF00573"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29191"
FT                   /db_xref="GOA:Q81VS9"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS9"
FT                   /protein_id="AAT29191.1"
FT   gene            122586..122876
FT                   /gene="rplW"
FT                   /locus_tag="GBAA_0112"
FT                   /old_locus_tag="GBAA0112"
FT   CDS_pept        122586..122876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="GBAA_0112"
FT                   /old_locus_tag="GBAA0112"
FT                   /product="ribosomal protein L23"
FT                   /note="identified by match to protein family HMM PF00276"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29192"
FT                   /db_xref="GOA:Q81VS8"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS8"
FT                   /protein_id="AAT29192.1"
FT   gene            122905..123735
FT                   /gene="rplB"
FT                   /locus_tag="GBAA_0113"
FT                   /old_locus_tag="GBAA0113"
FT   CDS_pept        122905..123735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="GBAA_0113"
FT                   /old_locus_tag="GBAA0113"
FT                   /product="ribosomal protein L2"
FT                   /note="identified by match to protein family HMM PF00181;
FT                   match to protein family HMM PF03947; match to protein
FT                   family HMM TIGR01171"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29193"
FT                   /db_xref="GOA:Q81VS7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS7"
FT                   /protein_id="AAT29193.1"
FT   gene            123796..124074
FT                   /gene="rpsS"
FT                   /locus_tag="GBAA_0114"
FT                   /old_locus_tag="GBAA0114"
FT   CDS_pept        123796..124074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="GBAA_0114"
FT                   /old_locus_tag="GBAA0114"
FT                   /product="ribosomal protein S19"
FT                   /note="identified by match to protein family HMM PF00203;
FT                   match to protein family HMM TIGR01050"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29194"
FT                   /db_xref="GOA:Q81VS6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS6"
FT                   /protein_id="AAT29194.1"
FT   gene            124092..124433
FT                   /gene="rplV"
FT                   /locus_tag="GBAA_0115"
FT                   /old_locus_tag="GBAA0115"
FT   CDS_pept        124092..124433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="GBAA_0115"
FT                   /old_locus_tag="GBAA0115"
FT                   /product="ribosomal protein L22"
FT                   /note="identified by match to protein family HMM PF00237;
FT                   match to protein family HMM TIGR01044"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29195"
FT                   /db_xref="GOA:Q81VS5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS5"
FT                   /protein_id="AAT29195.1"
FT                   VVVSEKKEG"
FT   gene            124437..125096
FT                   /gene="rpsC"
FT                   /locus_tag="GBAA_0116"
FT                   /old_locus_tag="GBAA0116"
FT   CDS_pept        124437..125096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="GBAA_0116"
FT                   /old_locus_tag="GBAA0116"
FT                   /product="ribosomal protein S3"
FT                   /note="identified by match to protein family HMM PF00189;
FT                   match to protein family HMM PF00417; match to protein
FT                   family HMM PF07650; match to protein family HMM TIGR01009"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29196"
FT                   /db_xref="GOA:Q81VS4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS4"
FT                   /protein_id="AAT29196.1"
FT   gene            125098..125532
FT                   /gene="rplP"
FT                   /locus_tag="GBAA_0117"
FT                   /old_locus_tag="GBAA0117"
FT   CDS_pept        125098..125532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="GBAA_0117"
FT                   /old_locus_tag="GBAA0117"
FT                   /product="ribosomal protein L16"
FT                   /note="identified by match to protein family HMM PF00252;
FT                   match to protein family HMM TIGR01164"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29197"
FT                   /db_xref="GOA:Q81VS3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS3"
FT                   /protein_id="AAT29197.2"
FT   gene            125522..125722
FT                   /gene="rpmC"
FT                   /locus_tag="GBAA_0118"
FT                   /old_locus_tag="GBAA0118"
FT   CDS_pept        125522..125722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="GBAA_0118"
FT                   /old_locus_tag="GBAA0118"
FT                   /product="ribosomal protein L29"
FT                   /note="identified by match to protein family HMM PF00831;
FT                   match to protein family HMM TIGR00012"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29198"
FT                   /db_xref="GOA:Q81VS2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS2"
FT                   /protein_id="AAT29198.1"
FT   gene            125743..126006
FT                   /gene="rpsQ"
FT                   /locus_tag="GBAA_0119"
FT                   /old_locus_tag="GBAA0119"
FT   CDS_pept        125743..126006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="GBAA_0119"
FT                   /old_locus_tag="GBAA0119"
FT                   /product="ribosomal protein S17"
FT                   /note="identified by match to protein family HMM PF00366"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29199"
FT                   /db_xref="GOA:Q81VS1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS1"
FT                   /protein_id="AAT29199.1"
FT   gene            126050..126418
FT                   /gene="rplN"
FT                   /locus_tag="GBAA_0120"
FT                   /old_locus_tag="GBAA0120"
FT   CDS_pept        126050..126418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="GBAA_0120"
FT                   /old_locus_tag="GBAA0120"
FT                   /product="ribosomal protein L14"
FT                   /note="identified by match to protein family HMM PF00238;
FT                   match to protein family HMM TIGR01067"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29200"
FT                   /db_xref="GOA:Q81VS0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VS0"
FT                   /protein_id="AAT29200.1"
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            126457..126768
FT                   /gene="rplX"
FT                   /locus_tag="GBAA_0121"
FT                   /old_locus_tag="GBAA0121"
FT   CDS_pept        126457..126768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="GBAA_0121"
FT                   /old_locus_tag="GBAA0121"
FT                   /product="ribosomal protein L24"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM TIGR01079"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29201"
FT                   /db_xref="GOA:Q81VR9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR9"
FT                   /protein_id="AAT29201.1"
FT   gene            126795..127334
FT                   /gene="rplE"
FT                   /locus_tag="GBAA_0122"
FT                   /old_locus_tag="GBAA0122"
FT   CDS_pept        126795..127334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="GBAA_0122"
FT                   /old_locus_tag="GBAA0122"
FT                   /product="ribosomal protein L5"
FT                   /note="identified by match to protein family HMM PF00281;
FT                   match to protein family HMM PF00673"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29202"
FT                   /db_xref="GOA:Q81VR8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR8"
FT                   /protein_id="AAT29202.1"
FT                   EEARELLTQFGMPFQK"
FT   gene            127368..127553
FT                   /gene="rpsN"
FT                   /locus_tag="GBAA_0123"
FT                   /old_locus_tag="GBAA0123"
FT   CDS_pept        127368..127553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="GBAA_0123"
FT                   /old_locus_tag="GBAA0123"
FT                   /product="ribosomal protein S14"
FT                   /note="identified by match to protein family HMM PF00253"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29203"
FT                   /db_xref="GOA:Q81VR7"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR7"
FT                   /protein_id="AAT29203.2"
FT                   ELAYKGQIPGVKKASW"
FT   gene            127583..127981
FT                   /gene="rpsH"
FT                   /locus_tag="GBAA_0124"
FT                   /old_locus_tag="GBAA0124"
FT   CDS_pept        127583..127981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="GBAA_0124"
FT                   /old_locus_tag="GBAA0124"
FT                   /product="ribosomal protein S8"
FT                   /note="identified by match to protein family HMM PF00410"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29204"
FT                   /db_xref="GOA:Q81VR6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="PDB:4PDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR6"
FT                   /protein_id="AAT29204.1"
FT   gene            128014..128553
FT                   /gene="rplF"
FT                   /locus_tag="GBAA_0125"
FT                   /old_locus_tag="GBAA0125"
FT   CDS_pept        128014..128553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="GBAA_0125"
FT                   /old_locus_tag="GBAA0125"
FT                   /product="ribosomal protein L6"
FT                   /note="identified by match to protein family HMM PF00347"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29205"
FT                   /db_xref="GOA:Q81VR5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR5"
FT                   /protein_id="AAT29205.1"
FT                   RYEGEVVRRKEGKTAK"
FT   gene            128585..128947
FT                   /gene="rplR"
FT                   /locus_tag="GBAA_0126"
FT                   /old_locus_tag="GBAA0126"
FT   CDS_pept        128585..128947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="GBAA_0126"
FT                   /old_locus_tag="GBAA0126"
FT                   /product="ribosomal protein L18"
FT                   /note="identified by match to protein family HMM PF00861;
FT                   match to protein family HMM TIGR00060"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29206"
FT                   /db_xref="GOA:Q81VR4"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR4"
FT                   /protein_id="AAT29206.1"
FT                   RVKALAEAAREAGLQF"
FT   gene            128969..129469
FT                   /gene="rpsE"
FT                   /locus_tag="GBAA_0127"
FT                   /old_locus_tag="GBAA0127"
FT   CDS_pept        128969..129469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="GBAA_0127"
FT                   /old_locus_tag="GBAA0127"
FT                   /product="ribosomal protein S5"
FT                   /note="identified by match to protein family HMM PF00333;
FT                   match to protein family HMM PF03719; match to protein
FT                   family HMM TIGR01021"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29207"
FT                   /db_xref="GOA:Q81VR3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR3"
FT                   /protein_id="AAT29207.1"
FT                   LLG"
FT   gene            129483..129665
FT                   /gene="rpmD"
FT                   /locus_tag="GBAA_0128"
FT                   /old_locus_tag="GBAA0128"
FT   CDS_pept        129483..129665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="GBAA_0128"
FT                   /old_locus_tag="GBAA0128"
FT                   /product="ribosomal protein L30"
FT                   /note="identified by match to protein family HMM PF00327;
FT                   match to protein family HMM TIGR01308"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29208"
FT                   /db_xref="GOA:Q81VR2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR2"
FT                   /protein_id="AAT29208.1"
FT                   GMINKVSHLVTVKEA"
FT   gene            129699..130139
FT                   /gene="rplO"
FT                   /locus_tag="GBAA_0129"
FT                   /old_locus_tag="GBAA0129"
FT   CDS_pept        129699..130139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="GBAA_0129"
FT                   /old_locus_tag="GBAA0129"
FT                   /product="ribosomal protein L15"
FT                   /note="identified by match to protein family HMM PF00256;
FT                   match to protein family HMM PF01305; match to protein
FT                   family HMM TIGR01071"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29209"
FT                   /db_xref="GOA:Q81VR1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VR1"
FT                   /protein_id="AAT29209.1"
FT   gene            130139..131440
FT                   /gene="secY1"
FT                   /locus_tag="GBAA_0130"
FT                   /old_locus_tag="GBAA0130"
FT   CDS_pept        130139..131440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY1"
FT                   /locus_tag="GBAA_0130"
FT                   /old_locus_tag="GBAA0130"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="identified by match to protein family HMM PF00344;
FT                   match to protein family HMM TIGR00967"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29210"
FT                   /db_xref="GOA:A0A1Q4MAW6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAW6"
FT                   /protein_id="AAT29210.2"
FT   gene            131497..132147
FT                   /gene="adk"
FT                   /locus_tag="GBAA_0131"
FT                   /old_locus_tag="GBAA0131"
FT   CDS_pept        131497..132147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="GBAA_0131"
FT                   /old_locus_tag="GBAA0131"
FT                   /product="adenylate kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00406;
FT                   match to protein family HMM PF05191; match to protein
FT                   family HMM TIGR01351"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29211"
FT                   /db_xref="GOA:Q81VQ9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ9"
FT                   /protein_id="AAT29211.1"
FT   gene            132147..132893
FT                   /gene="maP1"
FT                   /locus_tag="GBAA_0132"
FT                   /old_locus_tag="GBAA0132"
FT   CDS_pept        132147..132893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maP1"
FT                   /locus_tag="GBAA_0132"
FT                   /old_locus_tag="GBAA0132"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00557;
FT                   match to protein family HMM TIGR00500"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29212"
FT                   /db_xref="GOA:A0A1S0QZ90"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QZ90"
FT                   /protein_id="AAT29212.1"
FT   gene            132962..133180
FT                   /gene="infA"
FT                   /locus_tag="GBAA_0133"
FT                   /old_locus_tag="GBAA0133"
FT   CDS_pept        132962..133180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="GBAA_0133"
FT                   /old_locus_tag="GBAA0133"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29213"
FT                   /db_xref="GOA:Q81VQ7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ7"
FT                   /protein_id="AAT29213.1"
FT   gene            133216..133329
FT                   /gene="rpmJ"
FT                   /locus_tag="GBAA_0134"
FT                   /old_locus_tag="GBAA0134"
FT   CDS_pept        133216..133329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="GBAA_0134"
FT                   /old_locus_tag="GBAA0134"
FT                   /product="ribosomal protein L36"
FT                   /note="identified by match to protein family HMM PF00444;
FT                   match to protein family HMM TIGR01022"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29214"
FT                   /db_xref="GOA:Q81VQ6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ6"
FT                   /protein_id="AAT29214.1"
FT   gene            133351..133716
FT                   /gene="rpsM"
FT                   /locus_tag="GBAA_0135"
FT                   /old_locus_tag="GBAA0135"
FT   CDS_pept        133351..133716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="GBAA_0135"
FT                   /old_locus_tag="GBAA0135"
FT                   /product="ribosomal protein S13"
FT                   /note="identified by match to protein family HMM PF00416"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29215"
FT                   /db_xref="GOA:P62176"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62176"
FT                   /protein_id="AAT29215.1"
FT                   NARTRKGPRRTVANKKK"
FT   gene            133741..134130
FT                   /gene="rpsK"
FT                   /locus_tag="GBAA_0136"
FT                   /old_locus_tag="GBAA0136"
FT   CDS_pept        133741..134130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="GBAA_0136"
FT                   /old_locus_tag="GBAA0136"
FT                   /product="ribosomal protein S11"
FT                   /note="identified by match to protein family HMM PF00411"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29216"
FT                   /db_xref="GOA:Q81VQ5"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ5"
FT                   /protein_id="AAT29216.1"
FT   gene            134311..135255
FT                   /gene="rpoA"
FT                   /locus_tag="GBAA_0137"
FT                   /old_locus_tag="GBAA0137"
FT   CDS_pept        134311..135255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="GBAA_0137"
FT                   /old_locus_tag="GBAA0137"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01000;
FT                   match to protein family HMM PF01193; match to protein
FT                   family HMM PF03118; match to protein family HMM TIGR02027"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29217"
FT                   /db_xref="GOA:Q81VQ4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ4"
FT                   /protein_id="AAT29217.1"
FT   gene            135291..135653
FT                   /gene="rplQ"
FT                   /locus_tag="GBAA_0138"
FT                   /old_locus_tag="GBAA0138"
FT   CDS_pept        135291..135653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="GBAA_0138"
FT                   /old_locus_tag="GBAA0138"
FT                   /product="ribosomal protein L17"
FT                   /note="identified by match to protein family HMM PF01196;
FT                   match to protein family HMM TIGR00059"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29218"
FT                   /db_xref="GOA:Q81VQ3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ3"
FT                   /protein_id="AAT29218.1"
FT                   GPRRGDAAPMVIIELV"
FT   gene            135757..136599
FT                   /locus_tag="GBAA_0139"
FT                   /old_locus_tag="GBAA0139"
FT   CDS_pept        135757..136599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0139"
FT                   /old_locus_tag="GBAA0139"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29219"
FT                   /db_xref="GOA:Q81VQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ2"
FT                   /protein_id="AAT29219.2"
FT   gene            136575..137456
FT                   /locus_tag="GBAA_0140"
FT                   /old_locus_tag="GBAA0140"
FT   CDS_pept        136575..137456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0140"
FT                   /old_locus_tag="GBAA0140"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29220"
FT                   /db_xref="GOA:Q81VQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VQ1"
FT                   /protein_id="AAT29220.1"
FT                   VLRKGGHESCSS"
FT   gene            137444..138238
FT                   /locus_tag="GBAA_0141"
FT                   /old_locus_tag="GBAA0141"
FT   CDS_pept        137444..138238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0141"
FT                   /old_locus_tag="GBAA0141"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29221"
FT                   /db_xref="GOA:A0A1Q4MAP7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAP7"
FT                   /protein_id="AAT29221.1"
FT   gene            138253..138996
FT                   /gene="truA1"
FT                   /locus_tag="GBAA_0142"
FT                   /old_locus_tag="GBAA0142"
FT   CDS_pept        138253..138996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA1"
FT                   /locus_tag="GBAA_0142"
FT                   /old_locus_tag="GBAA0142"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACN55064"
FT                   /db_xref="GOA:A0A1S0QVM0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QVM0"
FT                   /protein_id="ACN55064.1"
FT   gene            139149..139586
FT                   /gene="rplM"
FT                   /locus_tag="GBAA_0143"
FT                   /old_locus_tag="GBAA0143"
FT   CDS_pept        139149..139586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="GBAA_0143"
FT                   /old_locus_tag="GBAA0143"
FT                   /product="ribosomal protein L13"
FT                   /note="identified by match to protein family HMM PF00572;
FT                   match to protein family HMM TIGR01066"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29223"
FT                   /db_xref="GOA:Q81VP9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP9"
FT                   /protein_id="AAT29223.1"
FT   gene            139608..140000
FT                   /gene="rpsI"
FT                   /locus_tag="GBAA_0144"
FT                   /old_locus_tag="GBAA0144"
FT   CDS_pept        139608..140000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="GBAA_0144"
FT                   /old_locus_tag="GBAA0144"
FT                   /product="ribosomal protein S9"
FT                   /note="identified by match to protein family HMM PF00380"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29224"
FT                   /db_xref="GOA:Q81VP8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VP8"
FT                   /protein_id="AAT29224.1"
FT   gene            140163..140591
FT                   /locus_tag="GBAA_0145"
FT                   /old_locus_tag="GBAA0145"
FT   CDS_pept        140163..140591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0145"
FT                   /old_locus_tag="GBAA0145"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29225"
FT                   /db_xref="GOA:A0A1J9W5U7"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W5U7"
FT                   /protein_id="AAT29225.1"
FT   gene            140658..141371
FT                   /gene="cwlD"
FT                   /locus_tag="GBAA_0146"
FT                   /old_locus_tag="GBAA0146"
FT   CDS_pept        140658..141371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="GBAA_0146"
FT                   /old_locus_tag="GBAA0146"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01520;
FT                   match to protein family HMM TIGR02883"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29226"
FT                   /db_xref="GOA:A0A0F7R9D0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9D0"
FT                   /protein_id="AAT29226.1"
FT                   RGILRYFTEKGNPPE"
FT   gene            141516..142580
FT                   /locus_tag="GBAA_0147"
FT                   /old_locus_tag="GBAA0147"
FT   CDS_pept        141516..142580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0147"
FT                   /old_locus_tag="GBAA0147"
FT                   /product="mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29227"
FT                   /db_xref="GOA:A0A1V4B5A0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B5A0"
FT                   /protein_id="AAT29227.1"
FT                   IAETVIDKTAFAQK"
FT   gene            complement(142637..143254)
FT                   /gene="gerD"
FT                   /locus_tag="GBAA_0148"
FT                   /old_locus_tag="GBAA0148"
FT   CDS_pept        complement(142637..143254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="GBAA_0148"
FT                   /old_locus_tag="GBAA0148"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29228"
FT                   /db_xref="GOA:A0A0J1HLV1"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HLV1"
FT                   /protein_id="AAT29228.1"
FT   gene            143394..144005
FT                   /gene="kbaA"
FT                   /locus_tag="GBAA_0149"
FT                   /old_locus_tag="GBAA0149"
FT   CDS_pept        143394..144005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="GBAA_0149"
FT                   /old_locus_tag="GBAA0149"
FT                   /product="kinb signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29229"
FT                   /db_xref="GOA:A0A1Q4MAQ5"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MAQ5"
FT                   /protein_id="AAT29229.1"
FT   gene            complement(144110..144874)
FT                   /locus_tag="GBAA_0150"
FT                   /old_locus_tag="GBAA0150"
FT   CDS_pept        complement(144110..144874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0150"
FT                   /old_locus_tag="GBAA0150"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02764"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29230"
FT                   /db_xref="GOA:A0A0F7R803"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="PDB:4M1B"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R803"
FT                   /protein_id="AAT29230.1"
FT   gene            145045..145263
FT                   /locus_tag="GBAA_0151"
FT                   /old_locus_tag="GBAA0151"
FT   CDS_pept        145045..145263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0151"
FT                   /old_locus_tag="GBAA0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29231"
FT                   /db_xref="GOA:A0A1J9WWD4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WWD4"
FT                   /protein_id="AAT29231.1"
FT   gene            145421..145519
FT                   /locus_tag="GBAA_0152"
FT                   /old_locus_tag="GBAA0152"
FT   CDS_pept        145421..145519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0152"
FT                   /old_locus_tag="GBAA0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29826"
FT                   /db_xref="GOA:Q81JD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q81JD8"
FT                   /protein_id="AAT29826.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            145515..147021
FT                   /gene="rrsD"
FT                   /locus_tag="GBAA_5967"
FT   rRNA            145515..147021
FT                   /gene="rrsD"
FT                   /locus_tag="GBAA_5967"
FT                   /product="16S ribosomal RNA"
FT   gene            147200..150107
FT                   /gene="rrlD"
FT                   /locus_tag="GBAA_5968"
FT   rRNA            147200..150107
FT                   /gene="rrlD"
FT                   /locus_tag="GBAA_5968"
FT                   /product="23S ribosomal RNA"
FT   gene            150194..150309
FT                   /gene="rrfD"
FT                   /locus_tag="GBAA_5969"
FT   rRNA            150194..150309
FT                   /gene="rrfD"
FT                   /locus_tag="GBAA_5969"
FT                   /product="5S ribosomal RNA"
FT   gene            150319..150393
FT                   /locus_tag="GBAA_5870"
FT   tRNA            150319..150393
FT                   /locus_tag="GBAA_5870"
FT                   /product="tRNA-Asn"
FT   gene            150398..150470
FT                   /locus_tag="GBAA_5871"
FT   tRNA            150398..150470
FT                   /locus_tag="GBAA_5871"
FT                   /product="tRNA-Thr"
FT   gene            150495..150569
FT                   /locus_tag="GBAA_5872"
FT   tRNA            150495..150569
FT                   /locus_tag="GBAA_5872"
FT                   /product="tRNA-Glu"
FT   gene            150575..150650
FT                   /locus_tag="GBAA_5873"
FT   tRNA            150575..150650
FT                   /locus_tag="GBAA_5873"
FT                   /product="tRNA-Val"
FT   gene            150668..150751
FT                   /locus_tag="GBAA_5874"
FT   tRNA            150668..150751
FT                   /locus_tag="GBAA_5874"
FT                   /product="tRNA-Tyr"
FT   gene            150817..150891
FT                   /locus_tag="GBAA_5875"
FT   tRNA            150817..150891
FT                   /locus_tag="GBAA_5875"
FT                   /product="tRNA-Gln"
FT   gene            150897..150972
FT                   /locus_tag="GBAA_5876"
FT   tRNA            150897..150972
FT                   /locus_tag="GBAA_5876"
FT                   /product="tRNA-Lys"
FT   gene            150978..151049
FT                   /locus_tag="GBAA_5877"
FT   tRNA            150978..151049
FT                   /locus_tag="GBAA_5877"
FT                   /product="tRNA-Gly"
FT   gene            151060..151132
FT                   /locus_tag="GBAA_5878"
FT   tRNA            151060..151132
FT                   /locus_tag="GBAA_5878"
FT                   /product="tRNA-Ala"
FT   gene            151247..152393
FT                   /pseudo
FT                   /locus_tag="GBAA_0153"
FT                   /old_locus_tag="GBAA0153"
FT                   /note="glycerate kinase, authentic frameshift; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            152603..153496
FT                   /gene="rocF"
FT                   /locus_tag="GBAA_0154"
FT                   /old_locus_tag="GBAA0154"
FT   CDS_pept        152603..153496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="GBAA_0154"
FT                   /old_locus_tag="GBAA0154"
FT                   /product="arginase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01229"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29236"
FT                   /db_xref="GOA:A0A0F7R7Z8"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7Z8"
FT                   /protein_id="AAT29236.1"
FT                   TTAVALMGSLFGEKLK"
FT   gene            153745..154566
FT                   /locus_tag="GBAA_0155"
FT                   /old_locus_tag="GBAA0155"
FT   CDS_pept        153745..154566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0155"
FT                   /old_locus_tag="GBAA0155"
FT                   /product="conserved hypothetical protein TIGR00159"
FT                   /note="identified by match to protein family HMM PF02457;
FT                   match to protein family HMM TIGR00159"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29237"
FT                   /db_xref="GOA:A0A1J9VWJ6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VWJ6"
FT                   /protein_id="AAT29237.1"
FT   gene            154559..156049
FT                   /locus_tag="GBAA_0156"
FT                   /old_locus_tag="GBAA0156"
FT   CDS_pept        154559..156049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0156"
FT                   /old_locus_tag="GBAA0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07949"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29238"
FT                   /db_xref="GOA:Q81VN8"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VN8"
FT                   /protein_id="AAT29238.1"
FT   gene            156042..157388
FT                   /gene="glmM"
FT                   /locus_tag="GBAA_0157"
FT                   /old_locus_tag="GBAA0157"
FT   CDS_pept        156042..157388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="GBAA_0157"
FT                   /old_locus_tag="GBAA0157"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29239"
FT                   /db_xref="GOA:Q81VN7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="PDB:3PDK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN7"
FT                   /protein_id="AAT29239.1"
FT   gene            157676..157861
FT                   /locus_tag="GBAA_0158"
FT                   /old_locus_tag="GBAA0158"
FT   CDS_pept        157676..157861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0158"
FT                   /old_locus_tag="GBAA0158"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35252"
FT                   /db_xref="GOA:Q81VN6"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VN6"
FT                   /protein_id="AAT35252.1"
FT                   GIGLCRYMFAEQRKHL"
FT   gene            157874..159676
FT                   /gene="glmS"
FT                   /locus_tag="GBAA_0159"
FT                   /old_locus_tag="GBAA0159"
FT   CDS_pept        157874..159676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="GBAA_0159"
FT                   /old_locus_tag="GBAA0159"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR01135"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29240"
FT                   /db_xref="GOA:Q81VN5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VN5"
FT                   /protein_id="AAT29240.1"
FT   gene            160040..160849
FT                   /locus_tag="GBAA_0160"
FT                   /old_locus_tag="GBAA0160"
FT   CDS_pept        160040..160849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0160"
FT                   /old_locus_tag="GBAA0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29241"
FT                   /db_xref="GOA:Q81VN4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VN4"
FT                   /protein_id="AAT29241.2"
FT   gene            161256..161987
FT                   /gene="gntR"
FT                   /locus_tag="GBAA_0161"
FT                   /old_locus_tag="GBAA0161"
FT   CDS_pept        161256..161987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="GBAA_0161"
FT                   /old_locus_tag="GBAA0161"
FT                   /product="gluconate operon transcriptional repressor"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29242"
FT                   /db_xref="GOA:A0A0F7R9B7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9B7"
FT                   /protein_id="AAT29242.1"
FT   gene            161980..163515
FT                   /pseudo
FT                   /locus_tag="GBAA_0162"
FT                   /old_locus_tag="GBAA0162"
FT                   /note="gluconate kinase, authentic point mutation; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00370; match to protein family HMM PF02782; match to
FT                   protein family HMM TIGR01314"
FT   gene            163635..164981
FT                   /gene="gntP1"
FT                   /locus_tag="GBAA_0163"
FT                   /old_locus_tag="GBAA0163"
FT   CDS_pept        163635..164981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gntP1"
FT                   /locus_tag="GBAA_0163"
FT                   /old_locus_tag="GBAA0163"
FT                   /product="gluconate permease"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29245"
FT                   /db_xref="GOA:A0A1J9VWI7"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VWI7"
FT                   /protein_id="AAT29245.1"
FT   gene            165246..166655
FT                   /gene="yqjI"
FT                   /locus_tag="GBAA_0164"
FT                   /old_locus_tag="GBAA0164"
FT   CDS_pept        165246..166655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjI"
FT                   /locus_tag="GBAA_0164"
FT                   /old_locus_tag="GBAA0164"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00393;
FT                   match to protein family HMM PF03446; match to protein
FT                   family HMM TIGR00873"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29246"
FT                   /db_xref="GOA:A0A0F7R7Y8"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7Y8"
FT                   /protein_id="AAT29246.1"
FT                   DKEGTFHTKWI"
FT   gene            166998..168962
FT                   /locus_tag="GBAA_0165"
FT                   /old_locus_tag="GBAA0165"
FT   CDS_pept        166998..168962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0165"
FT                   /old_locus_tag="GBAA0165"
FT                   /product="putative prolyl oligopeptidase family protein"
FT                   /note="identified by match to protein family HMM PF00326"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29247"
FT                   /db_xref="GOA:Q81VN0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VN0"
FT                   /protein_id="AAT29247.1"
FT   gene            169081..169647
FT                   /locus_tag="GBAA_0166"
FT                   /old_locus_tag="GBAA0166"
FT   CDS_pept        169081..169647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0166"
FT                   /old_locus_tag="GBAA0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29248"
FT                   /db_xref="GOA:A0A0F7R343"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R343"
FT                   /protein_id="AAT29248.1"
FT   gene            complement(169719..170225)
FT                   /locus_tag="GBAA_0167"
FT                   /old_locus_tag="GBAA0167"
FT   CDS_pept        complement(169719..170225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0167"
FT                   /old_locus_tag="GBAA0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29249"
FT                   /db_xref="GOA:A0A1Q4MBH8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MBH8"
FT                   /protein_id="AAT29249.1"
FT                   LSKTA"
FT   gene            complement(170466..171380)
FT                   /locus_tag="GBAA_0168"
FT                   /old_locus_tag="GBAA0168"
FT   CDS_pept        complement(170466..171380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0168"
FT                   /old_locus_tag="GBAA0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29250"
FT                   /db_xref="GOA:A0A0F7R8A4"
FT                   /db_xref="InterPro:IPR025672"
FT                   /db_xref="InterPro:IPR029101"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R8A4"
FT                   /protein_id="AAT29250.1"
FT   gene            complement(171380..171871)
FT                   /locus_tag="GBAA_0169"
FT                   /old_locus_tag="GBAA0169"
FT   CDS_pept        complement(171380..171871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0169"
FT                   /old_locus_tag="GBAA0169"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF08281; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29251"
FT                   /db_xref="GOA:Q81VM6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VM6"
FT                   /protein_id="AAT29251.1"
FT                   "
FT   gene            complement(172012..173312)
FT                   /pseudo
FT                   /locus_tag="GBAA_0171"
FT                   /old_locus_tag="GBAA0171"
FT                   /note="putative lipoprotein, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            173755..174528
FT                   /pseudo
FT                   /locus_tag="GBAA_0172"
FT                   /old_locus_tag="GBAA0172"
FT                   /note="oxidoreductase, short-chain dehydrogenase/reductase
FT                   family, authentic point mutation; this gene contains a
FT                   premature stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00106"
FT   gene            complement(174566..175234)
FT                   /locus_tag="GBAA_0173"
FT                   /old_locus_tag="GBAA0173"
FT   CDS_pept        complement(174566..175234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0173"
FT                   /old_locus_tag="GBAA0173"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29257"
FT                   /db_xref="GOA:A0A0F7R7X7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7X7"
FT                   /protein_id="AAT29257.1"
FT                   "
FT   gene            complement(175209..176249)
FT                   /locus_tag="GBAA_0174"
FT                   /old_locus_tag="GBAA0174"
FT   CDS_pept        complement(175209..176249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0174"
FT                   /old_locus_tag="GBAA0174"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29258"
FT                   /db_xref="GOA:Q81VM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VM2"
FT                   /protein_id="AAT29258.1"
FT                   KQVLFG"
FT   gene            complement(176262..177074)
FT                   /locus_tag="GBAA_0175"
FT                   /old_locus_tag="GBAA0175"
FT   CDS_pept        complement(176262..177074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0175"
FT                   /old_locus_tag="GBAA0175"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29259"
FT                   /db_xref="GOA:A0A1Q4MB94"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MB94"
FT                   /protein_id="AAT29259.1"
FT   gene            complement(177354..178262)
FT                   /locus_tag="GBAA_0176"
FT                   /old_locus_tag="GBAA0176"
FT   CDS_pept        complement(177354..178262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0176"
FT                   /old_locus_tag="GBAA0176"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29260"
FT                   /db_xref="GOA:Q81VM0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VM0"
FT                   /protein_id="AAT29260.1"
FT   gene            178408..179172
FT                   /locus_tag="GBAA_0177"
FT                   /old_locus_tag="GBAA0177"
FT   CDS_pept        178408..179172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0177"
FT                   /old_locus_tag="GBAA0177"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29261"
FT                   /db_xref="GOA:A0A0F7R897"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R897"
FT                   /protein_id="AAT29261.1"
FT   gene            179305..180720
FT                   /locus_tag="GBAA_0178"
FT                   /old_locus_tag="GBAA0178"
FT   CDS_pept        179305..180720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0178"
FT                   /old_locus_tag="GBAA0178"
FT                   /product="oxidoreductase, FAD-binding"
FT                   /note="identified by match to protein family HMM PF01565"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29262"
FT                   /db_xref="GOA:Q81VL8"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VL8"
FT                   /protein_id="AAT29262.1"
FT                   ERFVNLFYREYTK"
FT   gene            180717..181250
FT                   /locus_tag="GBAA_0179"
FT                   /old_locus_tag="GBAA0179"
FT   CDS_pept        180717..181250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0179"
FT                   /old_locus_tag="GBAA0179"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29263"
FT                   /db_xref="GOA:A0A0F7R9A4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9A4"
FT                   /protein_id="AAT29263.1"
FT                   LYVVSGVVLSSKKI"
FT   gene            181329..183050
FT                   /locus_tag="GBAA_0180"
FT                   /old_locus_tag="GBAA0180"
FT   CDS_pept        181329..183050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0180"
FT                   /old_locus_tag="GBAA0180"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29264"
FT                   /db_xref="GOA:Q81VL6"
FT                   /db_xref="InterPro:IPR025043"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VL6"
FT                   /protein_id="AAT29264.1"
FT   gene            183178..184428
FT                   /locus_tag="GBAA_0181"
FT                   /old_locus_tag="GBAA0181"
FT   CDS_pept        183178..184428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0181"
FT                   /old_locus_tag="GBAA0181"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29265"
FT                   /db_xref="GOA:A0A1T3URR1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3URR1"
FT                   /protein_id="AAT29265.1"
FT                   RRSEKQFELQARQNLEV"
FT   gene            184679..185179
FT                   /locus_tag="GBAA_0183"
FT                   /old_locus_tag="GBAA0183"
FT   CDS_pept        184679..185179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0183"
FT                   /old_locus_tag="GBAA0183"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29266"
FT                   /db_xref="GOA:A0A0F7R893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R893"
FT                   /protein_id="AAT29266.1"
FT                   TKK"
FT   gene            complement(185196..185411)
FT                   /locus_tag="GBAA_0184"
FT                   /old_locus_tag="GBAA0184"
FT   CDS_pept        complement(185196..185411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0184"
FT                   /old_locus_tag="GBAA0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29267"
FT                   /db_xref="GOA:A0A1J9VVX2"
FT                   /db_xref="InterPro:IPR025028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VVX2"
FT                   /protein_id="AAT29267.1"
FT   gene            185820..186743
FT                   /locus_tag="GBAA_0185"
FT                   /old_locus_tag="GBAA0185"
FT   CDS_pept        185820..186743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0185"
FT                   /old_locus_tag="GBAA0185"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29268"
FT                   /db_xref="GOA:A0A0F7R9A0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R9A0"
FT                   /protein_id="AAT29268.1"
FT   gene            186760..187764
FT                   /locus_tag="GBAA_0186"
FT                   /old_locus_tag="GBAA0186"
FT   CDS_pept        186760..187764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0186"
FT                   /old_locus_tag="GBAA0186"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29269"
FT                   /db_xref="GOA:A0A0F7R2X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R2X5"
FT                   /protein_id="AAT29269.1"
FT   gene            187721..188731
FT                   /locus_tag="GBAA_0187"
FT                   /old_locus_tag="GBAA0187"
FT   CDS_pept        187721..188731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0187"
FT                   /old_locus_tag="GBAA0187"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29270"
FT                   /db_xref="GOA:A0A0F7R444"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R444"
FT                   /protein_id="AAT29270.1"
FT   gene            188728..189501
FT                   /locus_tag="GBAA_0188"
FT                   /old_locus_tag="GBAA0188"
FT   CDS_pept        188728..189501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0188"
FT                   /old_locus_tag="GBAA0188"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29271"
FT                   /db_xref="GOA:A0A0F7R888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R888"
FT                   /protein_id="AAT29271.1"
FT   gene            189515..191125
FT                   /locus_tag="GBAA_0189"
FT                   /old_locus_tag="GBAA0189"
FT   CDS_pept        189515..191125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0189"
FT                   /old_locus_tag="GBAA0189"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29272"
FT                   /db_xref="GOA:A0A0F7R7W4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7W4"
FT                   /protein_id="AAT29272.1"
FT   gene            complement(191142..191609)
FT                   /locus_tag="GBAA_0190"
FT                   /old_locus_tag="GBAA0190"
FT   CDS_pept        complement(191142..191609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0190"
FT                   /old_locus_tag="GBAA0190"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29273"
FT                   /db_xref="GOA:Q81VK7"
FT                   /db_xref="InterPro:IPR025623"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VK7"
FT                   /protein_id="AAT29273.1"
FT   gene            191781..192680
FT                   /locus_tag="GBAA_0191"
FT                   /old_locus_tag="GBAA0191"
FT   CDS_pept        191781..192680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0191"
FT                   /old_locus_tag="GBAA0191"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29274"
FT                   /db_xref="GOA:A0A0F7R2X3"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R2X3"
FT                   /protein_id="AAT29274.1"
FT                   YETLLEEPVNLQFEEVEK"
FT   gene            192699..192890
FT                   /locus_tag="GBAA_0192"
FT                   /old_locus_tag="GBAA0192"
FT   CDS_pept        192699..192890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0192"
FT                   /old_locus_tag="GBAA0192"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35253"
FT                   /db_xref="GOA:A0A1Q4MB60"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MB60"
FT                   /protein_id="AAT35253.1"
FT                   FIFMMSFSSMQKEGEEDY"
FT   gene            192887..193235
FT                   /pseudo
FT                   /locus_tag="GBAA_0193"
FT                   /old_locus_tag="GBAA0193"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by similarity to
FT                   GB:AAU20048.1"
FT   gene            complement(193280..194920)
FT                   /locus_tag="GBAA_0194"
FT                   /old_locus_tag="GBAA0194"
FT   CDS_pept        complement(193280..194920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0194"
FT                   /old_locus_tag="GBAA0194"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29276"
FT                   /db_xref="GOA:A0A1V4B6E4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B6E4"
FT                   /protein_id="AAT29276.1"
FT   gene            complement(195308..196948)
FT                   /locus_tag="GBAA_0195"
FT                   /old_locus_tag="GBAA0195"
FT   CDS_pept        complement(195308..196948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0195"
FT                   /old_locus_tag="GBAA0195"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29277"
FT                   /db_xref="GOA:A0A0F7R7V9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7V9"
FT                   /protein_id="AAT29277.1"
FT   gene            complement(197340..198173)
FT                   /locus_tag="GBAA_0196"
FT                   /old_locus_tag="GBAA0196"
FT   CDS_pept        complement(197340..198173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0196"
FT                   /old_locus_tag="GBAA0196"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29278"
FT                   /db_xref="GOA:A0A1T3URV6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3URV6"
FT                   /protein_id="AAT29278.1"
FT   gene            complement(198175..198978)
FT                   /pseudo
FT                   /locus_tag="GBAA_0197"
FT                   /old_locus_tag="GBAA0197"
FT                   /note="putative pyrroline-5-carboxylate reductase,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF01210; match to
FT                   protein family HMM PF03807; match to protein family HMM
FT                   TIGR00112"
FT   gene            199078..199173
FT                   /locus_tag="GBAA_0198"
FT                   /old_locus_tag="GBAA0198"
FT   CDS_pept        199078..199173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0198"
FT                   /old_locus_tag="GBAA0198"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29280"
FT                   /db_xref="GOA:A0A1Q4MB53"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MB53"
FT                   /protein_id="AAT29280.1"
FT                   /translation="MKSRKLMVKGRVIPYTGDREFITHLGRDDYD"
FT   gene            199166..199816
FT                   /locus_tag="GBAA_0199"
FT                   /old_locus_tag="GBAA0199"
FT   CDS_pept        199166..199816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0199"
FT                   /old_locus_tag="GBAA0199"
FT                   /product="nucleoside transporter, PnuC family"
FT                   /note="identified by match to protein family HMM PF04973;
FT                   match to protein family HMM TIGR01528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29281"
FT                   /db_xref="GOA:A0A2B6BZ52"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BZ52"
FT                   /protein_id="AAT29281.1"
FT   gene            complement(199884..200735)
FT                   /locus_tag="GBAA_0200"
FT                   /old_locus_tag="GBAA0200"
FT   CDS_pept        complement(199884..200735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0200"
FT                   /old_locus_tag="GBAA0200"
FT                   /product="putative transporter"
FT                   /note="identified by match to protein family HMM PF06800"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29282"
FT                   /db_xref="GOA:Q81VJ7"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ7"
FT                   /protein_id="AAT29282.1"
FT                   KA"
FT   gene            complement(201022..201552)
FT                   /gene="modB"
FT                   /locus_tag="GBAA_0202"
FT                   /old_locus_tag="GBAA0202"
FT   CDS_pept        complement(201022..201552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="GBAA_0202"
FT                   /old_locus_tag="GBAA0202"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29285"
FT                   /db_xref="GOA:D1MPT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D1MPT7"
FT                   /protein_id="AAT29285.1"
FT                   INKRITNSSGSFF"
FT   gene            201515..201733
FT                   /locus_tag="GBAA_0203"
FT                   /old_locus_tag="GBAA0203"
FT   CDS_pept        201515..201733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0203"
FT                   /old_locus_tag="GBAA0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35254"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VJ5"
FT                   /protein_id="AAT35254.1"
FT   gene            complement(201717..202522)
FT                   /pseudo
FT                   /gene="modA"
FT                   /locus_tag="GBAA_0204"
FT                   /old_locus_tag="GBAA0204"
FT                   /note="molybdenum ABC transporter, molybdenum-binding
FT                   protein, authentic frameshift; this gene contains a frame
FT                   shift which is not the result of sequencing error;
FT                   identified by match to protein family HMM TIGR01256"
FT   gene            202684..203604
FT                   /locus_tag="GBAA_0205"
FT                   /old_locus_tag="GBAA0205"
FT   CDS_pept        202684..203604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0205"
FT                   /old_locus_tag="GBAA0205"
FT                   /product="putative molybdopterin biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF05930;
FT                   match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29289"
FT                   /db_xref="GOA:Q81VJ4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VJ4"
FT                   /protein_id="AAT29289.2"
FT   gene            complement(203820..203921)
FT                   /locus_tag="GBAA_0206"
FT                   /old_locus_tag="GBAA0206"
FT   CDS_pept        complement(203820..203921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0206"
FT                   /old_locus_tag="GBAA0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29290"
FT                   /db_xref="GOA:A0A0J1KFA2"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1KFA2"
FT                   /protein_id="AAT29290.1"
FT   gene            complement(203934..204035)
FT                   /locus_tag="GBAA_0207"
FT                   /old_locus_tag="GBAA0207"
FT   CDS_pept        complement(203934..204035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0207"
FT                   /old_locus_tag="GBAA0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29291"
FT                   /db_xref="GOA:A0A1J9WNV6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WNV6"
FT                   /protein_id="AAT29291.1"
FT   gene            complement(204177..205043)
FT                   /locus_tag="GBAA_0208"
FT                   /old_locus_tag="GBAA0208"
FT   CDS_pept        complement(204177..205043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0208"
FT                   /old_locus_tag="GBAA0208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29292"
FT                   /db_xref="GOA:Q81VJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VJ1"
FT                   /protein_id="AAT29292.1"
FT                   HHHINML"
FT   gene            205171..206139
FT                   /locus_tag="GBAA_0210"
FT                   /old_locus_tag="GBAA0210"
FT   CDS_pept        205171..206139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0210"
FT                   /old_locus_tag="GBAA0210"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29293"
FT                   /db_xref="GOA:Q81VJ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VJ0"
FT                   /protein_id="AAT29293.2"
FT   gene            206161..206301
FT                   /locus_tag="GBAA_0211"
FT                   /old_locus_tag="GBAA0211"
FT   CDS_pept        206161..206301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0211"
FT                   /old_locus_tag="GBAA0211"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29294"
FT                   /db_xref="GOA:A0A1Q4MB44"
FT                   /db_xref="InterPro:IPR025417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MB44"
FT                   /protein_id="AAT29294.1"
FT                   I"
FT   gene            complement(206362..206457)
FT                   /locus_tag="GBAA_0212"
FT                   /old_locus_tag="GBAA0212"
FT   CDS_pept        complement(206362..206457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0212"
FT                   /old_locus_tag="GBAA0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35255"
FT                   /db_xref="GOA:A0A1V4B6E5"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B6E5"
FT                   /protein_id="AAT35255.1"
FT                   /translation="MQNITFNKLDLLGLASGSILLTAFIYTATLV"
FT   gene            206669..207274
FT                   /locus_tag="GBAA_0213"
FT                   /old_locus_tag="GBAA0213"
FT   CDS_pept        206669..207274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0213"
FT                   /old_locus_tag="GBAA0213"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF01553;
FT                   match to protein family HMM TIGR00530"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29295"
FT                   /db_xref="GOA:A0A0F7R2W2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R2W2"
FT                   /protein_id="AAT29295.1"
FT   gene            207749..208726
FT                   /locus_tag="GBAA_0216"
FT                   /old_locus_tag="GBAA0216"
FT   CDS_pept        207749..208726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0216"
FT                   /old_locus_tag="GBAA0216"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29298"
FT                   /db_xref="GOA:A0A0F7R864"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R864"
FT                   /protein_id="AAT29298.1"
FT   gene            208875..209204
FT                   /locus_tag="GBAA_0217"
FT                   /old_locus_tag="GBAA0217"
FT   CDS_pept        208875..209204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0217"
FT                   /old_locus_tag="GBAA0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35256"
FT                   /db_xref="GOA:A0A0J1HN84"
FT                   /db_xref="InterPro:IPR039519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HN84"
FT                   /protein_id="AAT35256.1"
FT                   TNMNN"
FT   gene            209323..210159
FT                   /locus_tag="GBAA_0218"
FT                   /old_locus_tag="GBAA0218"
FT   CDS_pept        209323..210159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0218"
FT                   /old_locus_tag="GBAA0218"
FT                   /product="yitT family protein"
FT                   /note="identified by match to protein family HMM PF02588"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29299"
FT                   /db_xref="GOA:A0A0J1HN42"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HN42"
FT                   /protein_id="AAT29299.1"
FT   gene            210297..210653
FT                   /locus_tag="GBAA_0219"
FT                   /old_locus_tag="GBAA0219"
FT   CDS_pept        210297..210653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0219"
FT                   /old_locus_tag="GBAA0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06486;
FT                   match to protein family HMM TIGR01655"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29300"
FT                   /db_xref="GOA:Q81VI3"
FT                   /db_xref="InterPro:IPR006542"
FT                   /db_xref="InterPro:IPR036166"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VI3"
FT                   /protein_id="AAT29300.1"
FT                   NIPINAKSKLLSMR"
FT   gene            211225..211338
FT                   /locus_tag="GBAA_0221"
FT                   /old_locus_tag="GBAA0221"
FT   CDS_pept        211225..211338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0221"
FT                   /old_locus_tag="GBAA0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35257"
FT                   /db_xref="GOA:A0A1Q4MB56"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4MB56"
FT                   /protein_id="AAT35257.1"
FT   gene            211397..212161
FT                   /locus_tag="GBAA_0222"
FT                   /old_locus_tag="GBAA0222"
FT   CDS_pept        211397..212161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0222"
FT                   /old_locus_tag="GBAA0222"
FT                   /product="putative deoxyribonuclease, TatD family"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29301"
FT                   /db_xref="GOA:Q81VI1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VI1"
FT                   /protein_id="AAT29301.1"
FT   gene            complement(212264..213913)
FT                   /locus_tag="GBAA_0223"
FT                   /old_locus_tag="GBAA0223"
FT   CDS_pept        complement(212264..213913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0223"
FT                   /old_locus_tag="GBAA0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29302"
FT                   /db_xref="GOA:A0A0F7R859"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R859"
FT                   /protein_id="AAT29302.1"
FT   gene            214164..214697
FT                   /locus_tag="GBAA_0224"
FT                   /old_locus_tag="GBAA0224"
FT   CDS_pept        214164..214697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0224"
FT                   /old_locus_tag="GBAA0224"
FT                   /product="invasion protein IagB domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29303"
FT                   /db_xref="GOA:A0A0F7R7T4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7T4"
FT                   /protein_id="AAT29303.1"
FT                   LEDVYYRNKGIIKE"
FT   gene            complement(214713..215495)
FT                   /locus_tag="GBAA_0225"
FT                   /old_locus_tag="GBAA0225"
FT   CDS_pept        complement(214713..215495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0225"
FT                   /old_locus_tag="GBAA0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29304"
FT                   /db_xref="GOA:Q81VH8"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR012361"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VH8"
FT                   /protein_id="AAT29304.1"
FT   gene            215703..215795
FT                   /locus_tag="GBAA_0226"
FT                   /old_locus_tag="GBAA0226"
FT   CDS_pept        215703..215795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0226"
FT                   /old_locus_tag="GBAA0226"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29306"
FT                   /db_xref="GOA:A0A0F7R401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R401"
FT                   /protein_id="AAT29306.1"
FT                   /translation="MYKAIAVLAMTIMAFFIFVYPFFIVGLILG"
FT   gene            216438..218318
FT                   /locus_tag="GBAA_0228"
FT                   /old_locus_tag="GBAA0228"
FT   CDS_pept        216438..218318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0228"
FT                   /old_locus_tag="GBAA0228"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29309"
FT                   /db_xref="GOA:Q81VH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VH6"
FT                   /protein_id="AAT29309.1"
FT   gene            complement(218560..218805)
FT                   /locus_tag="GBAA_0229"
FT                   /old_locus_tag="GBAA0229"
FT   CDS_pept        complement(218560..218805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0229"
FT                   /old_locus_tag="GBAA0229"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29310"
FT                   /db_xref="GOA:A0A2B6BYU9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYU9"
FT                   /protein_id="AAT29310.1"
FT   gene            218858..218977
FT                   /locus_tag="GBAA_0230"
FT                   /old_locus_tag="GBAA0230"
FT   CDS_pept        218858..218977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0230"
FT                   /old_locus_tag="GBAA0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29311"
FT                   /db_xref="GOA:A0A0F7R7S9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7S9"
FT                   /protein_id="AAT29311.2"
FT   gene            219275..220942
FT                   /locus_tag="GBAA_0231"
FT                   /old_locus_tag="GBAA0231"
FT   CDS_pept        219275..220942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0231"
FT                   /old_locus_tag="GBAA0231"
FT                   /product="putative oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29312"
FT                   /db_xref="GOA:Q81VH3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VH3"
FT                   /protein_id="AAT29312.1"
FT   gene            221051..222007
FT                   /locus_tag="GBAA_0232"
FT                   /old_locus_tag="GBAA0232"
FT   CDS_pept        221051..222007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0232"
FT                   /old_locus_tag="GBAA0232"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29313"
FT                   /db_xref="GOA:Q81VH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VH2"
FT                   /protein_id="AAT29313.2"
FT   gene            222020..222943
FT                   /locus_tag="GBAA_0233"
FT                   /old_locus_tag="GBAA0233"
FT   CDS_pept        222020..222943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0233"
FT                   /old_locus_tag="GBAA0233"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29314"
FT                   /db_xref="GOA:A0A0F7R3Z2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R3Z2"
FT                   /protein_id="AAT29314.1"
FT   gene            222954..223934
FT                   /locus_tag="GBAA_0234"
FT                   /old_locus_tag="GBAA0234"
FT   CDS_pept        222954..223934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0234"
FT                   /old_locus_tag="GBAA0234"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29315"
FT                   /db_xref="GOA:A0A0F7R849"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R849"
FT                   /protein_id="AAT29315.1"
FT   gene            223931..224941
FT                   /locus_tag="GBAA_0235"
FT                   /old_locus_tag="GBAA0235"
FT   CDS_pept        223931..224941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0235"
FT                   /old_locus_tag="GBAA0235"
FT                   /product="oligopeptide ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08352; match to protein
FT                   family HMM TIGR01727"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29316"
FT                   /db_xref="GOA:Q81VG9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VG9"
FT                   /protein_id="AAT29316.1"
FT   gene            complement(224931..225804)
FT                   /pseudo
FT                   /locus_tag="GBAA_0236"
FT                   /old_locus_tag="GBAA0236"
FT                   /note="hydrolase, haloacid dehalogenase-like family,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family HMM PF08282"
FT   gene            226255..226362
FT                   /locus_tag="GBAA_0238"
FT                   /old_locus_tag="GBAA0238"
FT   CDS_pept        226255..226362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0238"
FT                   /old_locus_tag="GBAA0238"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29319"
FT                   /db_xref="GOA:A0A1J9VMA4"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VMA4"
FT                   /protein_id="AAT29319.1"
FT   gene            226405..226515
FT                   /locus_tag="GBAA_0239"
FT                   /old_locus_tag="GBAA0239"
FT   CDS_pept        226405..226515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0239"
FT                   /old_locus_tag="GBAA0239"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29320"
FT                   /db_xref="GOA:A0A2A8KR76"
FT                   /db_xref="InterPro:IPR025034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KR76"
FT                   /protein_id="AAT29320.1"
FT   gene            226826..227944
FT                   /gene="hppD"
FT                   /locus_tag="GBAA_0240"
FT                   /old_locus_tag="GBAA0240"
FT   CDS_pept        226826..227944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="GBAA_0240"
FT                   /old_locus_tag="GBAA0240"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR01263"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29321"
FT                   /db_xref="GOA:A0A1S0QS93"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QS93"
FT                   /protein_id="AAT29321.1"
FT   gene            228011..228967
FT                   /locus_tag="GBAA_0241"
FT                   /old_locus_tag="GBAA0241"
FT   CDS_pept        228011..228967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0241"
FT                   /old_locus_tag="GBAA0241"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29322"
FT                   /db_xref="GOA:A0A1T3UU99"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UU99"
FT                   /protein_id="AAT29322.1"
FT   gene            228933..230105
FT                   /locus_tag="GBAA_0242"
FT                   /old_locus_tag="GBAA0242"
FT   CDS_pept        228933..230105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0242"
FT                   /old_locus_tag="GBAA0242"
FT                   /product="putative homogentisate 1,2-dioxygenase"
FT                   /note="identified by match to protein family HMM PF04209"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29323"
FT                   /db_xref="GOA:Q81VG4"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VG4"
FT                   /protein_id="AAT29323.1"
FT   gene            230118..230228
FT                   /locus_tag="GBAA_0243"
FT                   /old_locus_tag="GBAA0243"
FT   CDS_pept        230118..230228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0243"
FT                   /old_locus_tag="GBAA0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35258"
FT                   /db_xref="GOA:A0A1T3UUA4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3UUA4"
FT                   /protein_id="AAT35258.1"
FT   gene            230339..231610
FT                   /locus_tag="GBAA_0244"
FT                   /old_locus_tag="GBAA0244"
FT   CDS_pept        230339..231610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0244"
FT                   /old_locus_tag="GBAA0244"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29324"
FT                   /db_xref="GOA:Q81VG2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VG2"
FT                   /protein_id="AAT29324.1"
FT   gene            231993..233079
FT                   /pseudo
FT                   /locus_tag="GBAA_0245"
FT                   /old_locus_tag="GBAA0245"
FT                   /note="D-alanine--D-alanine ligase, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF01820"
FT   gene            233140..234516
FT                   /gene="murF"
FT                   /locus_tag="GBAA_0246"
FT                   /old_locus_tag="GBAA0246"
FT   CDS_pept        233140..234516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="GBAA_0246"
FT                   /old_locus_tag="GBAA0246"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29327"
FT                   /db_xref="GOA:A0A1S0QZJ5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QZJ5"
FT                   /protein_id="AAT29327.1"
FT                   "
FT   gene            234821..236407
FT                   /locus_tag="GBAA_0247"
FT                   /old_locus_tag="GBAA0247"
FT   CDS_pept        234821..236407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0247"
FT                   /old_locus_tag="GBAA0247"
FT                   /product="ATP-dependent RNA helicase, DEAD/DEAH box family"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29328"
FT                   /db_xref="GOA:Q81VG0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VG0"
FT                   /protein_id="AAT29328.1"
FT                   ERKHHSRKPQA"
FT   gene            236504..237466
FT                   /locus_tag="GBAA_0248"
FT                   /old_locus_tag="GBAA0248"
FT   CDS_pept        236504..237466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0248"
FT                   /old_locus_tag="GBAA0248"
FT                   /product="putative UV-endonuclease"
FT                   /note="identified by match to protein family HMM PF03851;
FT                   match to protein family HMM TIGR00629"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29329"
FT                   /db_xref="GOA:Q81VF9"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VF9"
FT                   /protein_id="AAT29329.1"
FT   gene            complement(237459..238031)
FT                   /locus_tag="GBAA_0249"
FT                   /old_locus_tag="GBAA0249"
FT   CDS_pept        complement(237459..238031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0249"
FT                   /old_locus_tag="GBAA0249"
FT                   /product="rhomboid family protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29330"
FT                   /db_xref="GOA:A0A0F7R7R0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R7R0"
FT                   /protein_id="AAT29330.1"
FT   gene            238124..238483
FT                   /gene="acpS"
FT                   /locus_tag="GBAA_0250"
FT                   /old_locus_tag="GBAA0250"
FT   CDS_pept        238124..238483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="GBAA_0250"
FT                   /old_locus_tag="GBAA0250"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29331"
FT                   /db_xref="GOA:Q81JG3"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="PDB:3HYK"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81JG3"
FT                   /protein_id="AAT29331.1"
FT                   KEFAVAQVVLESSSS"
FT   gene            238577..239590
FT                   /locus_tag="GBAA_0251"
FT                   /old_locus_tag="GBAA0251"
FT   CDS_pept        238577..239590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0251"
FT                   /old_locus_tag="GBAA0251"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29332"
FT                   /db_xref="GOA:A0A1V4B6I8"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B6I8"
FT                   /protein_id="AAT29332.1"
FT   gene            239709..240878
FT                   /gene="dal1"
FT                   /locus_tag="GBAA_0252"
FT                   /old_locus_tag="GBAA0252"
FT   CDS_pept        239709..240878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dal1"
FT                   /locus_tag="GBAA_0252"
FT                   /old_locus_tag="GBAA0252"
FT                   /product="alanine racemase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00842;
FT                   match to protein family HMM PF01168; match to protein
FT                   family HMM TIGR00492"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29333"
FT                   /db_xref="GOA:A0A0F7R3Y0"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="PDB:2VD8"
FT                   /db_xref="PDB:2VD9"
FT                   /db_xref="PDB:3HA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7R3Y0"
FT                   /protein_id="AAT29333.1"
FT   gene            241188..241475
FT                   /locus_tag="GBAA_0253"
FT                   /old_locus_tag="GBAA0253"
FT   CDS_pept        241188..241475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0253"
FT                   /old_locus_tag="GBAA0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29334"
FT                   /db_xref="GOA:Q81VF5"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VF5"
FT                   /protein_id="AAT29334.1"
FT   gene            241480..241830
FT                   /locus_tag="GBAA_0254"
FT                   /old_locus_tag="GBAA0254"
FT   CDS_pept        241480..241830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0254"
FT                   /old_locus_tag="GBAA0254"
FT                   /product="transcriptional regulator, PemK family"
FT                   /note="identified by match to protein family HMM PF02452"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29335"
FT                   /db_xref="GOA:A0A0J1HNC0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="PDB:4HKE"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HNC0"
FT                   /protein_id="AAT29335.2"
FT                   EALQISLGLIDF"
FT   gene            241898..244066
FT                   /locus_tag="GBAA_0255"
FT                   /old_locus_tag="GBAA0255"
FT   CDS_pept        241898..244066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0255"
FT                   /old_locus_tag="GBAA0255"
FT                   /product="S1 RNA binding domain protein"
FT                   /note="identified by match to protein family HMM PF00575"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29336"
FT                   /db_xref="GOA:Q81VF3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VF3"
FT                   /protein_id="AAT29336.1"
FT   gene            complement(244124..244240)
FT                   /locus_tag="GBAA_0256"
FT                   /old_locus_tag="GBAA0256"
FT   CDS_pept        complement(244124..244240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0256"
FT                   /old_locus_tag="GBAA0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29337"
FT                   /db_xref="GOA:A0A1J9V7Y2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V7Y2"
FT                   /protein_id="AAT29337.2"
FT   gene            244436..244894
FT                   /locus_tag="GBAA_0257"
FT                   /old_locus_tag="GBAA0257"
FT   CDS_pept        244436..244894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0257"
FT                   /old_locus_tag="GBAA0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03926"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29338"
FT                   /db_xref="GOA:Q81VF1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VF1"
FT                   /protein_id="AAT29338.1"
FT   gene            245009..245083
FT                   /locus_tag="GBAA_5879"
FT   tRNA            245009..245083
FT                   /locus_tag="GBAA_5879"
FT                   /product="tRNA-Asn"
FT   gene            245087..245177
FT                   /locus_tag="GBAA_5880"
FT   tRNA            245087..245177
FT                   /locus_tag="GBAA_5880"
FT                   /product="tRNA-Ser"
FT   gene            245186..245260
FT                   /locus_tag="GBAA_5881"
FT   tRNA            245186..245260
FT                   /locus_tag="GBAA_5881"
FT                   /product="tRNA-Glu"
FT   gene            245265..245340
FT                   /locus_tag="GBAA_5882"
FT   tRNA            245265..245340
FT                   /locus_tag="GBAA_5882"
FT                   /product="tRNA-Val"
FT   gene            245387..245462
FT                   /locus_tag="GBAA_5883"
FT   tRNA            245387..245462
FT                   /locus_tag="GBAA_5883"
FT                   /product="tRNA-Asp"
FT   gene            245551..245625
FT                   /locus_tag="GBAA_5884"
FT   tRNA            245551..245625
FT                   /locus_tag="GBAA_5884"
FT                   /product="tRNA-Gln"
FT   gene            245631..245703
FT                   /locus_tag="GBAA_5885"
FT   tRNA            245631..245703
FT                   /locus_tag="GBAA_5885"
FT                   /product="tRNA-Lys"
FT   gene            245721..245806
FT                   /locus_tag="GBAA_5886"
FT   tRNA            245721..245806
FT                   /locus_tag="GBAA_5886"
FT                   /product="tRNA-Leu"
FT   gene            245902..245978
FT                   /locus_tag="GBAA_5887"
FT   tRNA            245902..245978
FT                   /locus_tag="GBAA_5887"
FT                   /product="tRNA-Arg"
FT   gene            245983..246059
FT                   /locus_tag="GBAA_5888"
FT   tRNA            245983..246059
FT                   /locus_tag="GBAA_5888"
FT                   /product="tRNA-Pro"
FT   gene            246061..246131
FT                   /locus_tag="GBAA_5889"
FT   tRNA            246061..246131
FT                   /locus_tag="GBAA_5889"
FT                   /product="tRNA-Gly"
FT   gene            246235..247741
FT                   /gene="rrsE"
FT                   /locus_tag="GBAA_5970"
FT   rRNA            246235..247741
FT                   /gene="rrsE"
FT                   /locus_tag="GBAA_5970"
FT                   /product="16S ribosomal RNA"
FT   gene            247920..250827
FT                   /gene="rrlE"
FT                   /locus_tag="GBAA_5971"
FT   rRNA            247920..250827
FT                   /gene="rrlE"
FT                   /locus_tag="GBAA_5971"
FT                   /product="23S ribosomal RNA"
FT   gene            250877..250992
FT                   /gene="rrfE"
FT                   /locus_tag="GBAA_5972"
FT   rRNA            250877..250992
FT                   /gene="rrfE"
FT                   /locus_tag="GBAA_5972"
FT                   /product="5S ribosomal RNA"
FT   gene            251005..251081
FT                   /locus_tag="GBAA_5890"
FT   tRNA            251005..251081
FT                   /locus_tag="GBAA_5890"
FT                   /product="tRNA-Met"
FT   gene            251085..251160
FT                   /locus_tag="GBAA_5891"
FT   tRNA            251085..251160
FT                   /locus_tag="GBAA_5891"
FT                   /product="tRNA-Asp"
FT   gene            251335..251808
FT                   /locus_tag="GBAA_0258"
FT                   /old_locus_tag="GBAA0258"
FT   CDS_pept        251335..251808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0258"
FT                   /old_locus_tag="GBAA0258"
FT                   /product="conserved hypothetical protein TIGR00150"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29341"
FT                   /db_xref="GOA:Q81VF0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VF0"
FT                   /protein_id="AAT29341.1"
FT   gene            251789..252481
FT                   /locus_tag="GBAA_0259"
FT                   /old_locus_tag="GBAA0259"
FT   CDS_pept        251789..252481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0259"
FT                   /old_locus_tag="GBAA0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29342"
FT                   /db_xref="GOA:Q81VE9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VE9"
FT                   /protein_id="AAT29342.1"
FT                   KWLESQNK"
FT   gene            252501..252938
FT                   /gene="rimI"
FT                   /locus_tag="GBAA_0260"
FT                   /old_locus_tag="GBAA0260"
FT   CDS_pept        252501..252938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="GBAA_0260"
FT                   /old_locus_tag="GBAA0260"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29343"
FT                   /db_xref="GOA:Q81VE8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VE8"
FT                   /protein_id="AAT29343.2"
FT   gene            252938..253954
FT                   /locus_tag="GBAA_0261"
FT                   /old_locus_tag="GBAA0261"
FT   CDS_pept        252938..253954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0261"
FT                   /old_locus_tag="GBAA0261"
FT                   /product="putative O-sialoglycoprotein endopeptidase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29344"
FT                   /db_xref="GOA:Q6I4E9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6I4E9"
FT                   /protein_id="AAT29344.1"
FT   gene            complement(254436..256358)
FT                   /locus_tag="GBAA_0262"
FT                   /old_locus_tag="GBAA0262"
FT   CDS_pept        complement(254436..256358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0262"
FT                   /old_locus_tag="GBAA0262"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29346"
FT                   /db_xref="GOA:Q81VE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VE6"
FT                   /protein_id="AAT29346.2"
FT                   EELHV"
FT   gene            256546..257175
FT                   /locus_tag="GBAA_0263"
FT                   /old_locus_tag="GBAA0263"
FT   CDS_pept        256546..257175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0263"
FT                   /old_locus_tag="GBAA0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29347"
FT                   /db_xref="GOA:Q81VE5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE5"
FT                   /protein_id="AAT29347.1"
FT   gene            complement(257205..257396)
FT                   /locus_tag="GBAA_0264"
FT                   /old_locus_tag="GBAA0264"
FT   CDS_pept        complement(257205..257396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0264"
FT                   /old_locus_tag="GBAA0264"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35259"
FT                   /db_xref="GOA:A0A0J1HJU5"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HJU5"
FT                   /protein_id="AAT35259.1"
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(257393..258100)
FT                   /locus_tag="GBAA_0265"
FT                   /old_locus_tag="GBAA0265"
FT   CDS_pept        complement(257393..258100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0265"
FT                   /old_locus_tag="GBAA0265"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35260"
FT                   /db_xref="GOA:Q81VE3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VE3"
FT                   /protein_id="AAT35260.1"
FT                   AEKMQGFIGGFLV"
FT   gene            258543..258827
FT                   /gene="groES"
FT                   /locus_tag="GBAA_0266"
FT                   /old_locus_tag="GBAA0266"
FT   CDS_pept        258543..258827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="GBAA_0266"
FT                   /old_locus_tag="GBAA0266"
FT                   /product="chaperonin, 10 kDa"
FT                   /note="identified by match to protein family HMM PF00166"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29349"
FT                   /db_xref="GOA:Q81VE2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE2"
FT                   /protein_id="AAT29349.1"
FT   gene            258866..260500
FT                   /gene="groL"
FT                   /locus_tag="GBAA_0267"
FT                   /old_locus_tag="GBAA0267"
FT   CDS_pept        258866..260500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="GBAA_0267"
FT                   /old_locus_tag="GBAA0267"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29351"
FT                   /db_xref="GOA:Q81VE1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE1"
FT                   /protein_id="AAT29351.1"
FT   gene            260908..262446
FT                   /gene="guaA"
FT                   /locus_tag="GBAA_0268"
FT                   /old_locus_tag="GBAA0268"
FT   CDS_pept        260908..262446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="GBAA_0268"
FT                   /old_locus_tag="GBAA0268"
FT                   /product="GMP synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00958; match to protein
FT                   family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29352"
FT                   /db_xref="GOA:Q81VE0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VE0"
FT                   /protein_id="AAT29352.2"
FT   gene            262831..264156
FT                   /locus_tag="GBAA_0270"
FT                   /old_locus_tag="GBAA0270"
FT   CDS_pept        262831..264156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0270"
FT                   /old_locus_tag="GBAA0270"
FT                   /product="xanthine/uracil permease family protein"
FT                   /note="identified by match to protein family HMM PF00860;
FT                   match to protein family HMM PF00916"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29353"
FT                   /db_xref="GOA:A0A0J1HJU1"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HJU1"
FT                   /protein_id="AAT29353.1"
FT   gene            264301..265002
FT                   /locus_tag="GBAA_0271"
FT                   /old_locus_tag="GBAA0271"
FT   CDS_pept        264301..265002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0271"
FT                   /old_locus_tag="GBAA0271"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29354"
FT                   /db_xref="GOA:A0A1Q4M4I5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4M4I5"
FT                   /protein_id="AAT29354.1"
FT                   WGVGYKIEKDI"
FT   gene            264986..266491
FT                   /locus_tag="GBAA_0272"
FT                   /old_locus_tag="GBAA0272"
FT   CDS_pept        264986..266491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0272"
FT                   /old_locus_tag="GBAA0272"
FT                   /product="sensor histidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29355"
FT                   /db_xref="GOA:A0A0F7RI94"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI94"
FT                   /protein_id="AAT29355.1"
FT   gene            266814..268320
FT                   /gene="rrsF"
FT                   /locus_tag="GBAA_5973"
FT   rRNA            266814..268320
FT                   /gene="rrsF"
FT                   /locus_tag="GBAA_5973"
FT                   /product="16S ribosomal RNA"
FT   gene            268499..271406
FT                   /gene="rrlF"
FT                   /locus_tag="GBAA_5974"
FT   rRNA            268499..271406
FT                   /gene="rrlF"
FT                   /locus_tag="GBAA_5974"
FT                   /product="23S ribosomal RNA"
FT   gene            271456..271571
FT                   /gene="rrfF"
FT                   /locus_tag="GBAA_5975"
FT   rRNA            271456..271571
FT                   /gene="rrfF"
FT                   /locus_tag="GBAA_5975"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(271709..272662)
FT                   /locus_tag="GBAA_0273"
FT                   /old_locus_tag="GBAA0273"
FT   CDS_pept        complement(271709..272662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0273"
FT                   /old_locus_tag="GBAA0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAI33488.1"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29357"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT2"
FT                   /protein_id="AAT29357.1"
FT   gene            complement(272895..273767)
FT                   /locus_tag="GBAA_0274"
FT                   /old_locus_tag="GBAA0274"
FT   CDS_pept        complement(272895..273767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0274"
FT                   /old_locus_tag="GBAA0274"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VD5"
FT                   /protein_id="AAT29358.1"
FT                   QALFVLQKD"
FT   gene            complement(273794..274516)
FT                   /locus_tag="GBAA_0275"
FT                   /old_locus_tag="GBAA0275"
FT   CDS_pept        complement(273794..274516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0275"
FT                   /old_locus_tag="GBAA0275"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29359"
FT                   /db_xref="GOA:Q81VD4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VD4"
FT                   /protein_id="AAT29359.1"
FT                   LDAEFLHVFISKKHEHNF"
FT   gene            complement(274820..275614)
FT                   /locus_tag="GBAA_0276"
FT                   /old_locus_tag="GBAA0276"
FT   CDS_pept        complement(274820..275614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0276"
FT                   /old_locus_tag="GBAA0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29360"
FT                   /db_xref="GOA:A0A0F7RK18"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RK18"
FT                   /protein_id="AAT29360.1"
FT   gene            275877..276819
FT                   /pseudo
FT                   /locus_tag="GBAA_0277"
FT                   /old_locus_tag="GBAA0277"
FT                   /note="UDP-glucose 4-epimerase, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            complement(276860..277633)
FT                   /locus_tag="GBAA_0278"
FT                   /old_locus_tag="GBAA0278"
FT   CDS_pept        complement(276860..277633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0278"
FT                   /old_locus_tag="GBAA0278"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29364"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT0"
FT                   /protein_id="AAT29364.1"
FT   gene            complement(277701..279632)
FT                   /pseudo
FT                   /locus_tag="GBAA_0280"
FT                   /old_locus_tag="GBAA0280"
FT                   /note="glycosyl transferase, group 1 family protein,
FT                   authentic point mutation; this gene contains a premature
FT                   stop which is not the result of sequencing error;
FT                   identified by match to protein family HMM PF00534"
FT   gene            280018..280116
FT                   /locus_tag="GBAA_0281"
FT                   /old_locus_tag="GBAA0281"
FT   CDS_pept        280018..280116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0281"
FT                   /old_locus_tag="GBAA0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29634"
FT                   /db_xref="GOA:Q81JD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q81JD8"
FT                   /protein_id="AAT29634.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            280112..281618
FT                   /gene="rrsG"
FT                   /locus_tag="GBAA_5976"
FT   rRNA            280112..281618
FT                   /gene="rrsG"
FT                   /locus_tag="GBAA_5976"
FT                   /product="16S ribosomal RNA"
FT   gene            281797..284704
FT                   /gene="rrlG"
FT                   /locus_tag="GBAA_5977"
FT   rRNA            281797..284704
FT                   /gene="rrlG"
FT                   /locus_tag="GBAA_5977"
FT                   /product="23S ribosomal RNA"
FT   gene            284755..284870
FT                   /gene="rrfG"
FT                   /locus_tag="GBAA_5978"
FT   rRNA            284755..284870
FT                   /gene="rrfG"
FT                   /locus_tag="GBAA_5978"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(285321..286118)
FT                   /gene="bacA1"
FT                   /locus_tag="GBAA_0283"
FT                   /old_locus_tag="GBAA0283"
FT   CDS_pept        complement(285321..286118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA1"
FT                   /locus_tag="GBAA_0283"
FT                   /old_locus_tag="GBAA0283"
FT                   /product="bacitracin resistance protein"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29368"
FT                   /db_xref="GOA:Q81VC9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81VC9"
FT                   /protein_id="AAT29368.1"
FT   gene            complement(286136..286882)
FT                   /locus_tag="GBAA_0284"
FT                   /old_locus_tag="GBAA0284"
FT   CDS_pept        complement(286136..286882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0284"
FT                   /old_locus_tag="GBAA0284"
FT                   /product="putative bacitracin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29369"
FT                   /db_xref="GOA:Q81VC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC8"
FT                   /protein_id="AAT29369.1"
FT   gene            complement(286866..287795)
FT                   /locus_tag="GBAA_0285"
FT                   /old_locus_tag="GBAA0285"
FT   CDS_pept        complement(286866..287795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0285"
FT                   /old_locus_tag="GBAA0285"
FT                   /product="putative bacitracin ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29370"
FT                   /db_xref="GOA:A0A0F7RI81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI81"
FT                   /protein_id="AAT29370.1"
FT   gene            complement(287864..288808)
FT                   /locus_tag="GBAA_0286"
FT                   /old_locus_tag="GBAA0286"
FT   CDS_pept        complement(287864..288808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0286"
FT                   /old_locus_tag="GBAA0286"
FT                   /product="putative sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29371"
FT                   /db_xref="GOA:Q81VC6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC6"
FT                   /protein_id="AAT29371.2"
FT   gene            complement(288867..289580)
FT                   /locus_tag="GBAA_0287"
FT                   /old_locus_tag="GBAA0287"
FT   CDS_pept        complement(288867..289580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0287"
FT                   /old_locus_tag="GBAA0287"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29372"
FT                   /db_xref="GOA:A0A0F7RN09"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RN09"
FT                   /protein_id="AAT29372.1"
FT                   VWGIGYKFVGEKLED"
FT   gene            290085..291591
FT                   /gene="rrsH"
FT                   /locus_tag="GBAA_5979"
FT   rRNA            290085..291591
FT                   /gene="rrsH"
FT                   /locus_tag="GBAA_5979"
FT                   /product="16S ribosomal RNA"
FT   gene            291770..294677
FT                   /gene="rrlH"
FT                   /locus_tag="GBAA_5980"
FT   rRNA            291770..294677
FT                   /gene="rrlH"
FT                   /locus_tag="GBAA_5980"
FT                   /product="23S ribosomal RNA"
FT   gene            294728..294843
FT                   /gene="rrfH"
FT                   /locus_tag="GBAA_5981"
FT   rRNA            294728..294843
FT                   /gene="rrfH"
FT                   /locus_tag="GBAA_5981"
FT                   /product="5S ribosomal RNA"
FT   gene            295542..296027
FT                   /gene="purE"
FT                   /locus_tag="GBAA_0288"
FT                   /old_locus_tag="GBAA0288"
FT   CDS_pept        295542..296027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="GBAA_0288"
FT                   /old_locus_tag="GBAA0288"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29375"
FT                   /db_xref="GOA:A0A1S0QXP6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="PDB:1XMP"
FT                   /db_xref="PDB:4AY3"
FT                   /db_xref="PDB:4AY4"
FT                   /db_xref="PDB:4B4K"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QXP6"
FT                   /protein_id="AAT29375.1"
FT   gene            296024..297175
FT                   /gene="purK"
FT                   /locus_tag="GBAA_0289"
FT                   /old_locus_tag="GBAA0289"
FT   CDS_pept        296024..297175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="GBAA_0289"
FT                   /old_locus_tag="GBAA0289"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29376"
FT                   /db_xref="GOA:A0A0F7RI76"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="PDB:4DLK"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI76"
FT                   /protein_id="AAT29376.2"
FT   gene            297172..298479
FT                   /gene="purB"
FT                   /locus_tag="GBAA_0290"
FT                   /old_locus_tag="GBAA0290"
FT   CDS_pept        297172..298479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="GBAA_0290"
FT                   /old_locus_tag="GBAA0290"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29377"
FT                   /db_xref="GOA:A0A0J1HRL9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="PDB:2PFM"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRL9"
FT                   /protein_id="AAT29377.1"
FT   gene            298568..299287
FT                   /gene="purC"
FT                   /locus_tag="GBAA_0291"
FT                   /old_locus_tag="GBAA0291"
FT   CDS_pept        298568..299287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="GBAA_0291"
FT                   /old_locus_tag="GBAA0291"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29378"
FT                   /db_xref="GOA:Q81ZH5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH5"
FT                   /protein_id="AAT29378.1"
FT                   TDAYEEILKRLGGISHV"
FT   gene            299280..299534
FT                   /locus_tag="GBAA_0292"
FT                   /old_locus_tag="GBAA0292"
FT   CDS_pept        299280..299534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0292"
FT                   /old_locus_tag="GBAA0292"
FT                   /product="phosphoribosylformylglycinamidine synthase, PurS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29379"
FT                   /db_xref="GOA:A0A2A8L495"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8L495"
FT                   /protein_id="AAT29379.1"
FT   gene            299531..300214
FT                   /gene="purQ"
FT                   /locus_tag="GBAA_0293"
FT                   /old_locus_tag="GBAA0293"
FT   CDS_pept        299531..300214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="GBAA_0293"
FT                   /old_locus_tag="GBAA0293"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF01965; match to protein
FT                   family HMM PF07685; match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29380"
FT                   /db_xref="GOA:Q81ZH3"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH3"
FT                   /protein_id="AAT29380.1"
FT                   YVVNA"
FT   gene            300198..302417
FT                   /gene="purL"
FT                   /locus_tag="GBAA_0294"
FT                   /old_locus_tag="GBAA0294"
FT   CDS_pept        300198..302417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="GBAA_0294"
FT                   /old_locus_tag="GBAA0294"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01736"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29381"
FT                   /db_xref="GOA:Q81ZH2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH2"
FT                   /protein_id="AAT29381.1"
FT   gene            302402..303817
FT                   /gene="purF"
FT                   /locus_tag="GBAA_0295"
FT                   /old_locus_tag="GBAA0295"
FT   CDS_pept        302402..303817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="GBAA_0295"
FT                   /old_locus_tag="GBAA0295"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29382"
FT                   /db_xref="GOA:A0A1S0QQ52"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QQ52"
FT                   /protein_id="AAT29382.1"
FT                   LYDYEQELLESMK"
FT   gene            303924..304964
FT                   /gene="purM"
FT                   /locus_tag="GBAA_0296"
FT                   /old_locus_tag="GBAA0296"
FT   CDS_pept        303924..304964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="GBAA_0296"
FT                   /old_locus_tag="GBAA0296"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR00878"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29383"
FT                   /db_xref="GOA:Q81ZH0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="PDB:2BTU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZH0"
FT                   /protein_id="AAT29383.1"
FT                   NGGKAL"
FT   gene            304961..305548
FT                   /gene="purN"
FT                   /locus_tag="GBAA_0297"
FT                   /old_locus_tag="GBAA0297"
FT   CDS_pept        304961..305548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="GBAA_0297"
FT                   /old_locus_tag="GBAA0297"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29384"
FT                   /db_xref="GOA:A0A1S0QNW4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QNW4"
FT                   /protein_id="AAT29384.1"
FT   gene            305573..307108
FT                   /gene="purH"
FT                   /locus_tag="GBAA_0298"
FT                   /old_locus_tag="GBAA0298"
FT   CDS_pept        305573..307108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="GBAA_0298"
FT                   /old_locus_tag="GBAA0298"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29385"
FT                   /db_xref="GOA:Q81ZG8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG8"
FT                   /protein_id="AAT29385.1"
FT   gene            307230..308501
FT                   /gene="purD"
FT                   /locus_tag="GBAA_0299"
FT                   /old_locus_tag="GBAA0299"
FT   CDS_pept        307230..308501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="GBAA_0299"
FT                   /old_locus_tag="GBAA0299"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF02655; match to protein family HMM PF02843;
FT                   match to protein family HMM PF02844; match to protein
FT                   family HMM PF08442; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29386"
FT                   /db_xref="GOA:A0A0F7RI71"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI71"
FT                   /protein_id="AAT29386.1"
FT   gene            complement(308537..308701)
FT                   /locus_tag="GBAA_0300"
FT                   /old_locus_tag="GBAA0300"
FT   CDS_pept        complement(308537..308701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0300"
FT                   /old_locus_tag="GBAA0300"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29387"
FT                   /db_xref="GOA:A0A1Q4LXA8"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LXA8"
FT                   /protein_id="AAT29387.1"
FT                   GKLKKDKDA"
FT   gene            complement(308718..309563)
FT                   /locus_tag="GBAA_0301"
FT                   /old_locus_tag="GBAA0301"
FT   CDS_pept        complement(308718..309563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0301"
FT                   /old_locus_tag="GBAA0301"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29388"
FT                   /db_xref="GOA:A0A0F7RN03"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RN03"
FT                   /protein_id="AAT29388.1"
FT                   "
FT   gene            complement(309773..310150)
FT                   /locus_tag="GBAA_0302"
FT                   /old_locus_tag="GBAA0302"
FT   CDS_pept        complement(309773..310150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0302"
FT                   /old_locus_tag="GBAA0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29389"
FT                   /db_xref="GOA:A0A1Q4LXC7"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LXC7"
FT                   /protein_id="AAT29389.1"
FT   gene            310422..311174
FT                   /locus_tag="GBAA_0304"
FT                   /old_locus_tag="GBAA0304"
FT   CDS_pept        310422..311174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0304"
FT                   /old_locus_tag="GBAA0304"
FT                   /product="pcrB family protein"
FT                   /note="identified by match to protein family HMM PF01884;
FT                   match to protein family HMM TIGR01768"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29390"
FT                   /db_xref="GOA:Q81ZG3"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG3"
FT                   /protein_id="AAT29390.2"
FT   gene            311187..313430
FT                   /gene="pcrA"
FT                   /locus_tag="GBAA_0305"
FT                   /old_locus_tag="GBAA0305"
FT   CDS_pept        311187..313430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="GBAA_0305"
FT                   /old_locus_tag="GBAA0305"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to GB:AAT52622.1; match to
FT                   protein family HMM PF00580; match to protein family HMM
FT                   TIGR01073"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29391"
FT                   /db_xref="GOA:Q81ZG2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZG2"
FT                   /protein_id="AAT29391.1"
FT   gene            313446..315455
FT                   /gene="ligA"
FT                   /locus_tag="GBAA_0306"
FT                   /old_locus_tag="GBAA0306"
FT   CDS_pept        313446..315455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="GBAA_0306"
FT                   /old_locus_tag="GBAA0306"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAT70114"
FT                   /db_xref="GOA:Q81ZG1"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZG1"
FT                   /protein_id="AAT70114.1"
FT   gene            315472..316665
FT                   /locus_tag="GBAA_0307"
FT                   /old_locus_tag="GBAA0307"
FT   CDS_pept        315472..316665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0307"
FT                   /old_locus_tag="GBAA0307"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF07537"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29394"
FT                   /db_xref="GOA:A0A0F7RN01"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RN01"
FT                   /protein_id="AAT29394.1"
FT   gene            316761..317531
FT                   /locus_tag="GBAA_0308"
FT                   /old_locus_tag="GBAA0308"
FT   CDS_pept        316761..317531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0308"
FT                   /old_locus_tag="GBAA0308"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29395"
FT                   /db_xref="GOA:A0A1Q4LXL1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LXL1"
FT                   /protein_id="AAT29395.1"
FT   gene            317685..319232
FT                   /locus_tag="GBAA_0309"
FT                   /old_locus_tag="GBAA0309"
FT   CDS_pept        317685..319232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0309"
FT                   /old_locus_tag="GBAA0309"
FT                   /product="putative delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01237"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29396"
FT                   /db_xref="GOA:Q81ZF8"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF8"
FT                   /protein_id="AAT29396.1"
FT   gene            319418..319567
FT                   /locus_tag="GBAA_0310"
FT                   /old_locus_tag="GBAA0310"
FT   CDS_pept        319418..319567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0310"
FT                   /old_locus_tag="GBAA0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29397"
FT                   /db_xref="GOA:A0A1Q4LXT7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LXT7"
FT                   /protein_id="AAT29397.1"
FT                   QTDK"
FT   gene            complement(319799..320362)
FT                   /locus_tag="GBAA_0311"
FT                   /old_locus_tag="GBAA0311"
FT   CDS_pept        complement(319799..320362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0311"
FT                   /old_locus_tag="GBAA0311"
FT                   /product="isochorismatase family protein"
FT                   /note="identified by match to protein family HMM PF00857"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29398"
FT                   /db_xref="GOA:A0A1J9WCM4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WCM4"
FT                   /protein_id="AAT29398.1"
FT   gene            320835..321854
FT                   /locus_tag="GBAA_0312"
FT                   /old_locus_tag="GBAA0312"
FT   CDS_pept        320835..321854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0312"
FT                   /old_locus_tag="GBAA0312"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29400"
FT                   /db_xref="GOA:Q81ZF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZF5"
FT                   /protein_id="AAT29400.1"
FT   gene            321844..322509
FT                   /locus_tag="GBAA_0313"
FT                   /old_locus_tag="GBAA0313"
FT   CDS_pept        321844..322509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0313"
FT                   /old_locus_tag="GBAA0313"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29402"
FT                   /db_xref="GOA:A0A1J9VXY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VXY7"
FT                   /protein_id="AAT29402.1"
FT   gene            322531..323385
FT                   /locus_tag="GBAA_0314"
FT                   /old_locus_tag="GBAA0314"
FT   CDS_pept        322531..323385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0314"
FT                   /old_locus_tag="GBAA0314"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03180"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29403"
FT                   /db_xref="GOA:A0A2A8YG77"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8YG77"
FT                   /protein_id="AAT29403.1"
FT                   IVK"
FT   gene            complement(323552..324022)
FT                   /locus_tag="GBAA_0315"
FT                   /old_locus_tag="GBAA0315"
FT   CDS_pept        complement(323552..324022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0315"
FT                   /old_locus_tag="GBAA0315"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35261"
FT                   /db_xref="GOA:Q81ZF2"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZF2"
FT                   /protein_id="AAT35261.1"
FT   gene            complement(324081..324272)
FT                   /locus_tag="GBAA_0316"
FT                   /old_locus_tag="GBAA0316"
FT   CDS_pept        complement(324081..324272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0316"
FT                   /old_locus_tag="GBAA0316"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29404"
FT                   /db_xref="GOA:Q81ZF1"
FT                   /db_xref="InterPro:IPR025076"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZF1"
FT                   /protein_id="AAT29404.1"
FT                   YPNEQGHHKNNLKNIIIE"
FT   gene            complement(324265..325442)
FT                   /pseudo
FT                   /locus_tag="GBAA_0317"
FT                   /old_locus_tag="GBAA0317"
FT                   /note="anion-transporting ATPase family protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF02374"
FT   gene            complement(325522..326004)
FT                   /locus_tag="GBAA_0318"
FT                   /old_locus_tag="GBAA0318"
FT   CDS_pept        complement(325522..326004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0318"
FT                   /old_locus_tag="GBAA0318"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29407"
FT                   /db_xref="GOA:A0A1J9VUR9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VUR9"
FT                   /protein_id="AAT29407.1"
FT   gene            326236..326473
FT                   /pseudo
FT                   /locus_tag="GBAA_0319"
FT                   /old_locus_tag="GBAA0319"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error"
FT   gene            326615..326905
FT                   /gene="gatC"
FT                   /locus_tag="GBAA_0320"
FT                   /old_locus_tag="GBAA0320"
FT   CDS_pept        326615..326905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="GBAA_0320"
FT                   /old_locus_tag="GBAA0320"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29409"
FT                   /db_xref="GOA:Q81ZE9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE9"
FT                   /protein_id="AAT29409.1"
FT   gene            326921..328378
FT                   /gene="gatA"
FT                   /locus_tag="GBAA_0321"
FT                   /old_locus_tag="GBAA0321"
FT   CDS_pept        326921..328378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="GBAA_0321"
FT                   /old_locus_tag="GBAA0321"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425;
FT                   match to protein family HMM TIGR00132"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAT70115"
FT                   /db_xref="GOA:Q81ZE8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE8"
FT                   /protein_id="AAT70115.1"
FT   gene            328393..329820
FT                   /gene="gatB"
FT                   /locus_tag="GBAA_0322"
FT                   /old_locus_tag="GBAA0322"
FT   CDS_pept        328393..329820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="GBAA_0322"
FT                   /old_locus_tag="GBAA0322"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29412"
FT                   /db_xref="GOA:Q81ZE7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZE7"
FT                   /protein_id="AAT29412.1"
FT                   ANPPLVNKILLEEINKR"
FT   gene            330291..331196
FT                   /locus_tag="GBAA_0323"
FT                   /old_locus_tag="GBAA0323"
FT   CDS_pept        330291..331196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0323"
FT                   /old_locus_tag="GBAA0323"
FT                   /product="conserved hypothetical protein TIGR00147"
FT                   /note="identified by match to protein family HMM PF00781;
FT                   match to protein family HMM TIGR00147"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29413"
FT                   /db_xref="GOA:A0A2A7DET4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A7DET4"
FT                   /protein_id="AAT29413.1"
FT   gene            331336..332079
FT                   /locus_tag="GBAA_0324"
FT                   /old_locus_tag="GBAA0324"
FT   CDS_pept        331336..332079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0324"
FT                   /old_locus_tag="GBAA0324"
FT                   /product="haloacid dehalogenase/epoxide hydrolase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01549"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29414"
FT                   /db_xref="GOA:A0A0F7RNS8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNS8"
FT                   /protein_id="AAT29414.1"
FT   gene            332234..333598
FT                   /gene="gabT"
FT                   /locus_tag="GBAA_0325"
FT                   /old_locus_tag="GBAA0325"
FT   CDS_pept        332234..333598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="GBAA_0325"
FT                   /old_locus_tag="GBAA0325"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00700"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29416"
FT                   /db_xref="GOA:Q81ZE4"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZE4"
FT                   /protein_id="AAT29416.1"
FT   gene            333711..335078
FT                   /locus_tag="GBAA_0326"
FT                   /old_locus_tag="GBAA0326"
FT   CDS_pept        333711..335078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0326"
FT                   /old_locus_tag="GBAA0326"
FT                   /product="sensory box sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM PF08448; match to protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29417"
FT                   /db_xref="GOA:A0A1J9V906"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V906"
FT                   /protein_id="AAT29417.1"
FT   gene            335071..336522
FT                   /gene="gabD"
FT                   /locus_tag="GBAA_0327"
FT                   /old_locus_tag="GBAA0327"
FT   CDS_pept        335071..336522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="GBAA_0327"
FT                   /old_locus_tag="GBAA0327"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01780"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29418"
FT                   /db_xref="GOA:A0A1V4B8A9"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B8A9"
FT                   /protein_id="AAT29418.2"
FT   gene            336570..336893
FT                   /locus_tag="GBAA_0328"
FT                   /old_locus_tag="GBAA0328"
FT   CDS_pept        336570..336893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0328"
FT                   /old_locus_tag="GBAA0328"
FT                   /product="multidrug resistance protein, Smr family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29419"
FT                   /db_xref="GOA:A0A0J1HRK2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRK2"
FT                   /protein_id="AAT29419.1"
FT                   SAS"
FT   gene            complement(336933..338162)
FT                   /gene="ampS"
FT                   /locus_tag="GBAA_0329"
FT                   /old_locus_tag="GBAA0329"
FT   CDS_pept        complement(336933..338162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="GBAA_0329"
FT                   /old_locus_tag="GBAA0329"
FT                   /product="aminopeptidase AmpS"
FT                   /EC_number="3.4.11.-"
FT                   /note="identified by match to protein family HMM PF02073"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29420"
FT                   /db_xref="GOA:Q81ZE0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZE0"
FT                   /protein_id="AAT29420.1"
FT                   PIFRKGNWAF"
FT   gene            complement(338279..339361)
FT                   /locus_tag="GBAA_0330"
FT                   /old_locus_tag="GBAA0330"
FT   CDS_pept        complement(338279..339361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0330"
FT                   /old_locus_tag="GBAA0330"
FT                   /product="polysaccharide deacetylase-like protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29421"
FT                   /db_xref="GOA:A0A0F7RI55"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="PDB:4V33"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI55"
FT                   /protein_id="AAT29421.1"
FT   gene            complement(339513..340616)
FT                   /locus_tag="GBAA_0331"
FT                   /old_locus_tag="GBAA0331"
FT   CDS_pept        complement(339513..340616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0331"
FT                   /old_locus_tag="GBAA0331"
FT                   /product="polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29422"
FT                   /db_xref="GOA:A0A0F7RJX5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="PDB:6GO1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJX5"
FT                   /protein_id="AAT29422.1"
FT   gene            complement(340856..342052)
FT                   /locus_tag="GBAA_0332"
FT                   /old_locus_tag="GBAA0332"
FT   CDS_pept        complement(340856..342052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0332"
FT                   /old_locus_tag="GBAA0332"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29423"
FT                   /db_xref="GOA:A0A1J9V2G9"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V2G9"
FT                   /protein_id="AAT29423.1"
FT   gene            342478..343854
FT                   /locus_tag="GBAA_0333"
FT                   /old_locus_tag="GBAA0333"
FT   CDS_pept        342478..343854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0333"
FT                   /old_locus_tag="GBAA0333"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF02475; match to protein
FT                   family HMM PF05958; match to protein family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29424"
FT                   /db_xref="GOA:Q81ZD6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZD6"
FT                   /protein_id="AAT29424.1"
FT                   "
FT   gene            343951..344940
FT                   /locus_tag="GBAA_0334"
FT                   /old_locus_tag="GBAA0334"
FT   CDS_pept        343951..344940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0334"
FT                   /old_locus_tag="GBAA0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29425"
FT                   /db_xref="GOA:Q81ZD5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZD5"
FT                   /protein_id="AAT29425.1"
FT   gene            345216..345770
FT                   /locus_tag="GBAA_0335"
FT                   /old_locus_tag="GBAA0335"
FT   CDS_pept        345216..345770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0335"
FT                   /old_locus_tag="GBAA0335"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29426"
FT                   /db_xref="GOA:Q81ZD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZD4"
FT                   /protein_id="AAT29426.2"
FT   gene            346049..346561
FT                   /locus_tag="GBAA_0336"
FT                   /old_locus_tag="GBAA0336"
FT   CDS_pept        346049..346561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0336"
FT                   /old_locus_tag="GBAA0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07308"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29427"
FT                   /db_xref="GOA:Q81ZD3"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZD3"
FT                   /protein_id="AAT29427.2"
FT                   LAVKYRG"
FT   gene            346656..347363
FT                   /locus_tag="GBAA_0337"
FT                   /old_locus_tag="GBAA0337"
FT   CDS_pept        346656..347363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0337"
FT                   /old_locus_tag="GBAA0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29428"
FT                   /db_xref="GOA:A0A0F7RMY7"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMY7"
FT                   /protein_id="AAT29428.1"
FT                   ENWLALSSWKMTV"
FT   gene            complement(347563..348258)
FT                   /locus_tag="GBAA_0338"
FT                   /old_locus_tag="GBAA0338"
FT   CDS_pept        complement(347563..348258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0338"
FT                   /old_locus_tag="GBAA0338"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29429"
FT                   /db_xref="GOA:A0A0F7RMQ3"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMQ3"
FT                   /protein_id="AAT29429.1"
FT                   EDFVVKFGR"
FT   gene            complement(348273..349382)
FT                   /locus_tag="GBAA_0339"
FT                   /old_locus_tag="GBAA0339"
FT   CDS_pept        complement(348273..349382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0339"
FT                   /old_locus_tag="GBAA0339"
FT                   /product="mandelate racemase/muconate lactonizing enzyme
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01188;
FT                   match to protein family HMM PF02746"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29430"
FT                   /db_xref="GOA:A0A0F7RNS0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNS0"
FT                   /protein_id="AAT29430.1"
FT   gene            349475..350746
FT                   /locus_tag="GBAA_0340"
FT                   /old_locus_tag="GBAA0340"
FT   CDS_pept        349475..350746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0340"
FT                   /old_locus_tag="GBAA0340"
FT                   /product="transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29431"
FT                   /db_xref="GOA:A0A0F7RI49"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI49"
FT                   /protein_id="AAT29431.1"
FT   gene            complement(350735..352156)
FT                   /gene="nhaC1"
FT                   /locus_tag="GBAA_0341"
FT                   /old_locus_tag="GBAA0341"
FT   CDS_pept        complement(350735..352156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="GBAA_0341"
FT                   /old_locus_tag="GBAA0341"
FT                   /product="Na+/H+ antiporter NhaC"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00931"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29432"
FT                   /db_xref="GOA:A0A0F7RMY4"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMY4"
FT                   /protein_id="AAT29432.1"
FT                   EKAELLKKQNAQLEA"
FT   gene            352436..353551
FT                   /gene="amhX"
FT                   /locus_tag="GBAA_0342"
FT                   /old_locus_tag="GBAA0342"
FT   CDS_pept        352436..353551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="GBAA_0342"
FT                   /old_locus_tag="GBAA0342"
FT                   /product="amidohydrolase amhX"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29433"
FT                   /db_xref="GOA:Q81ZC7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR037484"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZC7"
FT                   /protein_id="AAT29433.1"
FT   gene            353703..354311
FT                   /locus_tag="GBAA_0343"
FT                   /old_locus_tag="GBAA0343"
FT   CDS_pept        353703..354311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0343"
FT                   /old_locus_tag="GBAA0343"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29434"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNR2"
FT                   /protein_id="AAT29434.1"
FT   gene            complement(354356..355882)
FT                   /gene="ahpF"
FT                   /locus_tag="GBAA_0344"
FT                   /old_locus_tag="GBAA0344"
FT   CDS_pept        complement(354356..355882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="GBAA_0344"
FT                   /old_locus_tag="GBAA0344"
FT                   /product="alkyl hydroperoxide reductase, F subunit"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR03140"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29435"
FT                   /db_xref="GOA:A0A0F7RI47"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI47"
FT                   /protein_id="AAT29435.1"
FT   gene            complement(355897..356460)
FT                   /gene="ahpC"
FT                   /locus_tag="GBAA_0345"
FT                   /old_locus_tag="GBAA0345"
FT   CDS_pept        complement(355897..356460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="GBAA_0345"
FT                   /old_locus_tag="GBAA0345"
FT                   /product="peroxiredoxin"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534; match to protein
FT                   family HMM TIGR03137"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29436"
FT                   /db_xref="GOA:A0A0J1HRG9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRG9"
FT                   /protein_id="AAT29436.1"
FT   gene            357051..358280
FT                   /locus_tag="GBAA_0346"
FT                   /old_locus_tag="GBAA0346"
FT   CDS_pept        357051..358280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0346"
FT                   /old_locus_tag="GBAA0346"
FT                   /product="putative 5-methylthioribose kinase"
FT                   /note="identified by match to protein family HMM TIGR01767"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29437"
FT                   /db_xref="GOA:A0A0F7RMY1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMY1"
FT                   /protein_id="AAT29437.1"
FT                   LKEQSMHYAK"
FT   gene            358293..359336
FT                   /locus_tag="GBAA_0347"
FT                   /old_locus_tag="GBAA0347"
FT   CDS_pept        358293..359336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0347"
FT                   /old_locus_tag="GBAA0347"
FT                   /product="putative translation initiation factor, aIF-2BI
FT                   family"
FT                   /note="identified by match to protein family HMM PF01008;
FT                   match to protein family HMM TIGR00512; match to protein
FT                   family HMM TIGR00524"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29438"
FT                   /db_xref="GOA:Q81ZC2"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZC2"
FT                   /protein_id="AAT29438.1"
FT                   NLKKLFQ"
FT   gene            359391..360032
FT                   /locus_tag="GBAA_0348"
FT                   /old_locus_tag="GBAA0348"
FT   CDS_pept        359391..360032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0348"
FT                   /old_locus_tag="GBAA0348"
FT                   /product="aldolase, class II"
FT                   /note="identified by match to protein family HMM PF00596"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29439"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZC1"
FT                   /protein_id="AAT29439.1"
FT   gene            complement(360073..361080)
FT                   /locus_tag="GBAA_0349"
FT                   /old_locus_tag="GBAA0349"
FT   CDS_pept        complement(360073..361080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0349"
FT                   /old_locus_tag="GBAA0349"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29440"
FT                   /db_xref="GOA:A0A1Q4LX66"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LX66"
FT                   /protein_id="AAT29440.1"
FT   gene            complement(361077..362093)
FT                   /locus_tag="GBAA_0350"
FT                   /old_locus_tag="GBAA0350"
FT   CDS_pept        complement(361077..362093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0350"
FT                   /old_locus_tag="GBAA0350"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29441"
FT                   /db_xref="GOA:Q81ZB9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZB9"
FT                   /protein_id="AAT29441.1"
FT   gene            complement(362166..363083)
FT                   /locus_tag="GBAA_0351"
FT                   /old_locus_tag="GBAA0351"
FT   CDS_pept        complement(362166..363083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0351"
FT                   /old_locus_tag="GBAA0351"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29442"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LX69"
FT                   /protein_id="AAT29442.1"
FT   gene            363416..364465
FT                   /locus_tag="GBAA_0352"
FT                   /old_locus_tag="GBAA0352"
FT   CDS_pept        363416..364465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0352"
FT                   /old_locus_tag="GBAA0352"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01134; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29443"
FT                   /db_xref="GOA:Q81ZB7"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81ZB7"
FT                   /protein_id="AAT29443.1"
FT                   RELIKQMMK"
FT   gene            complement(364662..365030)
FT                   /locus_tag="GBAA_0353"
FT                   /old_locus_tag="GBAA0353"
FT   CDS_pept        complement(364662..365030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0353"
FT                   /old_locus_tag="GBAA0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29444"
FT                   /db_xref="GOA:A0A0F7RNR0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNR0"
FT                   /protein_id="AAT29444.1"
FT                   IASILNMPFPKKRAKGTA"
FT   gene            365212..365451
FT                   /locus_tag="GBAA_0354"
FT                   /old_locus_tag="GBAA0354"
FT   CDS_pept        365212..365451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0354"
FT                   /old_locus_tag="GBAA0354"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="identified by match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29445"
FT                   /db_xref="GOA:A0A1V4B8C1"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B8C1"
FT                   /protein_id="AAT29445.1"
FT   gene            365687..366678
FT                   /pseudo
FT                   /locus_tag="GBAA_0355"
FT                   /old_locus_tag="GBAA0355"
FT                   /note="putative spore coat protein B, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to SP:P07789"
FT   gene            366741..366848
FT                   /locus_tag="GBAA_0356"
FT                   /old_locus_tag="GBAA0356"
FT   CDS_pept        366741..366848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0356"
FT                   /old_locus_tag="GBAA0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29449"
FT                   /db_xref="GOA:A0A1T3V334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V334"
FT                   /protein_id="AAT29449.1"
FT   gene            366841..367509
FT                   /locus_tag="GBAA_0357"
FT                   /old_locus_tag="GBAA0357"
FT   CDS_pept        366841..367509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0357"
FT                   /old_locus_tag="GBAA0357"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29450"
FT                   /db_xref="GOA:A0A0F7RNQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNQ9"
FT                   /protein_id="AAT29450.1"
FT                   "
FT   gene            367746..369011
FT                   /locus_tag="GBAA_0358"
FT                   /old_locus_tag="GBAA0358"
FT   CDS_pept        367746..369011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0358"
FT                   /old_locus_tag="GBAA0358"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29451"
FT                   /db_xref="GOA:Q81ZB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZB2"
FT                   /protein_id="AAT29451.1"
FT   gene            369284..369665
FT                   /pseudo
FT                   /locus_tag="GBAA_0359"
FT                   /old_locus_tag="GBAA0359"
FT                   /note="sensor histidine kinase domain protein, degenerate;
FT                   this region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to SP:P39764"
FT   gene            369889..370269
FT                   /locus_tag="GBAA_0360"
FT                   /old_locus_tag="GBAA0360"
FT   CDS_pept        369889..370269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0360"
FT                   /old_locus_tag="GBAA0360"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29454"
FT                   /db_xref="GOA:A0A1T3V327"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V327"
FT                   /protein_id="AAT29454.2"
FT   gene            complement(370298..370930)
FT                   /locus_tag="GBAA_0361"
FT                   /old_locus_tag="GBAA0361"
FT   CDS_pept        complement(370298..370930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0361"
FT                   /old_locus_tag="GBAA0361"
FT                   /product="putative cyclase"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29455"
FT                   /db_xref="GOA:Q81ZB0"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZB0"
FT                   /protein_id="AAT29455.1"
FT   gene            371279..372388
FT                   /locus_tag="GBAA_0362"
FT                   /old_locus_tag="GBAA0362"
FT   CDS_pept        371279..372388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0362"
FT                   /old_locus_tag="GBAA0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29456"
FT                   /db_xref="GOA:Q81ZA9"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZA9"
FT                   /protein_id="AAT29456.1"
FT   gene            372511..373293
FT                   /locus_tag="GBAA_0363"
FT                   /old_locus_tag="GBAA0363"
FT   CDS_pept        372511..373293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0363"
FT                   /old_locus_tag="GBAA0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29457"
FT                   /db_xref="GOA:A0A0F7RMW8"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMW8"
FT                   /protein_id="AAT29457.1"
FT   gene            complement(373308..374609)
FT                   /locus_tag="GBAA_0364"
FT                   /old_locus_tag="GBAA0364"
FT   CDS_pept        complement(373308..374609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0364"
FT                   /old_locus_tag="GBAA0364"
FT                   /product="putative benzoate transport protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29458"
FT                   /db_xref="GOA:Q81ZA7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZA7"
FT                   /protein_id="AAT29458.1"
FT   gene            complement(374753..376279)
FT                   /locus_tag="GBAA_0365"
FT                   /old_locus_tag="GBAA0365"
FT   CDS_pept        complement(374753..376279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0365"
FT                   /old_locus_tag="GBAA0365"
FT                   /product="putative Rieske 2Fe-2S iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF00355;
FT                   match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29459"
FT                   /db_xref="GOA:Q81ZA6"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="InterPro:IPR038010"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZA6"
FT                   /protein_id="AAT29459.1"
FT   gene            376862..377947
FT                   /locus_tag="GBAA_0366"
FT                   /old_locus_tag="GBAA0366"
FT   CDS_pept        376862..377947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0366"
FT                   /old_locus_tag="GBAA0366"
FT                   /product="fatty acid desaturase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29460"
FT                   /db_xref="GOA:A0A1J9V2J3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V2J3"
FT                   /protein_id="AAT29460.1"
FT   gene            complement(378000..378809)
FT                   /locus_tag="GBAA_5743"
FT   CDS_pept        complement(378000..378809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_5743"
FT                   /product="putative amino acid ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ACN55047"
FT                   /db_xref="GOA:B9ZSE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9ZSE3"
FT                   /protein_id="ACN55047.1"
FT   gene            complement(378787..379581)
FT                   /locus_tag="GBAA_0367"
FT                   /old_locus_tag="GBAA0367"
FT   CDS_pept        complement(378787..379581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0367"
FT                   /old_locus_tag="GBAA0367"
FT                   /product="putative amino acid ABC transporter, amino
FT                   acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACN55065"
FT                   /db_xref="GOA:Q6I447"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q6I447"
FT                   /protein_id="ACN55065.1"
FT   gene            complement(379703..380425)
FT                   /locus_tag="GBAA_0368"
FT                   /old_locus_tag="GBAA0368"
FT   CDS_pept        complement(379703..380425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0368"
FT                   /old_locus_tag="GBAA0368"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29463"
FT                   /db_xref="GOA:A0A0F7RNQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNQ6"
FT                   /protein_id="AAT29463.1"
FT                   FFSTPSHERAKQFLRNVL"
FT   gene            complement(380595..382319)
FT                   /locus_tag="GBAA_0369"
FT                   /old_locus_tag="GBAA0369"
FT   CDS_pept        complement(380595..382319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0369"
FT                   /old_locus_tag="GBAA0369"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29464"
FT                   /db_xref="GOA:A0A0F7RI33"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI33"
FT                   /protein_id="AAT29464.1"
FT   gene            382527..383819
FT                   /locus_tag="GBAA_0370"
FT                   /old_locus_tag="GBAA0370"
FT   CDS_pept        382527..383819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0370"
FT                   /old_locus_tag="GBAA0370"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29465"
FT                   /db_xref="GOA:Q81ZA2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:Q81ZA2"
FT                   /protein_id="AAT29465.1"
FT   gene            384056..385720
FT                   /locus_tag="GBAA_0371"
FT                   /old_locus_tag="GBAA0371"
FT   CDS_pept        384056..385720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0371"
FT                   /old_locus_tag="GBAA0371"
FT                   /product="glycosyl hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29466"
FT                   /db_xref="GOA:A0A2B6CBL2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6CBL2"
FT                   /protein_id="AAT29466.1"
FT   gene            385893..387530
FT                   /locus_tag="GBAA_0372"
FT                   /old_locus_tag="GBAA0372"
FT   CDS_pept        385893..387530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0372"
FT                   /old_locus_tag="GBAA0372"
FT                   /product="PTS system, IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR02003"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29467"
FT                   /db_xref="GOA:A0A0F7RMJ5"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMJ5"
FT                   /protein_id="AAT29467.1"
FT   gene            387535..388326
FT                   /locus_tag="GBAA_0373"
FT                   /old_locus_tag="GBAA0373"
FT   CDS_pept        387535..388326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0373"
FT                   /old_locus_tag="GBAA0373"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29468"
FT                   /db_xref="GOA:Q81Z99"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z99"
FT                   /protein_id="AAT29468.1"
FT   gene            388632..391457
FT                   /locus_tag="GBAA_0374"
FT                   /old_locus_tag="GBAA0374"
FT   CDS_pept        388632..391457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0374"
FT                   /old_locus_tag="GBAA0374"
FT                   /product="conserved domain protein"
FT                   /note="identified by match to protein family HMM TIGR03061;
FT                   match to protein family HMM TIGR03062"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29469"
FT                   /db_xref="GOA:Q81Z98"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z98"
FT                   /protein_id="AAT29469.1"
FT                   VENAKGSKIIH"
FT   gene            complement(391498..393687)
FT                   /gene="topB1"
FT                   /locus_tag="GBAA_0375"
FT                   /old_locus_tag="GBAA0375"
FT   CDS_pept        complement(391498..393687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="GBAA_0375"
FT                   /old_locus_tag="GBAA0375"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01056"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29470"
FT                   /db_xref="GOA:Q81Z97"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z97"
FT                   /protein_id="AAT29470.1"
FT   gene            394096..394902
FT                   /gene="thiM"
FT                   /locus_tag="GBAA_0376"
FT                   /old_locus_tag="GBAA0376"
FT   CDS_pept        394096..394902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="GBAA_0376"
FT                   /old_locus_tag="GBAA0376"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02110;
FT                   match to protein family HMM TIGR00694"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29471"
FT                   /db_xref="GOA:Q81Z96"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z96"
FT                   /protein_id="AAT29471.1"
FT   gene            394919..395578
FT                   /gene="thiE"
FT                   /locus_tag="GBAA_0377"
FT                   /old_locus_tag="GBAA0377"
FT   CDS_pept        394919..395578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="GBAA_0377"
FT                   /old_locus_tag="GBAA0377"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29472"
FT                   /db_xref="GOA:Q81Z95"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z95"
FT                   /protein_id="AAT29472.1"
FT   gene            complement(395694..397007)
FT                   /locus_tag="GBAA_0378"
FT                   /old_locus_tag="GBAA0378"
FT   CDS_pept        complement(395694..397007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0378"
FT                   /old_locus_tag="GBAA0378"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter"
FT                   /note="identified by match to protein family HMM PF03605;
FT                   match to protein family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29473"
FT                   /db_xref="GOA:A0A1J9VBQ0"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VBQ0"
FT                   /protein_id="AAT29473.2"
FT   gene            397518..399257
FT                   /locus_tag="GBAA_0379"
FT                   /old_locus_tag="GBAA0379"
FT   CDS_pept        397518..399257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0379"
FT                   /old_locus_tag="GBAA0379"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29474"
FT                   /db_xref="GOA:Q81Z93"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z93"
FT                   /protein_id="AAT29474.1"
FT                   FKS"
FT   gene            399521..399841
FT                   /locus_tag="GBAA_0380"
FT                   /old_locus_tag="GBAA0380"
FT   CDS_pept        399521..399841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0380"
FT                   /old_locus_tag="GBAA0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29475"
FT                   /db_xref="GOA:A0A1J9WAQ1"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WAQ1"
FT                   /protein_id="AAT29475.1"
FT                   AI"
FT   gene            399813..400586
FT                   /locus_tag="GBAA_0381"
FT                   /old_locus_tag="GBAA0381"
FT   CDS_pept        399813..400586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0381"
FT                   /old_locus_tag="GBAA0381"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29476"
FT                   /db_xref="GOA:Q81Z91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z91"
FT                   /protein_id="AAT29476.1"
FT   gene            400583..401581
FT                   /locus_tag="GBAA_0382"
FT                   /old_locus_tag="GBAA0382"
FT   CDS_pept        400583..401581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0382"
FT                   /old_locus_tag="GBAA0382"
FT                   /product="putative ABC transporter, substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29477"
FT                   /db_xref="GOA:A0A0J1HRC5"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HRC5"
FT                   /protein_id="AAT29477.1"
FT   gene            401578..402327
FT                   /locus_tag="GBAA_0383"
FT                   /old_locus_tag="GBAA0383"
FT   CDS_pept        401578..402327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0383"
FT                   /old_locus_tag="GBAA0383"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29478"
FT                   /db_xref="GOA:A0A0F7RNP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNP9"
FT                   /protein_id="AAT29478.1"
FT   gene            402619..404163
FT                   /locus_tag="GBAA_0384"
FT                   /old_locus_tag="GBAA0384"
FT   CDS_pept        402619..404163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0384"
FT                   /old_locus_tag="GBAA0384"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29479"
FT                   /db_xref="GOA:A0A0F7RI18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI18"
FT                   /protein_id="AAT29479.1"
FT   gene            complement(404624..406648)
FT                   /locus_tag="GBAA_0385"
FT                   /old_locus_tag="GBAA0385"
FT   CDS_pept        complement(404624..406648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0385"
FT                   /old_locus_tag="GBAA0385"
FT                   /product="chitinase B"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00553; match to protein
FT                   family HMM PF00704"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29480"
FT                   /db_xref="GOA:Q81Z87"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z87"
FT                   /protein_id="AAT29480.1"
FT   gene            407020..407391
FT                   /locus_tag="GBAA_0386"
FT                   /old_locus_tag="GBAA0386"
FT   CDS_pept        407020..407391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0386"
FT                   /old_locus_tag="GBAA0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29481"
FT                   /db_xref="GOA:Q81Z86"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z86"
FT                   /protein_id="AAT29481.1"
FT   gene            407402..407716
FT                   /locus_tag="GBAA_0387"
FT                   /old_locus_tag="GBAA0387"
FT   CDS_pept        407402..407716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0387"
FT                   /old_locus_tag="GBAA0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29482"
FT                   /db_xref="GOA:A0A0F7RMJ0"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMJ0"
FT                   /protein_id="AAT29482.1"
FT                   "
FT   gene            407730..407981
FT                   /locus_tag="GBAA_0388"
FT                   /old_locus_tag="GBAA0388"
FT   CDS_pept        407730..407981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0388"
FT                   /old_locus_tag="GBAA0388"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29483"
FT                   /db_xref="GOA:A0A1Q4LXE4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LXE4"
FT                   /protein_id="AAT29483.1"
FT   gene            408264..408845
FT                   /locus_tag="GBAA_0389"
FT                   /old_locus_tag="GBAA0389"
FT   CDS_pept        408264..408845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0389"
FT                   /old_locus_tag="GBAA0389"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440;
FT                   match to protein family HMM PF08360"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29484"
FT                   /db_xref="GOA:A0A1J9V2M6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013571"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V2M6"
FT                   /protein_id="AAT29484.1"
FT   gene            408912..410144
FT                   /locus_tag="GBAA_0390"
FT                   /old_locus_tag="GBAA0390"
FT   CDS_pept        408912..410144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0390"
FT                   /old_locus_tag="GBAA0390"
FT                   /product="major facilitator family transporter"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29485"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJS1"
FT                   /protein_id="AAT29485.1"
FT                   KEELTNSLASK"
FT   gene            410258..410452
FT                   /locus_tag="GBAA_0391"
FT                   /old_locus_tag="GBAA0391"
FT   CDS_pept        410258..410452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0391"
FT                   /old_locus_tag="GBAA0391"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29486"
FT                   /db_xref="GOA:Q81Z81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z81"
FT                   /protein_id="AAT29486.2"
FT   gene            410465..410857
FT                   /locus_tag="GBAA_0392"
FT                   /old_locus_tag="GBAA0392"
FT   CDS_pept        410465..410857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0392"
FT                   /old_locus_tag="GBAA0392"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAT70116"
FT                   /db_xref="GOA:Q81Z80"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z80"
FT                   /protein_id="AAT70116.1"
FT   gene            complement(410884..412167)
FT                   /locus_tag="GBAA_0393"
FT                   /old_locus_tag="GBAA0393"
FT   CDS_pept        complement(410884..412167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0393"
FT                   /old_locus_tag="GBAA0393"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29488"
FT                   /db_xref="GOA:A0A1J9WCW0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WCW0"
FT                   /protein_id="AAT29488.1"
FT   gene            complement(412276..413589)
FT                   /locus_tag="GBAA_0394"
FT                   /old_locus_tag="GBAA0394"
FT   CDS_pept        complement(412276..413589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0394"
FT                   /old_locus_tag="GBAA0394"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01663"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29489"
FT                   /db_xref="GOA:A0A0F7RI12"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RI12"
FT                   /protein_id="AAT29489.1"
FT   gene            413725..414036
FT                   /locus_tag="GBAA_0395"
FT                   /old_locus_tag="GBAA0395"
FT   CDS_pept        413725..414036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0395"
FT                   /old_locus_tag="GBAA0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29490"
FT                   /db_xref="GOA:A0A1T3V2Z0"
FT                   /db_xref="InterPro:IPR025434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V2Z0"
FT                   /protein_id="AAT29490.2"
FT   gene            414384..415910
FT                   /gene="proS1"
FT                   /locus_tag="GBAA_0396"
FT                   /old_locus_tag="GBAA0396"
FT   CDS_pept        414384..415910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS1"
FT                   /locus_tag="GBAA_0396"
FT                   /old_locus_tag="GBAA0396"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29491"
FT                   /db_xref="GOA:Q81Z76"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z76"
FT                   /protein_id="AAT29491.1"
FT   gene            complement(415915..416688)
FT                   /locus_tag="GBAA_0397"
FT                   /old_locus_tag="GBAA0397"
FT   CDS_pept        complement(415915..416688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0397"
FT                   /old_locus_tag="GBAA0397"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="identified by match to protein family HMM PF00746;
FT                   match to protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29492"
FT                   /db_xref="GOA:Q81Z75"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z75"
FT                   /protein_id="AAT29492.1"
FT   gene            416891..417769
FT                   /locus_tag="GBAA_0398"
FT                   /old_locus_tag="GBAA0398"
FT   CDS_pept        416891..417769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0398"
FT                   /old_locus_tag="GBAA0398"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29493"
FT                   /db_xref="GOA:A0A0F7RNP1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNP1"
FT                   /protein_id="AAT29493.1"
FT                   GAIYHFLHHHK"
FT   gene            417898..418494
FT                   /locus_tag="GBAA_0399"
FT                   /old_locus_tag="GBAA0399"
FT   CDS_pept        417898..418494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0399"
FT                   /old_locus_tag="GBAA0399"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29494"
FT                   /db_xref="GOA:A0A1Q4LX21"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LX21"
FT                   /protein_id="AAT29494.1"
FT   gene            418518..419102
FT                   /locus_tag="GBAA_0400"
FT                   /old_locus_tag="GBAA0400"
FT   CDS_pept        418518..419102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0400"
FT                   /old_locus_tag="GBAA0400"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29495"
FT                   /db_xref="GOA:Q81Z72"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z72"
FT                   /protein_id="AAT29495.1"
FT   gene            419183..419767
FT                   /locus_tag="GBAA_0401"
FT                   /old_locus_tag="GBAA0401"
FT   CDS_pept        419183..419767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0401"
FT                   /old_locus_tag="GBAA0401"
FT                   /product="tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF02342"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29496"
FT                   /db_xref="GOA:A0A0F7RMU6"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMU6"
FT                   /protein_id="AAT29496.1"
FT   gene            419841..420632
FT                   /locus_tag="GBAA_0402"
FT                   /old_locus_tag="GBAA0402"
FT   CDS_pept        419841..420632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0402"
FT                   /old_locus_tag="GBAA0402"
FT                   /product="putative tellurium resistance protein"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29497"
FT                   /db_xref="GOA:A0A1Q4LWZ6"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWZ6"
FT                   /protein_id="AAT29497.1"
FT   gene            420742..422373
FT                   /locus_tag="GBAA_0403"
FT                   /old_locus_tag="GBAA0403"
FT   CDS_pept        420742..422373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0403"
FT                   /old_locus_tag="GBAA0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29498"
FT                   /db_xref="GOA:A0A0F7RNN8"
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNN8"
FT                   /protein_id="AAT29498.1"
FT   gene            422392..423474
FT                   /locus_tag="GBAA_0404"
FT                   /old_locus_tag="GBAA0404"
FT   CDS_pept        422392..423474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0404"
FT                   /old_locus_tag="GBAA0404"
FT                   /product="putative tellurite resistance protein"
FT                   /note="identified by match to protein family HMM PF05816"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29499"
FT                   /db_xref="GOA:A0A0J1KEV8"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1KEV8"
FT                   /protein_id="AAT29499.1"
FT   gene            complement(423510..426176)
FT                   /locus_tag="GBAA_0405"
FT                   /old_locus_tag="GBAA0405"
FT   CDS_pept        complement(423510..426176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0405"
FT                   /old_locus_tag="GBAA0405"
FT                   /product="cation-transporting ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29500"
FT                   /db_xref="GOA:Q81Z67"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z67"
FT                   /protein_id="AAT29500.1"
FT                   SIIPLVVNEFIKLVKRN"
FT   gene            complement(426368..426592)
FT                   /locus_tag="GBAA_0406"
FT                   /old_locus_tag="GBAA0406"
FT   CDS_pept        complement(426368..426592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0406"
FT                   /old_locus_tag="GBAA0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06569"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29501"
FT                   /db_xref="GOA:Q81Z66"
FT                   /db_xref="InterPro:IPR009507"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z66"
FT                   /protein_id="AAT29501.1"
FT   gene            426767..427231
FT                   /locus_tag="GBAA_0407"
FT                   /old_locus_tag="GBAA0407"
FT   CDS_pept        426767..427231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0407"
FT                   /old_locus_tag="GBAA0407"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29502"
FT                   /db_xref="GOA:A0A1S0QKK1"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QKK1"
FT                   /protein_id="AAT29502.1"
FT   gene            427285..427767
FT                   /locus_tag="GBAA_0408"
FT                   /old_locus_tag="GBAA0408"
FT   CDS_pept        427285..427767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0408"
FT                   /old_locus_tag="GBAA0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29503"
FT                   /db_xref="GOA:Q81Z64"
FT                   /db_xref="InterPro:IPR025276"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z64"
FT                   /protein_id="AAT29503.2"
FT   gene            427806..428675
FT                   /gene="yihY"
FT                   /locus_tag="GBAA_0409"
FT                   /old_locus_tag="GBAA0409"
FT   CDS_pept        427806..428675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yihY"
FT                   /locus_tag="GBAA_0409"
FT                   /old_locus_tag="GBAA0409"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631;
FT                   match to protein family HMM TIGR00765"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29504"
FT                   /db_xref="GOA:A0A1T3V2V9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V2V9"
FT                   /protein_id="AAT29504.1"
FT                   DNNSRNEK"
FT   gene            complement(428860..430785)
FT                   /locus_tag="GBAA_0410"
FT                   /old_locus_tag="GBAA0410"
FT   CDS_pept        complement(428860..430785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0410"
FT                   /old_locus_tag="GBAA0410"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01512; match to protein family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29507"
FT                   /db_xref="GOA:Q81Z62"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z62"
FT                   /protein_id="AAT29507.1"
FT                   LLKGNN"
FT   gene            431056..432006
FT                   /locus_tag="GBAA_0411"
FT                   /old_locus_tag="GBAA0411"
FT   CDS_pept        431056..432006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0411"
FT                   /old_locus_tag="GBAA0411"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29508"
FT                   /db_xref="GOA:A0A0F7RMU0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMU0"
FT                   /protein_id="AAT29508.1"
FT   gene            432129..432809
FT                   /locus_tag="GBAA_0412"
FT                   /old_locus_tag="GBAA0412"
FT   CDS_pept        432129..432809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0412"
FT                   /old_locus_tag="GBAA0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07947"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29510"
FT                   /db_xref="GOA:A0A0F7RMH1"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMH1"
FT                   /protein_id="AAT29510.1"
FT                   YVGL"
FT   gene            433039..433574
FT                   /pseudo
FT                   /gene="sipS1"
FT                   /locus_tag="GBAA_0413"
FT                   /old_locus_tag="GBAA0413"
FT                   /note="signal peptidase I S, authentic frameshift; this
FT                   gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00717; match to protein family HMM TIGR02227"
FT   gene            complement(433618..436380)
FT                   /locus_tag="GBAA_0414"
FT                   /old_locus_tag="GBAA0414"
FT   CDS_pept        complement(433618..436380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0414"
FT                   /old_locus_tag="GBAA0414"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29513"
FT                   /db_xref="GOA:A0A0F7RJQ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJQ3"
FT                   /protein_id="AAT29513.1"
FT   gene            436855..437445
FT                   /locus_tag="GBAA_0415"
FT                   /old_locus_tag="GBAA0415"
FT   CDS_pept        436855..437445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0415"
FT                   /old_locus_tag="GBAA0415"
FT                   /product="dedA family protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29514"
FT                   /db_xref="GOA:A0A0F7RMT8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT8"
FT                   /protein_id="AAT29514.1"
FT   gene            complement(437454..437882)
FT                   /locus_tag="GBAA_0416"
FT                   /old_locus_tag="GBAA0416"
FT   CDS_pept        complement(437454..437882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0416"
FT                   /old_locus_tag="GBAA0416"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29515"
FT                   /db_xref="GOA:A0A0J1HMR2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HMR2"
FT                   /protein_id="AAT29515.1"
FT   gene            complement(437989..438138)
FT                   /locus_tag="GBAA_0417"
FT                   /old_locus_tag="GBAA0417"
FT   CDS_pept        complement(437989..438138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0417"
FT                   /old_locus_tag="GBAA0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29517"
FT                   /db_xref="GOA:A0A1T3V2X8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1T3V2X8"
FT                   /protein_id="AAT29517.2"
FT                   EIAE"
FT   gene            complement(438289..438705)
FT                   /locus_tag="GBAA_0418"
FT                   /old_locus_tag="GBAA0418"
FT   CDS_pept        complement(438289..438705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0418"
FT                   /old_locus_tag="GBAA0418"
FT                   /product="general stress protein 26"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29518"
FT                   /db_xref="GOA:A0A0F7RHX8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="PDB:3EC6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHX8"
FT                   /protein_id="AAT29518.1"
FT   gene            438876..439940
FT                   /gene="cax"
FT                   /locus_tag="GBAA_0419"
FT                   /old_locus_tag="GBAA0419"
FT   CDS_pept        438876..439940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="GBAA_0419"
FT                   /old_locus_tag="GBAA0419"
FT                   /product="calcium/proton exchanger"
FT                   /note="identified by match to protein family HMM PF01699;
FT                   match to protein family HMM TIGR00378; match to protein
FT                   family HMM TIGR00846"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29519"
FT                   /db_xref="GOA:A0A0F7RJP9"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJP9"
FT                   /protein_id="AAT29519.1"
FT                   LAAYVIMGIGFYLL"
FT   gene            440022..440819
FT                   /locus_tag="GBAA_0420"
FT                   /old_locus_tag="GBAA0420"
FT   CDS_pept        440022..440819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0420"
FT                   /old_locus_tag="GBAA0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29520"
FT                   /db_xref="GOA:A0A0F7RMT6"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT6"
FT                   /protein_id="AAT29520.2"
FT   gene            complement(440854..441981)
FT                   /locus_tag="GBAA_0421"
FT                   /old_locus_tag="GBAA0421"
FT   CDS_pept        complement(440854..441981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0421"
FT                   /old_locus_tag="GBAA0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF08756"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29521"
FT                   /db_xref="GOA:A0A0F7RMG3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMG3"
FT                   /protein_id="AAT29521.1"
FT   gene            442195..442377
FT                   /locus_tag="GBAA_0422"
FT                   /old_locus_tag="GBAA0422"
FT   CDS_pept        442195..442377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0422"
FT                   /old_locus_tag="GBAA0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29522"
FT                   /db_xref="GOA:A0A1J9WLD4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WLD4"
FT                   /protein_id="AAT29522.1"
FT                   LDELELKCEQFKKDE"
FT   gene            442584..444104
FT                   /gene="fumA"
FT                   /locus_tag="GBAA_0423"
FT                   /old_locus_tag="GBAA0423"
FT   CDS_pept        442584..444104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="GBAA_0423"
FT                   /old_locus_tag="GBAA0423"
FT                   /product="fumarate hydratase, class I"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF05681;
FT                   match to protein family HMM PF05683; match to protein
FT                   family HMM TIGR00722; match to protein family HMM
FT                   TIGR00723"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29523"
FT                   /db_xref="GOA:Q81Z50"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z50"
FT                   /protein_id="AAT29523.1"
FT   gene            444231..445013
FT                   /locus_tag="GBAA_0424"
FT                   /old_locus_tag="GBAA0424"
FT   CDS_pept        444231..445013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0424"
FT                   /old_locus_tag="GBAA0424"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522;
FT                   match to protein family HMM TIGR02884"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29524"
FT                   /db_xref="GOA:Q81Z49"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="PDB:2J13"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z49"
FT                   /protein_id="AAT29524.1"
FT   gene            445061..445936
FT                   /pseudo
FT                   /locus_tag="GBAA_0425"
FT                   /old_locus_tag="GBAA0425"
FT                   /note="endonuclease III domain protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF00730"
FT   gene            445947..447326
FT                   /locus_tag="GBAA_0426"
FT                   /old_locus_tag="GBAA0426"
FT   CDS_pept        445947..447326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0426"
FT                   /old_locus_tag="GBAA0426"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29527"
FT                   /db_xref="GOA:Q81Z48"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81Z48"
FT                   /protein_id="AAT29527.1"
FT                   K"
FT   gene            complement(447387..448511)
FT                   /locus_tag="GBAA_0427"
FT                   /old_locus_tag="GBAA0427"
FT   CDS_pept        complement(447387..448511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0427"
FT                   /old_locus_tag="GBAA0427"
FT                   /product="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29528"
FT                   /db_xref="GOA:A0A0F7RHX2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHX2"
FT                   /protein_id="AAT29528.1"
FT   gene            complement(449227..449571)
FT                   /locus_tag="GBAA_0428"
FT                   /old_locus_tag="GBAA0428"
FT   CDS_pept        complement(449227..449571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0428"
FT                   /old_locus_tag="GBAA0428"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35262"
FT                   /db_xref="GOA:Q81Z46"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z46"
FT                   /protein_id="AAT35262.1"
FT                   NMLEDNQDIF"
FT   gene            450106..451281
FT                   /locus_tag="GBAA_0429"
FT                   /old_locus_tag="GBAA0429"
FT   CDS_pept        450106..451281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0429"
FT                   /old_locus_tag="GBAA0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29529"
FT                   /db_xref="GOA:A0A0F7RJP4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJP4"
FT                   /protein_id="AAT29529.1"
FT   gene            451278..451445
FT                   /locus_tag="GBAA_0430"
FT                   /old_locus_tag="GBAA0430"
FT   CDS_pept        451278..451445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0430"
FT                   /old_locus_tag="GBAA0430"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29530"
FT                   /db_xref="GOA:A0A0F7RMT3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT3"
FT                   /protein_id="AAT29530.1"
FT                   RMMTDPGGGW"
FT   gene            451613..451747
FT                   /locus_tag="GBAA_0431"
FT                   /old_locus_tag="GBAA0431"
FT   CDS_pept        451613..451747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0431"
FT                   /old_locus_tag="GBAA0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29531"
FT                   /db_xref="GOA:A0A0F7RMD6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMD6"
FT                   /protein_id="AAT29531.1"
FT   gene            complement(451775..452116)
FT                   /locus_tag="GBAA_0432"
FT                   /old_locus_tag="GBAA0432"
FT   CDS_pept        complement(451775..452116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0432"
FT                   /old_locus_tag="GBAA0432"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29532"
FT                   /db_xref="GOA:A0A0F7RNM6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNM6"
FT                   /protein_id="AAT29532.1"
FT                   YVNFTKNQK"
FT   gene            452291..452512
FT                   /locus_tag="GBAA_0433"
FT                   /old_locus_tag="GBAA0433"
FT   CDS_pept        452291..452512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0433"
FT                   /old_locus_tag="GBAA0433"
FT                   /product="prophage LambdaBa04, DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29533"
FT                   /db_xref="GOA:A0A0F7RHW7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHW7"
FT                   /protein_id="AAT29533.1"
FT   gene            452530..453261
FT                   /locus_tag="GBAA_0434"
FT                   /old_locus_tag="GBAA0434"
FT   CDS_pept        452530..453261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0434"
FT                   /old_locus_tag="GBAA0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02681"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29534"
FT                   /db_xref="GOA:Q81Z40"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="InterPro:IPR018878"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z40"
FT                   /protein_id="AAT29534.1"
FT   gene            453306..453656
FT                   /locus_tag="GBAA_0435"
FT                   /old_locus_tag="GBAA0435"
FT   CDS_pept        453306..453656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0435"
FT                   /old_locus_tag="GBAA0435"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29535"
FT                   /db_xref="GOA:A0A0F7RMT1"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMT1"
FT                   /protein_id="AAT29535.1"
FT                   AFFNWLERGVSA"
FT   gene            453629..453820
FT                   /locus_tag="GBAA_0436"
FT                   /old_locus_tag="GBAA0436"
FT   CDS_pept        453629..453820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0436"
FT                   /old_locus_tag="GBAA0436"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35263"
FT                   /db_xref="GOA:Q81Z38"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z38"
FT                   /protein_id="AAT35263.1"
FT                   EQNKKTHGSGSFKKKQLS"
FT   gene            453850..454035
FT                   /locus_tag="GBAA_0437"
FT                   /old_locus_tag="GBAA0437"
FT   CDS_pept        453850..454035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0437"
FT                   /old_locus_tag="GBAA0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29536"
FT                   /db_xref="GOA:A0A0F7RMD3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMD3"
FT                   /protein_id="AAT29536.1"
FT                   RSGESHIAICERKWLI"
FT   gene            454161..454904
FT                   /locus_tag="GBAA_0438"
FT                   /old_locus_tag="GBAA0438"
FT   CDS_pept        454161..454904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0438"
FT                   /old_locus_tag="GBAA0438"
FT                   /product="putative prophage LambdaBa04, DnaD replication
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04271;
FT                   match to protein family HMM TIGR01446"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29537"
FT                   /db_xref="GOA:Q81Z36"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z36"
FT                   /protein_id="AAT29537.1"
FT   gene            454873..455676
FT                   /locus_tag="GBAA_0439"
FT                   /old_locus_tag="GBAA0439"
FT   CDS_pept        454873..455676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0439"
FT                   /old_locus_tag="GBAA0439"
FT                   /product="putative prophage LambdaBa02, DNA replication
FT                   protein DnaC"
FT                   /note="identified by match to protein family HMM PF01695"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29538"
FT                   /db_xref="GOA:A0A1Q4LWV4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWV4"
FT                   /protein_id="AAT29538.1"
FT   gene            455692..455886
FT                   /locus_tag="GBAA_0440"
FT                   /old_locus_tag="GBAA0440"
FT   CDS_pept        455692..455886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0440"
FT                   /old_locus_tag="GBAA0440"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29539"
FT                   /db_xref="GOA:A0A0F7RJN6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJN6"
FT                   /protein_id="AAT29539.1"
FT   gene            455911..456084
FT                   /locus_tag="GBAA_0441"
FT                   /old_locus_tag="GBAA0441"
FT   CDS_pept        455911..456084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0441"
FT                   /old_locus_tag="GBAA0441"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29540"
FT                   /db_xref="GOA:A0A2A8KMF2"
FT                   /db_xref="InterPro:IPR025017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KMF2"
FT                   /protein_id="AAT29540.1"
FT                   DRVSTTITEKIK"
FT   gene            456099..456353
FT                   /locus_tag="GBAA_5740"
FT   CDS_pept        456099..456353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_5740"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_5740"
FT                   /db_xref="EnsemblGenomes-Tr:ACN55062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6I3X3"
FT                   /protein_id="ACN55062.1"
FT   gene            456365..456781
FT                   /locus_tag="GBAA_0442"
FT                   /old_locus_tag="GBAA0442"
FT   CDS_pept        456365..456781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0442"
FT                   /old_locus_tag="GBAA0442"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29541"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z32"
FT                   /protein_id="AAT29541.1"
FT   gene            456797..457261
FT                   /locus_tag="GBAA_0443"
FT                   /old_locus_tag="GBAA0443"
FT   CDS_pept        456797..457261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0443"
FT                   /old_locus_tag="GBAA0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03819"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29542"
FT                   /db_xref="GOA:Q81Z31"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z31"
FT                   /protein_id="AAT29542.1"
FT   gene            457299..457478
FT                   /locus_tag="GBAA_0444"
FT                   /old_locus_tag="GBAA0444"
FT   CDS_pept        457299..457478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0444"
FT                   /old_locus_tag="GBAA0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29543"
FT                   /db_xref="GOA:A0A0F7RHW1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHW1"
FT                   /protein_id="AAT29543.1"
FT                   EWKYSWDIVKVISE"
FT   gene            457521..457811
FT                   /locus_tag="GBAA_0445"
FT                   /old_locus_tag="GBAA0445"
FT   CDS_pept        457521..457811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0445"
FT                   /old_locus_tag="GBAA0445"
FT                   /product="prophage LambdaBa04, transactivating regulatory
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29544"
FT                   /db_xref="GOA:A0A0F7RJN3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJN3"
FT                   /protein_id="AAT29544.1"
FT   gene            458011..458610
FT                   /locus_tag="GBAA_0446"
FT                   /old_locus_tag="GBAA0446"
FT   CDS_pept        458011..458610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0446"
FT                   /old_locus_tag="GBAA0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29545"
FT                   /db_xref="GOA:A0A0F7RMS8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMS8"
FT                   /protein_id="AAT29545.1"
FT   gene            458648..458818
FT                   /locus_tag="GBAA_0447"
FT                   /old_locus_tag="GBAA0447"
FT   CDS_pept        458648..458818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0447"
FT                   /old_locus_tag="GBAA0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35264"
FT                   /db_xref="GOA:Q81Z27"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z27"
FT                   /protein_id="AAT35264.1"
FT                   ILVSGNATVQK"
FT   gene            458831..459016
FT                   /locus_tag="GBAA_0448"
FT                   /old_locus_tag="GBAA0448"
FT   CDS_pept        458831..459016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0448"
FT                   /old_locus_tag="GBAA0448"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35265"
FT                   /db_xref="GOA:Q81Z26"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z26"
FT                   /protein_id="AAT35265.1"
FT                   YHCKNCDHSTDPGHYM"
FT   gene            459042..459179
FT                   /locus_tag="GBAA_0449"
FT                   /old_locus_tag="GBAA0449"
FT   CDS_pept        459042..459179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0449"
FT                   /old_locus_tag="GBAA0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29546"
FT                   /db_xref="GOA:Q81Z25"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z25"
FT                   /protein_id="AAT29546.1"
FT                   "
FT   gene            459223..459627
FT                   /locus_tag="GBAA_0450"
FT                   /old_locus_tag="GBAA0450"
FT   CDS_pept        459223..459627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0450"
FT                   /old_locus_tag="GBAA0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29547"
FT                   /db_xref="GOA:Q81Z24"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z24"
FT                   /protein_id="AAT29547.1"
FT   gene            460114..460296
FT                   /locus_tag="GBAA_0452"
FT                   /old_locus_tag="GBAA0452"
FT   CDS_pept        460114..460296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0452"
FT                   /old_locus_tag="GBAA0452"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29549"
FT                   /db_xref="GOA:Q81Z23"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z23"
FT                   /protein_id="AAT29549.1"
FT                   LSDFLNSDGLNAEIE"
FT   gene            460328..460702
FT                   /locus_tag="GBAA_0453"
FT                   /old_locus_tag="GBAA0453"
FT   CDS_pept        460328..460702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0453"
FT                   /old_locus_tag="GBAA0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29550"
FT                   /db_xref="GOA:Q81Z22"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z22"
FT                   /protein_id="AAT29550.1"
FT   gene            460808..461164
FT                   /locus_tag="GBAA_0454"
FT                   /old_locus_tag="GBAA0454"
FT   CDS_pept        460808..461164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0454"
FT                   /old_locus_tag="GBAA0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29551"
FT                   /db_xref="GOA:Q81Z21"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z21"
FT                   /protein_id="AAT29551.1"
FT                   IELRKLKEVLFVTK"
FT   gene            461355..461507
FT                   /locus_tag="GBAA_0455"
FT                   /old_locus_tag="GBAA0455"
FT   CDS_pept        461355..461507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0455"
FT                   /old_locus_tag="GBAA0455"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29552"
FT                   /db_xref="GOA:A0A0F7RHV4"
FT                   /db_xref="InterPro:IPR025041"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHV4"
FT                   /protein_id="AAT29552.1"
FT                   NGYLK"
FT   gene            461623..461793
FT                   /locus_tag="GBAA_0456"
FT                   /old_locus_tag="GBAA0456"
FT   CDS_pept        461623..461793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0456"
FT                   /old_locus_tag="GBAA0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29553"
FT                   /db_xref="GOA:A0A0F7RJM5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJM5"
FT                   /protein_id="AAT29553.1"
FT                   YERRRGALRQK"
FT   gene            461821..462303
FT                   /locus_tag="GBAA_0457"
FT                   /old_locus_tag="GBAA0457"
FT   CDS_pept        461821..462303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0457"
FT                   /old_locus_tag="GBAA0457"
FT                   /product="phage transcriptional regulator, ArpU family"
FT                   /note="identified by match to protein family HMM TIGR01637"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29554"
FT                   /db_xref="GOA:A0A0F7RMS4"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMS4"
FT                   /protein_id="AAT29554.1"
FT   gene            462303..462845
FT                   /pseudo
FT                   /locus_tag="GBAA_0458"
FT                   /old_locus_tag="GBAA0458"
FT                   /note="prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family, authentic point mutation; this gene
FT                   contains a premature stop which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00589"
FT   gene            462978..463088
FT                   /locus_tag="GBAA_0459"
FT                   /old_locus_tag="GBAA0459"
FT   CDS_pept        462978..463088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0459"
FT                   /old_locus_tag="GBAA0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35266"
FT                   /db_xref="GOA:A0A0F7RHV1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHV1"
FT                   /protein_id="AAT35266.1"
FT   gene            complement(463157..463255)
FT                   /locus_tag="GBAA_0460"
FT                   /old_locus_tag="GBAA0460"
FT   CDS_pept        complement(463157..463255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0460"
FT                   /old_locus_tag="GBAA0460"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29557"
FT                   /db_xref="GOA:A0A1V4B626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B626"
FT                   /protein_id="AAT29557.1"
FT                   /translation="MLLAQRRAKALLINGNIQSVPSAGFGFYVPSL"
FT   gene            463434..463736
FT                   /locus_tag="GBAA_0461"
FT                   /old_locus_tag="GBAA0461"
FT   CDS_pept        463434..463736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0461"
FT                   /old_locus_tag="GBAA0461"
FT                   /product="prophage LambdaBa04, Gp54"
FT                   /note="identified by match to protein family HMM PF01844"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35267"
FT                   /db_xref="GOA:Q81Z15"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z15"
FT                   /protein_id="AAT35267.1"
FT   gene            463733..463900
FT                   /locus_tag="GBAA_0462"
FT                   /old_locus_tag="GBAA0462"
FT   CDS_pept        463733..463900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0462"
FT                   /old_locus_tag="GBAA0462"
FT                   /product="putative prophage LambdaBa04, DNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29558"
FT                   /db_xref="GOA:Q81Z14"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z14"
FT                   /protein_id="AAT29558.1"
FT                   DRSKLKGVRK"
FT   gene            463897..464043
FT                   /locus_tag="GBAA_0463"
FT                   /old_locus_tag="GBAA0463"
FT   CDS_pept        463897..464043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0463"
FT                   /old_locus_tag="GBAA0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29559"
FT                   /db_xref="GOA:A0A0F7RMS2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMS2"
FT                   /protein_id="AAT29559.1"
FT                   IKK"
FT   gene            464144..464515
FT                   /locus_tag="GBAA_0464"
FT                   /old_locus_tag="GBAA0464"
FT   CDS_pept        464144..464515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0464"
FT                   /old_locus_tag="GBAA0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29560"
FT                   /db_xref="GOA:Q81Z12"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z12"
FT                   /protein_id="AAT29560.1"
FT   gene            464512..466200
FT                   /locus_tag="GBAA_0465"
FT                   /old_locus_tag="GBAA0465"
FT   CDS_pept        464512..466200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0465"
FT                   /old_locus_tag="GBAA0465"
FT                   /product="putative prophage LambdaBa04, terminase, large
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03354"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29561"
FT                   /db_xref="GOA:A0A0F7RNK9"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNK9"
FT                   /protein_id="AAT29561.1"
FT   gene            466471..467436
FT                   /pseudo
FT                   /locus_tag="GBAA_0466"
FT                   /old_locus_tag="GBAA0466"
FT                   /note="prophage LambdaBa04, portal protein, truncation"
FT   gene            467384..467974
FT                   /locus_tag="GBAA_0467"
FT                   /old_locus_tag="GBAA0467"
FT   CDS_pept        467384..467974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0467"
FT                   /old_locus_tag="GBAA0467"
FT                   /product="putative prophage LambdaBa04, prohead protease"
FT                   /note="identified by match to protein family HMM PF04586;
FT                   match to protein family HMM TIGR01543"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29563"
FT                   /db_xref="GOA:A0A0F7RJL9"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJL9"
FT                   /protein_id="AAT29563.1"
FT   gene            467993..469183
FT                   /locus_tag="GBAA_0468"
FT                   /old_locus_tag="GBAA0468"
FT   CDS_pept        467993..469183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0468"
FT                   /old_locus_tag="GBAA0468"
FT                   /product="putative prophage LambdaBa04, major capsid
FT                   protein"
FT                   /note="identified by match to protein family HMM PF05065;
FT                   match to protein family HMM TIGR01554"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29564"
FT                   /db_xref="GOA:Q81Z09"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z09"
FT                   /protein_id="AAT29564.1"
FT   gene            469199..469456
FT                   /locus_tag="GBAA_0469"
FT                   /old_locus_tag="GBAA0469"
FT   CDS_pept        469199..469456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0469"
FT                   /old_locus_tag="GBAA0469"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29565"
FT                   /db_xref="GOA:A0A0F7RMB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMB5"
FT                   /protein_id="AAT29565.1"
FT   gene            469453..469725
FT                   /locus_tag="GBAA_0470"
FT                   /old_locus_tag="GBAA0470"
FT   CDS_pept        469453..469725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0470"
FT                   /old_locus_tag="GBAA0470"
FT                   /product="putative prophage LambdaBa04, DNA packaging
FT                   protein"
FT                   /note="identified by match to protein family HMM TIGR01560"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35268"
FT                   /db_xref="GOA:A0A0F7RNK4"
FT                   /db_xref="InterPro:IPR006450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNK4"
FT                   /protein_id="AAT35268.1"
FT   gene            469722..470021
FT                   /locus_tag="GBAA_0471"
FT                   /old_locus_tag="GBAA0471"
FT   CDS_pept        469722..470021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0471"
FT                   /old_locus_tag="GBAA0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01563"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29566"
FT                   /db_xref="GOA:A0A0F7RHU3"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHU3"
FT                   /protein_id="AAT29566.1"
FT   gene            470014..470370
FT                   /locus_tag="GBAA_0472"
FT                   /old_locus_tag="GBAA0472"
FT   CDS_pept        470014..470370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0472"
FT                   /old_locus_tag="GBAA0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29567"
FT                   /db_xref="GOA:A0A0F7RJL7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJL7"
FT                   /protein_id="AAT29567.1"
FT                   ENEFLERVERAIQQ"
FT   gene            470367..470696
FT                   /locus_tag="GBAA_0473"
FT                   /old_locus_tag="GBAA0473"
FT   CDS_pept        470367..470696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0473"
FT                   /old_locus_tag="GBAA0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35269"
FT                   /db_xref="GOA:Q81Z04"
FT                   /db_xref="UniProtKB/TrEMBL:Q81Z04"
FT                   /protein_id="AAT35269.1"
FT                   ETRLI"
FT   gene            470697..471266
FT                   /locus_tag="GBAA_0474"
FT                   /old_locus_tag="GBAA0474"
FT   CDS_pept        470697..471266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0474"
FT                   /old_locus_tag="GBAA0474"
FT                   /product="putative prophage LambdaBa04, major tail protein"
FT                   /note="identified by match to protein family HMM TIGR01603"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29568"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMR9"
FT                   /protein_id="AAT29568.2"
FT   gene            471271..471633
FT                   /locus_tag="GBAA_0475"
FT                   /old_locus_tag="GBAA0475"
FT   CDS_pept        471271..471633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0475"
FT                   /old_locus_tag="GBAA0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29569"
FT                   /db_xref="GOA:A0A0F7RMB3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMB3"
FT                   /protein_id="AAT29569.1"
FT                   TEIQDLIKSTVQSKKK"
FT   gene            471744..471857
FT                   /locus_tag="GBAA_0476"
FT                   /old_locus_tag="GBAA0476"
FT   CDS_pept        471744..471857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0476"
FT                   /old_locus_tag="GBAA0476"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29570"
FT                   /db_xref="GOA:A0A2C3G762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2C3G762"
FT                   /protein_id="AAT29570.1"
FT   gene            471875..475810
FT                   /locus_tag="GBAA_0477"
FT                   /old_locus_tag="GBAA0477"
FT   CDS_pept        471875..475810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0477"
FT                   /old_locus_tag="GBAA0477"
FT                   /product="putative prophage LambdaBa04, tape measure
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29571"
FT                   /db_xref="GOA:A0A0F7RHU0"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHU0"
FT                   /protein_id="AAT29571.1"
FT   gene            475807..476616
FT                   /locus_tag="GBAA_0478"
FT                   /old_locus_tag="GBAA0478"
FT   CDS_pept        475807..476616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0478"
FT                   /old_locus_tag="GBAA0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR01633"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29572"
FT                   /db_xref="GOA:A0A0F7RJL6"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJL6"
FT                   /protein_id="AAT29572.1"
FT   gene            476631..480209
FT                   /locus_tag="GBAA_0479"
FT                   /old_locus_tag="GBAA0479"
FT   CDS_pept        476631..480209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0479"
FT                   /old_locus_tag="GBAA0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29573"
FT                   /db_xref="GOA:A0A0F7RMP8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMP8"
FT                   /protein_id="AAT29573.1"
FT   gene            480275..480436
FT                   /locus_tag="GBAA_0480"
FT                   /old_locus_tag="GBAA0480"
FT   CDS_pept        480275..480436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0480"
FT                   /old_locus_tag="GBAA0480"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29574"
FT                   /db_xref="GOA:A0A0F7RMB1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMB1"
FT                   /protein_id="AAT29574.1"
FT                   YVIPEQIE"
FT   gene            480505..482139
FT                   /locus_tag="GBAA_0481"
FT                   /old_locus_tag="GBAA0481"
FT   CDS_pept        480505..482139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0481"
FT                   /old_locus_tag="GBAA0481"
FT                   /product="phage minor structural protein"
FT                   /note="identified by match to protein family HMM TIGR01665"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29575"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNK0"
FT                   /protein_id="AAT29575.1"
FT   gene            482157..482636
FT                   /locus_tag="GBAA_0482"
FT                   /old_locus_tag="GBAA0482"
FT   CDS_pept        482157..482636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0482"
FT                   /old_locus_tag="GBAA0482"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29576"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHT5"
FT                   /protein_id="AAT29576.1"
FT   gene            482731..482970
FT                   /locus_tag="GBAA_0483"
FT                   /old_locus_tag="GBAA0483"
FT   CDS_pept        482731..482970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0483"
FT                   /old_locus_tag="GBAA0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29577"
FT                   /db_xref="GOA:A0A0F7RJK8"
FT                   /db_xref="InterPro:IPR019715"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJK8"
FT                   /protein_id="AAT29577.1"
FT   gene            483043..483186
FT                   /locus_tag="GBAA_0484"
FT                   /old_locus_tag="GBAA0484"
FT   CDS_pept        483043..483186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0484"
FT                   /old_locus_tag="GBAA0484"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29578"
FT                   /db_xref="GOA:A0A0F7RMP6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMP6"
FT                   /protein_id="AAT29578.1"
FT                   DK"
FT   gene            483186..483983
FT                   /locus_tag="GBAA_0485"
FT                   /old_locus_tag="GBAA0485"
FT   CDS_pept        483186..483983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0485"
FT                   /old_locus_tag="GBAA0485"
FT                   /product="putative prophage LambdaBa04, glycosyl hydrolase,
FT                   family 25"
FT                   /note="identified by match to protein family HMM PF01183"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29579"
FT                   /db_xref="GOA:A0A0F7RMA9"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021976"
FT                   /db_xref="PDB:3HMC"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMA9"
FT                   /protein_id="AAT29579.1"
FT   gene            complement(484037..484339)
FT                   /locus_tag="GBAA_0486"
FT                   /old_locus_tag="GBAA0486"
FT   CDS_pept        complement(484037..484339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0486"
FT                   /old_locus_tag="GBAA0486"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29580"
FT                   /db_xref="GOA:Q81YZ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YZ1"
FT                   /protein_id="AAT29580.2"
FT   gene            484752..485489
FT                   /gene="truA2"
FT                   /locus_tag="GBAA_0487"
FT                   /old_locus_tag="GBAA0487"
FT   CDS_pept        484752..485489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA2"
FT                   /locus_tag="GBAA_0487"
FT                   /old_locus_tag="GBAA0487"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="identified by match to protein family HMM PF01416;
FT                   match to protein family HMM TIGR00071"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACN55049"
FT                   /db_xref="GOA:B9ZSE6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B9ZSE6"
FT                   /protein_id="ACN55049.1"
FT   gene            complement(485540..485743)
FT                   /locus_tag="GBAA_0488"
FT                   /old_locus_tag="GBAA0488"
FT   CDS_pept        complement(485540..485743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0488"
FT                   /old_locus_tag="GBAA0488"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35270"
FT                   /db_xref="GOA:A0A1Q4LWT3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWT3"
FT                   /protein_id="AAT35270.1"
FT   gene            complement(485827..487230)
FT                   /gene="rocR1"
FT                   /locus_tag="GBAA_0489"
FT                   /old_locus_tag="GBAA0489"
FT   CDS_pept        complement(485827..487230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR1"
FT                   /locus_tag="GBAA_0489"
FT                   /old_locus_tag="GBAA0489"
FT                   /product="arginine utilization regulatory protein RocR"
FT                   /note="identified by match to protein family HMM PF00158;
FT                   match to protein family HMM PF02954; match to protein
FT                   family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29582"
FT                   /db_xref="GOA:Q81YY9"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YY9"
FT                   /protein_id="AAT29582.1"
FT                   RIKKLHLHI"
FT   gene            487504..487758
FT                   /locus_tag="GBAA_0490"
FT                   /old_locus_tag="GBAA0490"
FT   CDS_pept        487504..487758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0490"
FT                   /old_locus_tag="GBAA0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00364"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29583"
FT                   /db_xref="GOA:A0A2A8KX58"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2A8KX58"
FT                   /protein_id="AAT29583.1"
FT   gene            487863..489284
FT                   /locus_tag="GBAA_0492"
FT                   /old_locus_tag="GBAA0492"
FT   CDS_pept        487863..489284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0492"
FT                   /old_locus_tag="GBAA0492"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29585"
FT                   /db_xref="GOA:A0A0F7RNJ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNJ4"
FT                   /protein_id="AAT29585.1"
FT                   VEHIEKTDTTEVDSL"
FT   gene            489380..490660
FT                   /locus_tag="GBAA_0493"
FT                   /old_locus_tag="GBAA0493"
FT   CDS_pept        489380..490660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0493"
FT                   /old_locus_tag="GBAA0493"
FT                   /product="putative acetylornitine deacetylase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01910"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29586"
FT                   /db_xref="GOA:Q81YY6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YY6"
FT                   /protein_id="AAT29586.1"
FT   gene            complement(490755..491408)
FT                   /locus_tag="GBAA_0494"
FT                   /old_locus_tag="GBAA0494"
FT   CDS_pept        complement(490755..491408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0494"
FT                   /old_locus_tag="GBAA0494"
FT                   /product="DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29587"
FT                   /db_xref="GOA:Q81YY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YY5"
FT                   /protein_id="AAT29587.1"
FT   gene            491538..492149
FT                   /locus_tag="GBAA_0495"
FT                   /old_locus_tag="GBAA0495"
FT   CDS_pept        491538..492149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0495"
FT                   /old_locus_tag="GBAA0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM TIGR02840"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29589"
FT                   /db_xref="GOA:Q81YY4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YY4"
FT                   /protein_id="AAT29589.1"
FT   gene            492264..492422
FT                   /locus_tag="GBAA_0496"
FT                   /old_locus_tag="GBAA0496"
FT   CDS_pept        492264..492422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0496"
FT                   /old_locus_tag="GBAA0496"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29590"
FT                   /db_xref="GOA:A0A1J9VJG9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VJG9"
FT                   /protein_id="AAT29590.1"
FT                   KNSLKKH"
FT   gene            complement(492445..492786)
FT                   /locus_tag="GBAA_0497"
FT                   /old_locus_tag="GBAA0497"
FT   CDS_pept        complement(492445..492786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0497"
FT                   /old_locus_tag="GBAA0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29591"
FT                   /db_xref="GOA:A0A1J9VXI5"
FT                   /db_xref="InterPro:IPR025083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VXI5"
FT                   /protein_id="AAT29591.1"
FT                   SEQLIEDIR"
FT   gene            complement(492825..492977)
FT                   /locus_tag="GBAA_0498"
FT                   /old_locus_tag="GBAA0498"
FT   CDS_pept        complement(492825..492977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0498"
FT                   /old_locus_tag="GBAA0498"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35271"
FT                   /db_xref="GOA:Q81YY1"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YY1"
FT                   /protein_id="AAT35271.1"
FT                   LPPPE"
FT   gene            complement(492962..493891)
FT                   /gene="glsA1"
FT                   /locus_tag="GBAA_0499"
FT                   /old_locus_tag="GBAA0499"
FT   CDS_pept        complement(492962..493891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA1"
FT                   /locus_tag="GBAA_0499"
FT                   /old_locus_tag="GBAA0499"
FT                   /product="glutaminase A"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04960"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29592"
FT                   /db_xref="GOA:Q81YY0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YY0"
FT                   /protein_id="AAT29592.1"
FT   gene            493961..494074
FT                   /locus_tag="GBAA_0500"
FT                   /old_locus_tag="GBAA0500"
FT   CDS_pept        493961..494074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0500"
FT                   /old_locus_tag="GBAA0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29593"
FT                   /db_xref="GOA:A0A0F7RJJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJJ6"
FT                   /protein_id="AAT29593.1"
FT   gene            494216..495709
FT                   /locus_tag="GBAA_0501"
FT                   /old_locus_tag="GBAA0501"
FT   CDS_pept        494216..495709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0501"
FT                   /old_locus_tag="GBAA0501"
FT                   /product="putative PTS system, N-acetylglucosamine-specific
FT                   IIBC component"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826; match to protein family HMM
FT                   TIGR01998"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29594"
FT                   /db_xref="GOA:Q81YX8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YX8"
FT                   /protein_id="AAT29594.1"
FT   gene            495964..497202
FT                   /locus_tag="GBAA_0502"
FT                   /old_locus_tag="GBAA0502"
FT   CDS_pept        495964..497202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0502"
FT                   /old_locus_tag="GBAA0502"
FT                   /product="putative penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29595"
FT                   /db_xref="GOA:Q81YX7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YX7"
FT                   /protein_id="AAT29595.1"
FT                   NNDIYTMLRNIEV"
FT   gene            497356..497757
FT                   /locus_tag="GBAA_0503"
FT                   /old_locus_tag="GBAA0503"
FT   CDS_pept        497356..497757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0503"
FT                   /old_locus_tag="GBAA0503"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29596"
FT                   /db_xref="GOA:A0A1J9VY29"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VY29"
FT                   /protein_id="AAT29596.1"
FT   gene            497774..497968
FT                   /locus_tag="GBAA_0504"
FT                   /old_locus_tag="GBAA0504"
FT   CDS_pept        497774..497968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0504"
FT                   /old_locus_tag="GBAA0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35272"
FT                   /db_xref="GOA:A0A0J1HMT8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HMT8"
FT                   /protein_id="AAT35272.1"
FT   gene            497943..499529
FT                   /locus_tag="GBAA_0505"
FT                   /old_locus_tag="GBAA0505"
FT   CDS_pept        497943..499529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0505"
FT                   /old_locus_tag="GBAA0505"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAT35273"
FT                   /db_xref="GOA:Q81YX4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YX4"
FT                   /protein_id="AAT35273.1"
FT                   LRREEENTNEY"
FT   gene            499519..500762
FT                   /pseudo
FT                   /locus_tag="GBAA_0506"
FT                   /old_locus_tag="GBAA0506"
FT                   /note="putative polysaccharide biosynthesis protein,
FT                   authentic frameshift; this gene contains a frame shift
FT                   which is not the result of sequencing error; identified by
FT                   match to protein family HMM PF03721"
FT   gene            500759..501724
FT                   /locus_tag="GBAA_0507"
FT                   /old_locus_tag="GBAA0507"
FT   CDS_pept        500759..501724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0507"
FT                   /old_locus_tag="GBAA0507"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF05368; match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29601"
FT                   /db_xref="GOA:A0A0J1HMT1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HMT1"
FT                   /protein_id="AAT29601.1"
FT   gene            501717..503261
FT                   /locus_tag="GBAA_0508"
FT                   /old_locus_tag="GBAA0508"
FT   CDS_pept        501717..503261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0508"
FT                   /old_locus_tag="GBAA0508"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29602"
FT                   /db_xref="GOA:Q81YX2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YX2"
FT                   /protein_id="AAT29602.1"
FT   gene            503601..505850
FT                   /gene="pfl"
FT                   /locus_tag="GBAA_0509"
FT                   /old_locus_tag="GBAA0509"
FT   CDS_pept        503601..505850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="GBAA_0509"
FT                   /old_locus_tag="GBAA0509"
FT                   /product="formate acetyltransferase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01228;
FT                   match to protein family HMM PF02901; match to protein
FT                   family HMM TIGR01255"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29603"
FT                   /db_xref="GOA:Q81YX1"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YX1"
FT                   /protein_id="AAT29603.1"
FT   gene            505920..506651
FT                   /gene="pflA"
FT                   /locus_tag="GBAA_0510"
FT                   /old_locus_tag="GBAA0510"
FT   CDS_pept        505920..506651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="GBAA_0510"
FT                   /old_locus_tag="GBAA0510"
FT                   /product="pyruvate formate-lyase-activating enzyme"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR02493"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29604"
FT                   /db_xref="GOA:A0A0F7RMN6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMN6"
FT                   /protein_id="AAT29604.1"
FT   gene            507064..508230
FT                   /locus_tag="GBAA_0511"
FT                   /old_locus_tag="GBAA0511"
FT   CDS_pept        507064..508230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0511"
FT                   /old_locus_tag="GBAA0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06925"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29605"
FT                   /db_xref="GOA:Q81YW9"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="InterPro:IPR023589"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW9"
FT                   /protein_id="AAT29605.1"
FT   gene            complement(508595..508714)
FT                   /locus_tag="GBAA_0512"
FT                   /old_locus_tag="GBAA0512"
FT   CDS_pept        complement(508595..508714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0512"
FT                   /old_locus_tag="GBAA0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29606"
FT                   /db_xref="GOA:A0A1Q4LWZ7"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWZ7"
FT                   /protein_id="AAT29606.1"
FT   gene            complement(508825..509382)
FT                   /locus_tag="GBAA_0513"
FT                   /old_locus_tag="GBAA0513"
FT   CDS_pept        complement(508825..509382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0513"
FT                   /old_locus_tag="GBAA0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29607"
FT                   /db_xref="GOA:A0A1J9VXH0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VXH0"
FT                   /protein_id="AAT29607.1"
FT   gene            complement(509624..510754)
FT                   /locus_tag="GBAA_0514"
FT                   /old_locus_tag="GBAA0514"
FT   CDS_pept        complement(509624..510754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0514"
FT                   /old_locus_tag="GBAA0514"
FT                   /product="chlorohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29608"
FT                   /db_xref="GOA:A0A0F7RJI3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJI3"
FT                   /protein_id="AAT29608.2"
FT   gene            complement(510895..511800)
FT                   /locus_tag="GBAA_0515"
FT                   /old_locus_tag="GBAA0515"
FT   CDS_pept        complement(510895..511800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0515"
FT                   /old_locus_tag="GBAA0515"
FT                   /product="cell division inhibitor-like protein"
FT                   /note="identified by match to protein family HMM PF01370;
FT                   match to protein family HMM PF07993; match to protein
FT                   family HMM PF08338; match to protein family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29609"
FT                   /db_xref="GOA:Q81YW5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YW5"
FT                   /protein_id="AAT29609.1"
FT   gene            511882..512694
FT                   /locus_tag="GBAA_0516"
FT                   /old_locus_tag="GBAA0516"
FT   CDS_pept        511882..512694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0516"
FT                   /old_locus_tag="GBAA0516"
FT                   /product="recX domain protein"
FT                   /note="identified by match to protein family HMM PF02631"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29610"
FT                   /db_xref="GOA:Q81YW4"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW4"
FT                   /protein_id="AAT29610.1"
FT   gene            512710..513021
FT                   /locus_tag="GBAA_0517"
FT                   /old_locus_tag="GBAA0517"
FT   CDS_pept        512710..513021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0517"
FT                   /old_locus_tag="GBAA0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08838"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29611"
FT                   /db_xref="GOA:Q81YW3"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YW3"
FT                   /protein_id="AAT29611.2"
FT   gene            complement(513086..513238)
FT                   /locus_tag="GBAA_0518"
FT                   /old_locus_tag="GBAA0518"
FT   CDS_pept        complement(513086..513238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0518"
FT                   /old_locus_tag="GBAA0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29612"
FT                   /db_xref="GOA:A0A1J9W166"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W166"
FT                   /protein_id="AAT29612.1"
FT                   KKRQF"
FT   gene            complement(513282..513440)
FT                   /locus_tag="GBAA_0519"
FT                   /old_locus_tag="GBAA0519"
FT   CDS_pept        complement(513282..513440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0519"
FT                   /old_locus_tag="GBAA0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08176;
FT                   match to protein family HMM TIGR03091"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29613"
FT                   /db_xref="GOA:Q81YW1"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YW1"
FT                   /protein_id="AAT29613.1"
FT                   AANQQEE"
FT   gene            513562..513828
FT                   /locus_tag="GBAA_0520"
FT                   /old_locus_tag="GBAA0520"
FT   CDS_pept        513562..513828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0520"
FT                   /old_locus_tag="GBAA0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29614"
FT                   /db_xref="GOA:A0A0F7RMN2"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMN2"
FT                   /protein_id="AAT29614.1"
FT   gene            complement(513853..514833)
FT                   /locus_tag="GBAA_0521"
FT                   /old_locus_tag="GBAA0521"
FT   CDS_pept        complement(513853..514833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0521"
FT                   /old_locus_tag="GBAA0521"
FT                   /product="yfhP protein"
FT                   /note="identified by match to protein family HMM PF04307"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29615"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM70"
FT                   /protein_id="AAT29615.1"
FT   gene            514983..516080
FT                   /gene="mutY"
FT                   /locus_tag="GBAA_0522"
FT                   /old_locus_tag="GBAA0522"
FT   CDS_pept        514983..516080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="GBAA_0522"
FT                   /old_locus_tag="GBAA0522"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29616"
FT                   /db_xref="GOA:A0A0F7RNH6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNH6"
FT                   /protein_id="AAT29616.1"
FT   gene            complement(516115..516402)
FT                   /locus_tag="GBAA_0523"
FT                   /old_locus_tag="GBAA0523"
FT   CDS_pept        complement(516115..516402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0523"
FT                   /old_locus_tag="GBAA0523"
FT                   /product="yfhS protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29617"
FT                   /db_xref="GOA:A0A0F7RHQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHQ2"
FT                   /protein_id="AAT29617.1"
FT   gene            516465..516752
FT                   /locus_tag="GBAA_0524"
FT                   /old_locus_tag="GBAA0524"
FT   CDS_pept        516465..516752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0524"
FT                   /old_locus_tag="GBAA0524"
FT                   /product="small acid-soluble spore protein, gamma-type"
FT                   /note="identified by match to protein family HMM PF04259;
FT                   match to protein family HMM TIGR01442"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29618"
FT                   /db_xref="GOA:Q84DX8"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:Q84DX8"
FT                   /protein_id="AAT29618.1"
FT   gene            516941..517201
FT                   /locus_tag="GBAA_0526"
FT                   /old_locus_tag="GBAA0526"
FT   CDS_pept        516941..517201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0526"
FT                   /old_locus_tag="GBAA0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29619"
FT                   /db_xref="GOA:A0A1J9W235"
FT                   /db_xref="InterPro:IPR025572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9W235"
FT                   /protein_id="AAT29619.1"
FT   gene            517434..517964
FT                   /locus_tag="GBAA_0527"
FT                   /old_locus_tag="GBAA0527"
FT   CDS_pept        517434..517964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0527"
FT                   /old_locus_tag="GBAA0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04167"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29620"
FT                   /db_xref="GOA:Q81YV4"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV4"
FT                   /protein_id="AAT29620.1"
FT                   VDMWYERYLMYRN"
FT   gene            518019..519779
FT                   /locus_tag="GBAA_0528"
FT                   /old_locus_tag="GBAA0528"
FT   CDS_pept        518019..519779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0528"
FT                   /old_locus_tag="GBAA0528"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29621"
FT                   /db_xref="GOA:A0A0F7RNH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNH3"
FT                   /protein_id="AAT29621.1"
FT                   QHITETAPLA"
FT   gene            complement(519793..520881)
FT                   /locus_tag="GBAA_0529"
FT                   /old_locus_tag="GBAA0529"
FT   CDS_pept        complement(519793..520881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0529"
FT                   /old_locus_tag="GBAA0529"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06081"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29622"
FT                   /db_xref="GOA:A0A1Q4LWM7"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWM7"
FT                   /protein_id="AAT29622.1"
FT   gene            complement(521142..525578)
FT                   /locus_tag="GBAA_0530"
FT                   /old_locus_tag="GBAA0530"
FT   CDS_pept        complement(521142..525578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0530"
FT                   /old_locus_tag="GBAA0530"
FT                   /product="putative glutamate synthase, large subunit"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01493; match to protein
FT                   family HMM PF01645; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAT70117"
FT                   /db_xref="GOA:Q81YV1"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YV1"
FT                   /protein_id="AAT70117.1"
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(525778..527082)
FT                   /gene="hemL1"
FT                   /locus_tag="GBAA_0531"
FT                   /old_locus_tag="GBAA0531"
FT   CDS_pept        complement(525778..527082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL1"
FT                   /locus_tag="GBAA_0531"
FT                   /old_locus_tag="GBAA0531"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29625"
FT                   /db_xref="GOA:Q81YV0"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="PDB:3L44"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YV0"
FT                   /protein_id="AAT29625.1"
FT   gene            527204..528217
FT                   /locus_tag="GBAA_0532"
FT                   /old_locus_tag="GBAA0532"
FT   CDS_pept        527204..528217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0532"
FT                   /old_locus_tag="GBAA0532"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29626"
FT                   /db_xref="GOA:A0A1J9X6F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9X6F5"
FT                   /protein_id="AAT29626.1"
FT   gene            528210..529001
FT                   /locus_tag="GBAA_0533"
FT                   /old_locus_tag="GBAA0533"
FT   CDS_pept        528210..529001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0533"
FT                   /old_locus_tag="GBAA0533"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29627"
FT                   /db_xref="GOA:A0A1Q4LWL8"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWL8"
FT                   /protein_id="AAT29627.1"
FT   gene            529006..529791
FT                   /locus_tag="GBAA_0534"
FT                   /old_locus_tag="GBAA0534"
FT   CDS_pept        529006..529791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0534"
FT                   /old_locus_tag="GBAA0534"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF06182"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29628"
FT                   /db_xref="GOA:A0A1Q4LWY7"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWY7"
FT                   /protein_id="AAT29628.1"
FT   gene            529864..530268
FT                   /locus_tag="GBAA_0535"
FT                   /old_locus_tag="GBAA0535"
FT   CDS_pept        529864..530268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0535"
FT                   /old_locus_tag="GBAA0535"
FT                   /product="putative potassium channel protein"
FT                   /note="identified by match to protein family HMM PF07885"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29629"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YU6"
FT                   /protein_id="AAT29629.1"
FT   gene            530313..530768
FT                   /gene="bcP"
FT                   /locus_tag="GBAA_0536"
FT                   /old_locus_tag="GBAA0536"
FT   CDS_pept        530313..530768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="GBAA_0536"
FT                   /old_locus_tag="GBAA0536"
FT                   /product="bacterioferritin comigratory protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29631"
FT                   /db_xref="GOA:A0A2B6BYF7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2B6BYF7"
FT                   /protein_id="AAT29631.1"
FT   gene            531060..531494
FT                   /locus_tag="GBAA_0537"
FT                   /old_locus_tag="GBAA0537"
FT   CDS_pept        531060..531494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0537"
FT                   /old_locus_tag="GBAA0537"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29632"
FT                   /db_xref="GOA:A0A1Q4LWN0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWN0"
FT                   /protein_id="AAT29632.2"
FT   gene            complement(531693..532049)
FT                   /locus_tag="GBAA_0538"
FT                   /old_locus_tag="GBAA0538"
FT   CDS_pept        complement(531693..532049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0538"
FT                   /old_locus_tag="GBAA0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29633"
FT                   /db_xref="GOA:Q81YU3"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU3"
FT                   /protein_id="AAT29633.1"
FT                   KEFDEKYNKKSYKS"
FT   gene            532369..532467
FT                   /locus_tag="GBAA_0539"
FT                   /old_locus_tag="GBAA0539"
FT   CDS_pept        532369..532467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0539"
FT                   /old_locus_tag="GBAA0539"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29367"
FT                   /db_xref="GOA:Q81JD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q81JD8"
FT                   /protein_id="AAT29367.1"
FT                   /translation="MKTERNKQRETSIFILDARQTNFIGEFDPGSG"
FT   gene            532463..533968
FT                   /gene="rrsI"
FT                   /locus_tag="GBAA_5982"
FT   rRNA            532463..533968
FT                   /gene="rrsI"
FT                   /locus_tag="GBAA_5982"
FT                   /product="16S ribosomal RNA"
FT   gene            534140..537047
FT                   /gene="rrlI"
FT                   /locus_tag="GBAA_5983"
FT   rRNA            534140..537047
FT                   /gene="rrlI"
FT                   /locus_tag="GBAA_5983"
FT                   /product="23S ribosomal RNA"
FT   gene            537148..537263
FT                   /gene="rrfI"
FT                   /locus_tag="GBAA_5984"
FT   rRNA            537148..537263
FT                   /gene="rrfI"
FT                   /locus_tag="GBAA_5984"
FT                   /product="5S ribosomal RNA"
FT   gene            537272..537346
FT                   /locus_tag="GBAA_5892"
FT   tRNA            537272..537346
FT                   /locus_tag="GBAA_5892"
FT                   /product="tRNA-Asn"
FT   gene            537349..537440
FT                   /locus_tag="GBAA_5893"
FT   tRNA            537349..537440
FT                   /locus_tag="GBAA_5893"
FT                   /product="tRNA-Ser"
FT   gene            537458..537532
FT                   /locus_tag="GBAA_5894"
FT   tRNA            537458..537532
FT                   /locus_tag="GBAA_5894"
FT                   /product="tRNA-Glu"
FT   gene            537538..537613
FT                   /locus_tag="GBAA_5895"
FT   tRNA            537538..537613
FT                   /locus_tag="GBAA_5895"
FT                   /product="tRNA-Val"
FT   gene            537638..537714
FT                   /locus_tag="GBAA_5896"
FT   tRNA            537638..537714
FT                   /locus_tag="GBAA_5896"
FT                   /product="tRNA-Met"
FT   gene            537718..537793
FT                   /locus_tag="GBAA_5897"
FT   tRNA            537718..537793
FT                   /locus_tag="GBAA_5897"
FT                   /product="tRNA-Asp"
FT   gene            537803..537878
FT                   /locus_tag="GBAA_5898"
FT   tRNA            537803..537878
FT                   /locus_tag="GBAA_5898"
FT                   /product="tRNA-Phe"
FT   gene            537897..537972
FT                   /locus_tag="GBAA_5899"
FT   tRNA            537897..537972
FT                   /locus_tag="GBAA_5899"
FT                   /product="tRNA-Thr"
FT   gene            537983..538066
FT                   /locus_tag="GBAA_5900"
FT   tRNA            537983..538066
FT                   /locus_tag="GBAA_5900"
FT                   /product="tRNA-Tyr"
FT   gene            538074..538147
FT                   /locus_tag="GBAA_5901"
FT   tRNA            538074..538147
FT                   /locus_tag="GBAA_5901"
FT                   /product="tRNA-Trp"
FT   gene            538167..538242
FT                   /locus_tag="GBAA_5902"
FT   tRNA            538167..538242
FT                   /locus_tag="GBAA_5902"
FT                   /product="tRNA-His"
FT   gene            538306..538380
FT                   /locus_tag="GBAA_5903"
FT   tRNA            538306..538380
FT                   /locus_tag="GBAA_5903"
FT                   /product="tRNA-Gln"
FT   gene            538386..538460
FT                   /locus_tag="GBAA_5904"
FT   tRNA            538386..538460
FT                   /locus_tag="GBAA_5904"
FT                   /product="tRNA-Gly"
FT   gene            538475..538545
FT                   /locus_tag="GBAA_5905"
FT   tRNA            538475..538545
FT                   /locus_tag="GBAA_5905"
FT                   /product="tRNA-Cys"
FT   gene            538556..538640
FT                   /locus_tag="GBAA_5906"
FT   tRNA            538556..538640
FT                   /locus_tag="GBAA_5906"
FT                   /product="tRNA-Leu"
FT   gene            complement(538848..539168)
FT                   /locus_tag="GBAA_0540"
FT                   /old_locus_tag="GBAA0540"
FT   CDS_pept        complement(538848..539168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0540"
FT                   /old_locus_tag="GBAA0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29637"
FT                   /db_xref="GOA:A0A0F7RMM2"
FT                   /db_xref="InterPro:IPR024979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMM2"
FT                   /protein_id="AAT29637.1"
FT                   SL"
FT   gene            539521..540240
FT                   /locus_tag="GBAA_0541"
FT                   /old_locus_tag="GBAA0541"
FT   CDS_pept        539521..540240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0541"
FT                   /old_locus_tag="GBAA0541"
FT                   /product="conserved hypothetical protein TIGR01033"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29638"
FT                   /db_xref="GOA:Q81YU1"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YU1"
FT                   /protein_id="AAT29638.1"
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            540358..540852
FT                   /locus_tag="GBAA_0542"
FT                   /old_locus_tag="GBAA0542"
FT   CDS_pept        540358..540852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0542"
FT                   /old_locus_tag="GBAA0542"
FT                   /product="mutT/nudix family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29639"
FT                   /db_xref="GOA:A0A0F7RNG7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNG7"
FT                   /protein_id="AAT29639.1"
FT                   L"
FT   gene            541339..542115
FT                   /locus_tag="GBAA_0543"
FT                   /old_locus_tag="GBAA0543"
FT   CDS_pept        541339..542115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0543"
FT                   /old_locus_tag="GBAA0543"
FT                   /product="penicillin-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29640"
FT                   /db_xref="GOA:A0A1Q4LWB1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LWB1"
FT                   /protein_id="AAT29640.1"
FT   gene            542303..542956
FT                   /locus_tag="GBAA_0544"
FT                   /old_locus_tag="GBAA0544"
FT   CDS_pept        542303..542956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0544"
FT                   /old_locus_tag="GBAA0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29641"
FT                   /db_xref="GOA:Q81YT8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT8"
FT                   /protein_id="AAT29641.1"
FT   gene            543071..543144
FT                   /locus_tag="GBAA_5907"
FT   tRNA            543071..543144
FT                   /locus_tag="GBAA_5907"
FT                   /product="tRNA-Gly"
FT   gene            543343..544485
FT                   /locus_tag="GBAA_0545"
FT                   /old_locus_tag="GBAA0545"
FT   CDS_pept        543343..544485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0545"
FT                   /old_locus_tag="GBAA0545"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF03130; match to protein
FT                   family HMM PF08331; match to protein family HMM TIGR00276"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29642"
FT                   /db_xref="GOA:Q81YT7"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT7"
FT                   /protein_id="AAT29642.1"
FT   gene            544530..545417
FT                   /locus_tag="GBAA_0546"
FT                   /old_locus_tag="GBAA0546"
FT   CDS_pept        544530..545417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0546"
FT                   /old_locus_tag="GBAA0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29643"
FT                   /db_xref="GOA:A0A0J1HUE7"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HUE7"
FT                   /protein_id="AAT29643.1"
FT                   TPQMKYKFFHIING"
FT   gene            545476..545964
FT                   /locus_tag="GBAA_0547"
FT                   /old_locus_tag="GBAA0547"
FT   CDS_pept        545476..545964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0547"
FT                   /old_locus_tag="GBAA0547"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29644"
FT                   /db_xref="GOA:A0A1S0QJT2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="PDB:4PZK"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QJT2"
FT                   /protein_id="AAT29644.1"
FT   gene            546092..548161
FT                   /locus_tag="GBAA_0548"
FT                   /old_locus_tag="GBAA0548"
FT   CDS_pept        546092..548161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0548"
FT                   /old_locus_tag="GBAA0548"
FT                   /product="sensory box/GGDEF family protein"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00989; match to protein
FT                   family HMM PF00990; match to protein family HMM PF08447;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29645"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHN3"
FT                   /protein_id="AAT29645.1"
FT   gene            complement(548192..548287)
FT                   /locus_tag="GBAA_0549"
FT                   /old_locus_tag="GBAA0549"
FT   CDS_pept        complement(548192..548287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0549"
FT                   /old_locus_tag="GBAA0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29646"
FT                   /db_xref="GOA:A0A1Q4LW74"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Q4LW74"
FT                   /protein_id="AAT29646.1"
FT                   /translation="MKLLLILGVSLTFLTAIFTSGYNDKPGTHKK"
FT   gene            548553..550448
FT                   /locus_tag="GBAA_0550"
FT                   /old_locus_tag="GBAA0550"
FT   CDS_pept        548553..550448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0550"
FT                   /old_locus_tag="GBAA0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06798;
FT                   match to protein family HMM PF08298"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29647"
FT                   /db_xref="GOA:A0A1J9VYP5"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9VYP5"
FT                   /protein_id="AAT29647.1"
FT   gene            550894..552069
FT                   /locus_tag="GBAA_0551"
FT                   /old_locus_tag="GBAA0551"
FT   CDS_pept        550894..552069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0551"
FT                   /old_locus_tag="GBAA0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04285;
FT                   match to protein family HMM TIGR02877"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29648"
FT                   /db_xref="GOA:Q81YT1"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81YT1"
FT                   /protein_id="AAT29648.1"
FT   gene            552231..555443
FT                   /locus_tag="GBAA_0552"
FT                   /old_locus_tag="GBAA0552"
FT   CDS_pept        552231..555443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0552"
FT                   /old_locus_tag="GBAA0552"
FT                   /product="putative internalin"
FT                   /note="identified by similarity to GB:CAC98412.1; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF00746; match to protein family HMM PF05031; match to
FT                   protein family HMM TIGR01167"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29649"
FT                   /db_xref="GOA:A0A0F7RNB7"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR037250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNB7"
FT                   /protein_id="AAT29649.1"
FT   gene            555598..556464
FT                   /locus_tag="GBAA_0553"
FT                   /old_locus_tag="GBAA0553"
FT   CDS_pept        555598..556464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0553"
FT                   /old_locus_tag="GBAA0553"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29650"
FT                   /db_xref="GOA:Q81YS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YS9"
FT                   /protein_id="AAT29650.1"
FT                   LQHYIIE"
FT   gene            complement(556568..558118)
FT                   /gene="opuD1"
FT                   /locus_tag="GBAA_0554"
FT                   /old_locus_tag="GBAA0554"
FT   CDS_pept        complement(556568..558118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD1"
FT                   /locus_tag="GBAA_0554"
FT                   /old_locus_tag="GBAA0554"
FT                   /product="glycine betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028;
FT                   match to protein family HMM TIGR00842"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29651"
FT                   /db_xref="GOA:Q81YS8"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YS8"
FT                   /protein_id="AAT29651.1"
FT   gene            558387..561284
FT                   /locus_tag="GBAA_0555"
FT                   /old_locus_tag="GBAA0555"
FT   CDS_pept        558387..561284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0555"
FT                   /old_locus_tag="GBAA0555"
FT                   /product="putative microbial collagenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00801;
FT                   match to protein family HMM PF01752; match to protein
FT                   family HMM PF04151; match to protein family HMM PF08453"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29652"
FT                   /db_xref="GOA:A0A0F7RMG0"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR013661"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR041379"
FT                   /db_xref="PDB:5SV5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMG0"
FT                   /protein_id="AAT29652.1"
FT   gene            561531..562079
FT                   /locus_tag="GBAA_0556"
FT                   /old_locus_tag="GBAA0556"
FT   CDS_pept        561531..562079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0556"
FT                   /old_locus_tag="GBAA0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01957"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29653"
FT                   /db_xref="GOA:A0A0F7RM41"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM41"
FT                   /protein_id="AAT29653.1"
FT   gene            562092..563672
FT                   /locus_tag="GBAA_0557"
FT                   /old_locus_tag="GBAA0557"
FT   CDS_pept        562092..563672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0557"
FT                   /old_locus_tag="GBAA0557"
FT                   /product="SPFH domain/band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145;
FT                   match to protein family HMM PF03149"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29654"
FT                   /db_xref="GOA:A0A0F7RNB4"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNB4"
FT                   /protein_id="AAT29654.1"
FT                   EVEKDKDKE"
FT   gene            563909..565885
FT                   /locus_tag="GBAA_0558"
FT                   /old_locus_tag="GBAA0558"
FT   CDS_pept        563909..565885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0558"
FT                   /old_locus_tag="GBAA0558"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29655"
FT                   /db_xref="GOA:A0A0F7RHI2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHI2"
FT                   /protein_id="AAT29655.1"
FT   gene            566037..567647
FT                   /locus_tag="GBAA_0559"
FT                   /old_locus_tag="GBAA0559"
FT   CDS_pept        566037..567647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0559"
FT                   /old_locus_tag="GBAA0559"
FT                   /product="sensor histidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29656"
FT                   /db_xref="GOA:A0A0F7RJB0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJB0"
FT                   /protein_id="AAT29656.1"
FT   gene            567647..568338
FT                   /pseudo
FT                   /locus_tag="GBAA_0560"
FT                   /old_locus_tag="GBAA0560"
FT                   /note="response regulator, authentic frameshift; this gene
FT                   contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00072"
FT   gene            complement(568382..569686)
FT                   /locus_tag="GBAA_0561"
FT                   /old_locus_tag="GBAA0561"
FT   CDS_pept        complement(568382..569686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0561"
FT                   /old_locus_tag="GBAA0561"
FT                   /product="citrate transporter, CitM family"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF06808; match to protein
FT                   family HMM TIGR00784"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29659"
FT                   /db_xref="GOA:A0A0F7RNB2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNB2"
FT                   /protein_id="AAT29659.1"
FT   gene            569938..570192
FT                   /locus_tag="GBAA_0562"
FT                   /old_locus_tag="GBAA0562"
FT   CDS_pept        569938..570192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0562"
FT                   /old_locus_tag="GBAA0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29660"
FT                   /db_xref="GOA:A0A1J9WCB1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WCB1"
FT                   /protein_id="AAT29660.1"
FT   gene            570327..570830
FT                   /locus_tag="GBAA_0563"
FT                   /old_locus_tag="GBAA0563"
FT   CDS_pept        570327..570830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0563"
FT                   /old_locus_tag="GBAA0563"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29661"
FT                   /db_xref="GOA:A0A0F7RJA5"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJA5"
FT                   /protein_id="AAT29661.1"
FT                   GGHH"
FT   gene            571366..571989
FT                   /locus_tag="GBAA_0564"
FT                   /old_locus_tag="GBAA0564"
FT   CDS_pept        571366..571989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0564"
FT                   /old_locus_tag="GBAA0564"
FT                   /product="ankyrin repeat domain protein"
FT                   /note="identified by match to protein family HMM PF00023"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29662"
FT                   /db_xref="GOA:Q81YR9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q81YR9"
FT                   /protein_id="AAT29662.2"
FT   gene            572548..573114
FT                   /locus_tag="GBAA_0565"
FT                   /old_locus_tag="GBAA0565"
FT   CDS_pept        572548..573114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0565"
FT                   /old_locus_tag="GBAA0565"
FT                   /product="putative glycerol uptake operon antiterminator
FT                   regulatory protein"
FT                   /note="identified by match to protein family HMM PF04309"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29663"
FT                   /db_xref="GOA:A0A0F7RM38"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM38"
FT                   /protein_id="AAT29663.1"
FT   gene            573078..574208
FT                   /locus_tag="GBAA_0566"
FT                   /old_locus_tag="GBAA0566"
FT   CDS_pept        573078..574208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0566"
FT                   /old_locus_tag="GBAA0566"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29664"
FT                   /db_xref="GOA:A0A0F7RNA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNA9"
FT                   /protein_id="AAT29664.1"
FT   gene            574208..575140
FT                   /locus_tag="GBAA_0567"
FT                   /old_locus_tag="GBAA0567"
FT   CDS_pept        574208..575140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0567"
FT                   /old_locus_tag="GBAA0567"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29665"
FT                   /db_xref="GOA:A0A0F7RHH2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHH2"
FT                   /protein_id="AAT29665.1"
FT   gene            575137..575958
FT                   /locus_tag="GBAA_0568"
FT                   /old_locus_tag="GBAA0568"
FT   CDS_pept        575137..575958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0568"
FT                   /old_locus_tag="GBAA0568"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29666"
FT                   /db_xref="GOA:A0A0F7RJA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJA0"
FT                   /protein_id="AAT29666.1"
FT   gene            575980..577356
FT                   /locus_tag="GBAA_0569"
FT                   /old_locus_tag="GBAA0569"
FT   CDS_pept        575980..577356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0569"
FT                   /old_locus_tag="GBAA0569"
FT                   /product="putative glycerol-3-phosphate ABC transporter,
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29667"
FT                   /db_xref="GOA:A0A0F7RMF1"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMF1"
FT                   /protein_id="AAT29667.1"
FT                   "
FT   gene            577772..578476
FT                   /locus_tag="GBAA_0570"
FT                   /old_locus_tag="GBAA0570"
FT   CDS_pept        577772..578476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0570"
FT                   /old_locus_tag="GBAA0570"
FT                   /product="putative serine/threonine phosphatase"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29668"
FT                   /db_xref="GOA:A0A0F7RM34"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM34"
FT                   /protein_id="AAT29668.1"
FT                   ELPSKKVYVVKS"
FT   gene            578626..579297
FT                   /locus_tag="GBAA_0571"
FT                   /old_locus_tag="GBAA0571"
FT   CDS_pept        578626..579297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0571"
FT                   /old_locus_tag="GBAA0571"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29669"
FT                   /db_xref="GOA:A0A1J9X205"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9X205"
FT                   /protein_id="AAT29669.1"
FT                   Q"
FT   gene            579294..580544
FT                   /locus_tag="GBAA_0572"
FT                   /old_locus_tag="GBAA0572"
FT   CDS_pept        579294..580544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0572"
FT                   /old_locus_tag="GBAA0572"
FT                   /product="sensor histidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29670"
FT                   /db_xref="GOA:A0A0F7RHG9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHG9"
FT                   /protein_id="AAT29670.2"
FT                   WGEGTCFEVILPKNQRI"
FT   gene            580763..581572
FT                   /locus_tag="GBAA_0573"
FT                   /old_locus_tag="GBAA0573"
FT   CDS_pept        580763..581572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0573"
FT                   /old_locus_tag="GBAA0573"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29671"
FT                   /db_xref="GOA:Q81VC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC4"
FT                   /protein_id="AAT29671.2"
FT   gene            581586..582332
FT                   /locus_tag="GBAA_0574"
FT                   /old_locus_tag="GBAA0574"
FT   CDS_pept        581586..582332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0574"
FT                   /old_locus_tag="GBAA0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29672"
FT                   /db_xref="GOA:Q81VC3"
FT                   /db_xref="InterPro:IPR016997"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="PDB:3ERV"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC3"
FT                   /protein_id="AAT29672.2"
FT   gene            582586..584568
FT                   /locus_tag="GBAA_0575"
FT                   /old_locus_tag="GBAA0575"
FT   CDS_pept        582586..584568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0575"
FT                   /old_locus_tag="GBAA0575"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29673"
FT                   /db_xref="GOA:A0A0F7RM31"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM31"
FT                   /protein_id="AAT29673.1"
FT   gene            584647..586251
FT                   /locus_tag="GBAA_0576"
FT                   /old_locus_tag="GBAA0576"
FT   CDS_pept        584647..586251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0576"
FT                   /old_locus_tag="GBAA0576"
FT                   /product="sensory box histidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29674"
FT                   /db_xref="GOA:Q81VC1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VC1"
FT                   /protein_id="AAT29674.1"
FT                   GTTITIEIPKGRDERQI"
FT   gene            586281..586955
FT                   /locus_tag="GBAA_0577"
FT                   /old_locus_tag="GBAA0577"
FT   CDS_pept        586281..586955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0577"
FT                   /old_locus_tag="GBAA0577"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29675"
FT                   /db_xref="GOA:D1MPU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:D1MPU8"
FT                   /protein_id="AAT29675.1"
FT                   YV"
FT   gene            587078..588424
FT                   /locus_tag="GBAA_0578"
FT                   /old_locus_tag="GBAA0578"
FT   CDS_pept        587078..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0578"
FT                   /old_locus_tag="GBAA0578"
FT                   /product="citrate cation symporter family"
FT                   /note="identified by match to protein family HMM PF03390"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29676"
FT                   /db_xref="GOA:A0A0F7RJ92"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJ92"
FT                   /protein_id="AAT29676.1"
FT   gene            588484..589683
FT                   /locus_tag="GBAA_0579"
FT                   /old_locus_tag="GBAA0579"
FT   CDS_pept        588484..589683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0579"
FT                   /old_locus_tag="GBAA0579"
FT                   /product="putative malate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29678"
FT                   /db_xref="GOA:A0A0F7RME4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RME4"
FT                   /protein_id="AAT29678.1"
FT                   "
FT   gene            complement(589979..590503)
FT                   /locus_tag="GBAA_0580"
FT                   /old_locus_tag="GBAA0580"
FT   CDS_pept        complement(589979..590503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0580"
FT                   /old_locus_tag="GBAA0580"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29679"
FT                   /db_xref="GOA:A0A0F7RM30"
FT                   /db_xref="InterPro:IPR032366"
FT                   /db_xref="PDB:4JG9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM30"
FT                   /protein_id="AAT29679.1"
FT                   KYYDQFVITAE"
FT   gene            complement(590619..591545)
FT                   /locus_tag="GBAA_0581"
FT                   /old_locus_tag="GBAA0581"
FT   CDS_pept        complement(590619..591545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0581"
FT                   /old_locus_tag="GBAA0581"
FT                   /product="transporter, EamA family"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29680"
FT                   /db_xref="GOA:Q81VB6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VB6"
FT                   /protein_id="AAT29680.1"
FT   gene            591666..593066
FT                   /locus_tag="GBAA_0582"
FT                   /old_locus_tag="GBAA0582"
FT   CDS_pept        591666..593066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0582"
FT                   /old_locus_tag="GBAA0582"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00392"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29681"
FT                   /db_xref="GOA:A0A0F7RHG0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHG0"
FT                   /protein_id="AAT29681.1"
FT                   HKAWFTRK"
FT   gene            complement(593100..593612)
FT                   /locus_tag="GBAA_0583"
FT                   /old_locus_tag="GBAA0583"
FT   CDS_pept        complement(593100..593612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0583"
FT                   /old_locus_tag="GBAA0583"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29682"
FT                   /db_xref="GOA:A0A0J1KKT7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1KKT7"
FT                   /protein_id="AAT29682.1"
FT                   LFLDENK"
FT   gene            complement(593759..595222)
FT                   /locus_tag="GBAA_0584"
FT                   /old_locus_tag="GBAA0584"
FT   CDS_pept        complement(593759..595222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0584"
FT                   /old_locus_tag="GBAA0584"
FT                   /product="sensor histidine kinase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29683"
FT                   /db_xref="GOA:A0A0F7RMD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMD9"
FT                   /protein_id="AAT29683.1"
FT   gene            complement(595288..595959)
FT                   /locus_tag="GBAA_0585"
FT                   /old_locus_tag="GBAA0585"
FT   CDS_pept        complement(595288..595959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0585"
FT                   /old_locus_tag="GBAA0585"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29684"
FT                   /db_xref="GOA:Q81VB2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VB2"
FT                   /protein_id="AAT29684.1"
FT                   E"
FT   gene            596289..596411
FT                   /locus_tag="GBAA_0586"
FT                   /old_locus_tag="GBAA0586"
FT   CDS_pept        596289..596411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0586"
FT                   /old_locus_tag="GBAA0586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29685"
FT                   /db_xref="GOA:A0A0F7RNA1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RNA1"
FT                   /protein_id="AAT29685.1"
FT   gene            complement(596793..597299)
FT                   /locus_tag="GBAA_0587"
FT                   /old_locus_tag="GBAA0587"
FT   CDS_pept        complement(596793..597299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0587"
FT                   /old_locus_tag="GBAA0587"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29686"
FT                   /db_xref="GOA:Q81VB0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VB0"
FT                   /protein_id="AAT29686.1"
FT                   LFLND"
FT   gene            complement(597528..598334)
FT                   /gene="fdhD1"
FT                   /locus_tag="GBAA_0588"
FT                   /old_locus_tag="GBAA0588"
FT   CDS_pept        complement(597528..598334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD1"
FT                   /locus_tag="GBAA_0588"
FT                   /old_locus_tag="GBAA0588"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29687"
FT                   /db_xref="GOA:Q81VA9"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VA9"
FT                   /protein_id="AAT29687.1"
FT   gene            598638..601574
FT                   /locus_tag="GBAA_0589"
FT                   /old_locus_tag="GBAA0589"
FT   CDS_pept        598638..601574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0589"
FT                   /old_locus_tag="GBAA0589"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM PF00384; match to protein family HMM PF01568;
FT                   match to protein family HMM PF04879; match to protein
FT                   family HMM TIGR01591"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29688"
FT                   /db_xref="GOA:Q81VA8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VA8"
FT                   /protein_id="AAT29688.1"
FT   gene            601587..602069
FT                   /pseudo
FT                   /locus_tag="GBAA_0590"
FT                   /old_locus_tag="GBAA0590"
FT                   /note="conserved hypothetical protein, authentic point
FT                   mutation; this gene contains a premature stop which is not
FT                   the result of sequencing error; identified by match to
FT                   protein family HMM PF07849"
FT   gene            602262..604097
FT                   /locus_tag="GBAA_0591"
FT                   /old_locus_tag="GBAA0591"
FT   CDS_pept        602262..604097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0591"
FT                   /old_locus_tag="GBAA0591"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29692"
FT                   /db_xref="GOA:Q81VA7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VA7"
FT                   /protein_id="AAT29692.1"
FT   gene            604465..605598
FT                   /gene="ald1"
FT                   /locus_tag="GBAA_0592"
FT                   /old_locus_tag="GBAA0592"
FT   CDS_pept        604465..605598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald1"
FT                   /locus_tag="GBAA_0592"
FT                   /old_locus_tag="GBAA0592"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF01262;
FT                   match to protein family HMM PF01488; match to protein
FT                   family HMM PF05222; match to protein family HMM TIGR00518"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29693"
FT                   /db_xref="GOA:A0A1S0QNX7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1S0QNX7"
FT                   /protein_id="AAT29693.1"
FT   gene            605702..607117
FT                   /locus_tag="GBAA_0593"
FT                   /old_locus_tag="GBAA0593"
FT   CDS_pept        605702..607117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0593"
FT                   /old_locus_tag="GBAA0593"
FT                   /product="amino acid permease family protein"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM PF03845"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29694"
FT                   /db_xref="GOA:A0A0F7RM08"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM08"
FT                   /protein_id="AAT29694.2"
FT                   DDGSSQDNLEQAN"
FT   gene            607384..607761
FT                   /locus_tag="GBAA_0594"
FT                   /old_locus_tag="GBAA0594"
FT   CDS_pept        607384..607761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0594"
FT                   /old_locus_tag="GBAA0594"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29695"
FT                   /db_xref="GOA:A0A1J9WCD7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WCD7"
FT                   /protein_id="AAT29695.1"
FT   gene            607786..610152
FT                   /locus_tag="GBAA_0595"
FT                   /old_locus_tag="GBAA0595"
FT   CDS_pept        607786..610152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0595"
FT                   /old_locus_tag="GBAA0595"
FT                   /product="heavy metal-transporting ATPase"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00403; match to protein
FT                   family HMM PF00702; match to protein family HMM TIGR01494;
FT                   match to protein family HMM TIGR01512; match to protein
FT                   family HMM TIGR01525"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29696"
FT                   /db_xref="GOA:A0A0F7RHE4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHE4"
FT                   /protein_id="AAT29696.1"
FT   gene            complement(610356..611819)
FT                   /locus_tag="GBAA_0596"
FT                   /old_locus_tag="GBAA0596"
FT   CDS_pept        complement(610356..611819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0596"
FT                   /old_locus_tag="GBAA0596"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29698"
FT                   /db_xref="GOA:A0A0F7RJ74"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJ74"
FT                   /protein_id="AAT29698.1"
FT   gene            612020..613288
FT                   /locus_tag="GBAA_0597"
FT                   /old_locus_tag="GBAA0597"
FT   CDS_pept        612020..613288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0597"
FT                   /old_locus_tag="GBAA0597"
FT                   /product="transcriptional regulator/TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF01381; match to protein
FT                   family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29699"
FT                   /db_xref="GOA:Q81VA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q81VA1"
FT                   /protein_id="AAT29699.1"
FT   gene            613291..613422
FT                   /locus_tag="GBAA_0598"
FT                   /old_locus_tag="GBAA0598"
FT   CDS_pept        613291..613422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0598"
FT                   /old_locus_tag="GBAA0598"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29700"
FT                   /db_xref="GOA:A0A1V4B8V6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1V4B8V6"
FT                   /protein_id="AAT29700.1"
FT   gene            613589..615289
FT                   /locus_tag="GBAA_0599"
FT                   /old_locus_tag="GBAA0599"
FT   CDS_pept        613589..615289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0599"
FT                   /old_locus_tag="GBAA0599"
FT                   /product="neutral protease NprB"
FT                   /note="identified by match to protein family HMM PF01447;
FT                   match to protein family HMM PF02868; match to protein
FT                   family HMM PF03413; match to protein family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29701"
FT                   /db_xref="GOA:Q81V99"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V99"
FT                   /protein_id="AAT29701.1"
FT   gene            complement(615352..615900)
FT                   /locus_tag="GBAA_0600"
FT                   /old_locus_tag="GBAA0600"
FT   CDS_pept        complement(615352..615900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0600"
FT                   /old_locus_tag="GBAA0600"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29703"
FT                   /db_xref="GOA:A0A0J1HU91"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0J1HU91"
FT                   /protein_id="AAT29703.1"
FT   gene            616279..616797
FT                   /locus_tag="GBAA_0602"
FT                   /old_locus_tag="GBAA0602"
FT   CDS_pept        616279..616797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0602"
FT                   /old_locus_tag="GBAA0602"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29704"
FT                   /db_xref="GOA:Q81V97"
FT                   /db_xref="InterPro:IPR041436"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V97"
FT                   /protein_id="AAT29704.1"
FT                   IITSYPSDK"
FT   gene            616813..617085
FT                   /locus_tag="GBAA_0603"
FT                   /old_locus_tag="GBAA0603"
FT   CDS_pept        616813..617085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0603"
FT                   /old_locus_tag="GBAA0603"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29705"
FT                   /db_xref="GOA:A0A1J9WK73"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9WK73"
FT                   /protein_id="AAT29705.1"
FT   gene            complement(617134..618396)
FT                   /locus_tag="GBAA_0604"
FT                   /old_locus_tag="GBAA0604"
FT   CDS_pept        complement(617134..618396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0604"
FT                   /old_locus_tag="GBAA0604"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04294"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29706"
FT                   /db_xref="GOA:A0A0F7RN91"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RN91"
FT                   /protein_id="AAT29706.1"
FT   gene            complement(618631..619632)
FT                   /locus_tag="GBAA_0605"
FT                   /old_locus_tag="GBAA0605"
FT   CDS_pept        complement(618631..619632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0605"
FT                   /old_locus_tag="GBAA0605"
FT                   /product="transcription antiterminator, LytR family"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29707"
FT                   /db_xref="GOA:Q81V94"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V94"
FT                   /protein_id="AAT29707.2"
FT   gene            complement(619908..621086)
FT                   /locus_tag="GBAA_0606"
FT                   /old_locus_tag="GBAA0606"
FT   CDS_pept        complement(619908..621086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0606"
FT                   /old_locus_tag="GBAA0606"
FT                   /product="nucleoside transporter, NupC family"
FT                   /note="identified by match to protein family HMM PF01773;
FT                   match to protein family HMM PF07662; match to protein
FT                   family HMM PF07670; match to protein family HMM TIGR00804"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29708"
FT                   /db_xref="GOA:A0A0F7RJ64"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJ64"
FT                   /protein_id="AAT29708.1"
FT   gene            621178..621564
FT                   /locus_tag="GBAA_0607"
FT                   /old_locus_tag="GBAA0607"
FT   CDS_pept        621178..621564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0607"
FT                   /old_locus_tag="GBAA0607"
FT                   /product="glyoxylase family protein"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29709"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037478"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RMB8"
FT                   /protein_id="AAT29709.1"
FT   gene            621672..622757
FT                   /locus_tag="GBAA_0608"
FT                   /old_locus_tag="GBAA0608"
FT   CDS_pept        621672..622757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0608"
FT                   /old_locus_tag="GBAA0608"
FT                   /product="CBS domain protein"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29710"
FT                   /db_xref="GOA:A0A0F7RM01"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RM01"
FT                   /protein_id="AAT29710.1"
FT   gene            622841..624274
FT                   /gene="aspA1"
FT                   /locus_tag="GBAA_0609"
FT                   /old_locus_tag="GBAA0609"
FT   CDS_pept        622841..624274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA1"
FT                   /locus_tag="GBAA_0609"
FT                   /old_locus_tag="GBAA0609"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number=""
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29711"
FT                   /db_xref="GOA:Q81V90"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V90"
FT                   /protein_id="AAT29711.1"
FT   gene            complement(624314..625933)
FT                   /gene="lldP1"
FT                   /locus_tag="GBAA_0610"
FT                   /old_locus_tag="GBAA0610"
FT   CDS_pept        complement(624314..625933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldP1"
FT                   /locus_tag="GBAA_0610"
FT                   /old_locus_tag="GBAA0610"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29712"
FT                   /db_xref="GOA:A0A0F7RHD9"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RHD9"
FT                   /protein_id="AAT29712.1"
FT   gene            626770..627057
FT                   /locus_tag="GBAA_0612"
FT                   /old_locus_tag="GBAA0612"
FT   CDS_pept        626770..627057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0612"
FT                   /old_locus_tag="GBAA0612"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29713"
FT                   /db_xref="GOA:A0A1J9V557"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1J9V557"
FT                   /protein_id="AAT29713.1"
FT   gene            627172..627351
FT                   /locus_tag="GBAA_0613"
FT                   /old_locus_tag="GBAA0613"
FT   CDS_pept        627172..627351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0613"
FT                   /old_locus_tag="GBAA0613"
FT                   /product="small acid-soluble spore protein, H-type"
FT                   /note="identified by match to protein family HMM PF08141;
FT                   match to protein family HMM TIGR02861"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29714"
FT                   /db_xref="GOA:Q81V87"
FT                   /db_xref="InterPro:IPR012610"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V87"
FT                   /protein_id="AAT29714.2"
FT                   GESVHVHVNALEEK"
FT   gene            complement(627392..628750)
FT                   /locus_tag="GBAA_0614"
FT                   /old_locus_tag="GBAA0614"
FT   CDS_pept        complement(627392..628750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0614"
FT                   /old_locus_tag="GBAA0614"
FT                   /product="proton/peptide symporter family protein"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29715"
FT                   /db_xref="GOA:A0A0F7RLZ9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RLZ9"
FT                   /protein_id="AAT29715.1"
FT   gene            complement(629132..630097)
FT                   /locus_tag="GBAA_0615"
FT                   /old_locus_tag="GBAA0615"
FT   CDS_pept        complement(629132..630097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0615"
FT                   /old_locus_tag="GBAA0615"
FT                   /product="iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29716"
FT                   /db_xref="GOA:A0A0F7RN86"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RN86"
FT                   /protein_id="AAT29716.1"
FT   gene            630270..631274
FT                   /locus_tag="GBAA_0616"
FT                   /old_locus_tag="GBAA0616"
FT   CDS_pept        630270..631274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0616"
FT                   /old_locus_tag="GBAA0616"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29718"
FT                   /db_xref="GOA:Q81V84"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V84"
FT                   /protein_id="AAT29718.1"
FT   gene            631271..632329
FT                   /locus_tag="GBAA_0617"
FT                   /old_locus_tag="GBAA0617"
FT   CDS_pept        631271..632329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0617"
FT                   /old_locus_tag="GBAA0617"
FT                   /product="iron compound ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29719"
FT                   /db_xref="GOA:A0A0F7RJ57"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RJ57"
FT                   /protein_id="AAT29719.1"
FT                   YFIYLLYKSRNS"
FT   gene            632342..633163
FT                   /locus_tag="GBAA_0618"
FT                   /old_locus_tag="GBAA0618"
FT   CDS_pept        632342..633163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0618"
FT                   /old_locus_tag="GBAA0618"
FT                   /product="iron compound ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29720"
FT                   /db_xref="GOA:Q81V82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V82"
FT                   /protein_id="AAT29720.1"
FT   gene            complement(633195..633926)
FT                   /locus_tag="GBAA_0619"
FT                   /old_locus_tag="GBAA0619"
FT   CDS_pept        complement(633195..633926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0619"
FT                   /old_locus_tag="GBAA0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29721"
FT                   /db_xref="GOA:A0A0F7RLZ7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0F7RLZ7"
FT                   /protein_id="AAT29721.1"
FT   gene            634139..635329
FT                   /locus_tag="GBAA_0620"
FT                   /old_locus_tag="GBAA0620"
FT   CDS_pept        634139..635329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0620"
FT                   /old_locus_tag="GBAA0620"
FT                   /product="putative 8-amino-7-oxononanoate synthase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01825"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29722"
FT                   /db_xref="GOA:Q81V80"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010962"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q81V80"
FT                   /protein_id="AAT29722.1"
FT   gene            635374..636327
FT                   /locus_tag="GBAA_0621"
FT                   /old_locus_tag="GBAA0621"
FT   CDS_pept        635374..636327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0621"
FT                   /old_locus_tag="GBAA0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM PF07993"
FT                   /db_xref="EnsemblGenomes-Gn:GBAA_0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAT29723"
FT                   /db_xref="GOA:Q81V79"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q81V79"
FT                   /protein_id="AAT29723.1"
FT   gene            636393..636815
FT                   /locus_tag="GBAA_0622"
FT                   /old_locus_tag="GBAA0622"
FT   CDS_pept        636393..636815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GBAA_0622"
FT                   /old_locus_tag="GBAA0622"
FT                   /product="mutT/nudix family protein"