(data stored in SCRATCH3701 zone)

EMBL: AE017340

ID   AE017340; SV 1; circular; genomic DNA; STD; PRO; 2839318 BP.
XX
AC   AE017340;
XX
PR   Project:PRJNA10790;
XX
DT   04-DEC-2004 (Rel. 82, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 11)
XX
DE   Idiomarina loihiensis L2TR, complete genome.
XX
KW   .
XX
OS   Idiomarina loihiensis L2TR
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Idiomarinaceae; Idiomarina.
XX
RN   [1]
RP   1-2839318
RX   DOI; 10.1073/pnas.0407638102.
RX   PUBMED; 15596722.
RA   Hou S., Saw J.H., Lee K.S., Freitas T.A., Belisle C., Kawarabayasi Y.,
RA   Donachie S.P., Pikina A., Galperin M.Y., Koonin E.V., Makarova K.S.,
RA   Omelchenko M.V., Sorokin A., Wolf Y.I., Li Q.X., Keum Y.S., Campbell S.,
RA   Denery J., Aizawa S., Shibata S., Malahoff A., Alam M.;
RT   "Genome sequence of the deep-sea gamma-proteobacterium Idiomarina
RT   loihiensis reveals amino acid fermentation as a source of carbon and
RT   energy";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(52):18036-18041(2004).
XX
RN   [2]
RP   1-2839318
RA   Hou S., Saw J.H., Lee K.S., Freitas T.A., Belisle C., Kawarabayasi Y.,
RA   Donachie S.P., Galperin M.Y., Koonin E.V., Makarova K.S., Omelchenko M.V.,
RA   Sorokin A., Wolf Y.I., Li Q., Keum Y.S., Campbell S., Denery J.,
RA   Aizawa S.-I., Shibata S., Malahoff A., Alam M.;
RT   ;
RL   Submitted (01-JUL-2004) to the INSDC.
RL   Microbiology, University of Hawaii at Manoa, 2538 The Mall, Snyder 111,
RL   Honolulu, HI 96822, USA
XX
DR   MD5; 83b341e1668cde9b40f54422f1e655a1.
DR   BioSample; SAMN02604184.
DR   EnsemblGenomes-Gn; EBG00001056669.
DR   EnsemblGenomes-Gn; EBG00001056670.
DR   EnsemblGenomes-Gn; EBG00001056671.
DR   EnsemblGenomes-Gn; EBG00001056672.
DR   EnsemblGenomes-Gn; EBG00001056673.
DR   EnsemblGenomes-Gn; EBG00001056674.
DR   EnsemblGenomes-Gn; EBG00001056675.
DR   EnsemblGenomes-Gn; EBG00001056676.
DR   EnsemblGenomes-Gn; EBG00001056677.
DR   EnsemblGenomes-Gn; EBG00001056678.
DR   EnsemblGenomes-Gn; EBG00001056679.
DR   EnsemblGenomes-Gn; EBG00001056680.
DR   EnsemblGenomes-Gn; EBG00001056681.
DR   EnsemblGenomes-Gn; EBG00001056682.
DR   EnsemblGenomes-Gn; EBG00001056683.
DR   EnsemblGenomes-Gn; EBG00001056684.
DR   EnsemblGenomes-Gn; EBG00001056685.
DR   EnsemblGenomes-Gn; EBG00001056686.
DR   EnsemblGenomes-Gn; EBG00001056687.
DR   EnsemblGenomes-Gn; EBG00001056688.
DR   EnsemblGenomes-Gn; EBG00001056689.
DR   EnsemblGenomes-Gn; EBG00001056690.
DR   EnsemblGenomes-Gn; EBG00001056691.
DR   EnsemblGenomes-Gn; EBG00001056692.
DR   EnsemblGenomes-Gn; EBG00001056693.
DR   EnsemblGenomes-Gn; EBG00001056694.
DR   EnsemblGenomes-Gn; EBG00001056695.
DR   EnsemblGenomes-Gn; EBG00001056696.
DR   EnsemblGenomes-Gn; EBG00001056698.
DR   EnsemblGenomes-Gn; EBG00001056699.
DR   EnsemblGenomes-Gn; EBG00001056702.
DR   EnsemblGenomes-Gn; EBG00001056703.
DR   EnsemblGenomes-Gn; EBG00001056706.
DR   EnsemblGenomes-Gn; EBG00001056708.
DR   EnsemblGenomes-Gn; EBG00001056710.
DR   EnsemblGenomes-Gn; EBG00001056712.
DR   EnsemblGenomes-Gn; EBG00001056714.
DR   EnsemblGenomes-Gn; EBG00001056716.
DR   EnsemblGenomes-Gn; EBG00001056720.
DR   EnsemblGenomes-Gn; EBG00001056722.
DR   EnsemblGenomes-Gn; EBG00001056723.
DR   EnsemblGenomes-Gn; EBG00001056725.
DR   EnsemblGenomes-Gn; EBG00001056727.
DR   EnsemblGenomes-Gn; EBG00001056729.
DR   EnsemblGenomes-Gn; EBG00001056731.
DR   EnsemblGenomes-Gn; EBG00001056732.
DR   EnsemblGenomes-Gn; EBG00001056734.
DR   EnsemblGenomes-Gn; EBG00001056736.
DR   EnsemblGenomes-Gn; EBG00001056738.
DR   EnsemblGenomes-Gn; EBG00001056740.
DR   EnsemblGenomes-Gn; EBG00001056742.
DR   EnsemblGenomes-Gn; EBG00001056744.
DR   EnsemblGenomes-Gn; EBG00001056746.
DR   EnsemblGenomes-Gn; EBG00001056748.
DR   EnsemblGenomes-Gn; EBG00001056750.
DR   EnsemblGenomes-Gn; EBG00001056753.
DR   EnsemblGenomes-Gn; EBG00001056755.
DR   EnsemblGenomes-Gn; EBG00001056756.
DR   EnsemblGenomes-Gn; EBG00001056758.
DR   EnsemblGenomes-Gn; EBG00001056760.
DR   EnsemblGenomes-Gn; EBG00001056762.
DR   EnsemblGenomes-Gn; EBG00001056764.
DR   EnsemblGenomes-Gn; EBG00001056766.
DR   EnsemblGenomes-Gn; EBG00001056768.
DR   EnsemblGenomes-Gn; EBG00001056770.
DR   EnsemblGenomes-Gn; EBG00001056772.
DR   EnsemblGenomes-Gn; EBG00001056774.
DR   EnsemblGenomes-Gn; EBG00001056776.
DR   EnsemblGenomes-Gn; EBG00001056778.
DR   EnsemblGenomes-Gn; EBG00001056780.
DR   EnsemblGenomes-Gn; EBG00001056783.
DR   EnsemblGenomes-Gn; EBG00001056785.
DR   EnsemblGenomes-Gn; EBG00001056787.
DR   EnsemblGenomes-Gn; EBG00001056790.
DR   EnsemblGenomes-Gn; EBG00001056792.
DR   EnsemblGenomes-Gn; EBG00001056793.
DR   EnsemblGenomes-Gn; EBG00001056795.
DR   EnsemblGenomes-Gn; EBG00001056797.
DR   EnsemblGenomes-Gn; EBG00001056799.
DR   EnsemblGenomes-Gn; EBG00001056800.
DR   EnsemblGenomes-Gn; EBG00001056802.
DR   EnsemblGenomes-Gn; EBG00001056804.
DR   EnsemblGenomes-Gn; EBG00001056806.
DR   EnsemblGenomes-Gn; EBG00001056808.
DR   EnsemblGenomes-Gn; IL_SC0001.
DR   EnsemblGenomes-Gn; rRNA_16S_1.
DR   EnsemblGenomes-Gn; rRNA_16S_2.
DR   EnsemblGenomes-Gn; rRNA_16S_3.
DR   EnsemblGenomes-Gn; rRNA_16S_4.
DR   EnsemblGenomes-Gn; rRNA_23S_1.
DR   EnsemblGenomes-Gn; rRNA_23S_2.
DR   EnsemblGenomes-Gn; rRNA_23S_3.
DR   EnsemblGenomes-Gn; rRNA_23S_4.
DR   EnsemblGenomes-Gn; rRNA_5S_1.
DR   EnsemblGenomes-Gn; rRNA_5S_2.
DR   EnsemblGenomes-Gn; rRNA_5S_3.
DR   EnsemblGenomes-Gn; rRNA_5S_4.
DR   EnsemblGenomes-Gn; tRNA_Ala_1.
DR   EnsemblGenomes-Gn; tRNA_Ala_2.
DR   EnsemblGenomes-Gn; tRNA_Ala_3.
DR   EnsemblGenomes-Gn; tRNA_Ala_4.
DR   EnsemblGenomes-Gn; tRNA_Ala_5.
DR   EnsemblGenomes-Gn; tRNA_Arg_1.
DR   EnsemblGenomes-Gn; tRNA_Arg_2.
DR   EnsemblGenomes-Gn; tRNA_Arg_3.
DR   EnsemblGenomes-Gn; tRNA_Arg_4.
DR   EnsemblGenomes-Gn; tRNA_Arg_5.
DR   EnsemblGenomes-Gn; tRNA_Asn_1.
DR   EnsemblGenomes-Gn; tRNA_Asn_2.
DR   EnsemblGenomes-Gn; tRNA_Asp_1.
DR   EnsemblGenomes-Gn; tRNA_Asp_2.
DR   EnsemblGenomes-Gn; tRNA_Cys_1.
DR   EnsemblGenomes-Gn; tRNA_Gln_1.
DR   EnsemblGenomes-Gn; tRNA_Gln_2.
DR   EnsemblGenomes-Gn; tRNA_Glu_1.
DR   EnsemblGenomes-Gn; tRNA_Glu_2.
DR   EnsemblGenomes-Gn; tRNA_Glu_3.
DR   EnsemblGenomes-Gn; tRNA_Gly_1.
DR   EnsemblGenomes-Gn; tRNA_Gly_2.
DR   EnsemblGenomes-Gn; tRNA_Gly_3.
DR   EnsemblGenomes-Gn; tRNA_Gly_4.
DR   EnsemblGenomes-Gn; tRNA_His_1.
DR   EnsemblGenomes-Gn; tRNA_Ile_1.
DR   EnsemblGenomes-Gn; tRNA_Ile_2.
DR   EnsemblGenomes-Gn; tRNA_Ile_3.
DR   EnsemblGenomes-Gn; tRNA_Ile_4.
DR   EnsemblGenomes-Gn; tRNA_Leu_1.
DR   EnsemblGenomes-Gn; tRNA_Leu_2.
DR   EnsemblGenomes-Gn; tRNA_Leu_3.
DR   EnsemblGenomes-Gn; tRNA_Leu_4.
DR   EnsemblGenomes-Gn; tRNA_Leu_5.
DR   EnsemblGenomes-Gn; tRNA_Lys_1.
DR   EnsemblGenomes-Gn; tRNA_Lys_2.
DR   EnsemblGenomes-Gn; tRNA_Met_1.
DR   EnsemblGenomes-Gn; tRNA_Met_2.
DR   EnsemblGenomes-Gn; tRNA_Met_3.
DR   EnsemblGenomes-Gn; tRNA_Met_4.
DR   EnsemblGenomes-Gn; tRNA_Phe_1.
DR   EnsemblGenomes-Gn; tRNA_Pro_1.
DR   EnsemblGenomes-Gn; tRNA_Pro_2.
DR   EnsemblGenomes-Gn; tRNA_Pro_3.
DR   EnsemblGenomes-Gn; tRNA_Ser_1.
DR   EnsemblGenomes-Gn; tRNA_Ser_2.
DR   EnsemblGenomes-Gn; tRNA_Ser_3.
DR   EnsemblGenomes-Gn; tRNA_Thr_1.
DR   EnsemblGenomes-Gn; tRNA_Thr_2.
DR   EnsemblGenomes-Gn; tRNA_Trp_1.
DR   EnsemblGenomes-Gn; tRNA_Trp_2.
DR   EnsemblGenomes-Gn; tRNA_Tyr_1.
DR   EnsemblGenomes-Gn; tRNA_Tyr_2.
DR   EnsemblGenomes-Gn; tRNA_Val_1.
DR   EnsemblGenomes-Gn; tRNA_Val_2.
DR   EnsemblGenomes-Gn; tRNA_Val_3.
DR   EnsemblGenomes-Tr; EBT00001659739.
DR   EnsemblGenomes-Tr; EBT00001659740.
DR   EnsemblGenomes-Tr; EBT00001659741.
DR   EnsemblGenomes-Tr; EBT00001659742.
DR   EnsemblGenomes-Tr; EBT00001659743.
DR   EnsemblGenomes-Tr; EBT00001659744.
DR   EnsemblGenomes-Tr; EBT00001659745.
DR   EnsemblGenomes-Tr; EBT00001659746.
DR   EnsemblGenomes-Tr; EBT00001659747.
DR   EnsemblGenomes-Tr; EBT00001659748.
DR   EnsemblGenomes-Tr; EBT00001659749.
DR   EnsemblGenomes-Tr; EBT00001659750.
DR   EnsemblGenomes-Tr; EBT00001659751.
DR   EnsemblGenomes-Tr; EBT00001659752.
DR   EnsemblGenomes-Tr; EBT00001659753.
DR   EnsemblGenomes-Tr; EBT00001659754.
DR   EnsemblGenomes-Tr; EBT00001659755.
DR   EnsemblGenomes-Tr; EBT00001659756.
DR   EnsemblGenomes-Tr; EBT00001659757.
DR   EnsemblGenomes-Tr; EBT00001659758.
DR   EnsemblGenomes-Tr; EBT00001659759.
DR   EnsemblGenomes-Tr; EBT00001659760.
DR   EnsemblGenomes-Tr; EBT00001659761.
DR   EnsemblGenomes-Tr; EBT00001659762.
DR   EnsemblGenomes-Tr; EBT00001659763.
DR   EnsemblGenomes-Tr; EBT00001659764.
DR   EnsemblGenomes-Tr; EBT00001659765.
DR   EnsemblGenomes-Tr; EBT00001659766.
DR   EnsemblGenomes-Tr; EBT00001659767.
DR   EnsemblGenomes-Tr; EBT00001659768.
DR   EnsemblGenomes-Tr; EBT00001659769.
DR   EnsemblGenomes-Tr; EBT00001659770.
DR   EnsemblGenomes-Tr; EBT00001659771.
DR   EnsemblGenomes-Tr; EBT00001659772.
DR   EnsemblGenomes-Tr; EBT00001659773.
DR   EnsemblGenomes-Tr; EBT00001659774.
DR   EnsemblGenomes-Tr; EBT00001659775.
DR   EnsemblGenomes-Tr; EBT00001659776.
DR   EnsemblGenomes-Tr; EBT00001659777.
DR   EnsemblGenomes-Tr; EBT00001659778.
DR   EnsemblGenomes-Tr; EBT00001659779.
DR   EnsemblGenomes-Tr; EBT00001659780.
DR   EnsemblGenomes-Tr; EBT00001659781.
DR   EnsemblGenomes-Tr; EBT00001659782.
DR   EnsemblGenomes-Tr; EBT00001659783.
DR   EnsemblGenomes-Tr; EBT00001659784.
DR   EnsemblGenomes-Tr; EBT00001659785.
DR   EnsemblGenomes-Tr; EBT00001659786.
DR   EnsemblGenomes-Tr; EBT00001659787.
DR   EnsemblGenomes-Tr; EBT00001659788.
DR   EnsemblGenomes-Tr; EBT00001659789.
DR   EnsemblGenomes-Tr; EBT00001659790.
DR   EnsemblGenomes-Tr; EBT00001659791.
DR   EnsemblGenomes-Tr; EBT00001659792.
DR   EnsemblGenomes-Tr; EBT00001659793.
DR   EnsemblGenomes-Tr; EBT00001659794.
DR   EnsemblGenomes-Tr; EBT00001659795.
DR   EnsemblGenomes-Tr; EBT00001659796.
DR   EnsemblGenomes-Tr; EBT00001659797.
DR   EnsemblGenomes-Tr; EBT00001659798.
DR   EnsemblGenomes-Tr; EBT00001659799.
DR   EnsemblGenomes-Tr; EBT00001659800.
DR   EnsemblGenomes-Tr; EBT00001659801.
DR   EnsemblGenomes-Tr; EBT00001659802.
DR   EnsemblGenomes-Tr; EBT00001659803.
DR   EnsemblGenomes-Tr; EBT00001659804.
DR   EnsemblGenomes-Tr; EBT00001659805.
DR   EnsemblGenomes-Tr; EBT00001659806.
DR   EnsemblGenomes-Tr; EBT00001659807.
DR   EnsemblGenomes-Tr; EBT00001659808.
DR   EnsemblGenomes-Tr; EBT00001659809.
DR   EnsemblGenomes-Tr; EBT00001659810.
DR   EnsemblGenomes-Tr; EBT00001659811.
DR   EnsemblGenomes-Tr; EBT00001659812.
DR   EnsemblGenomes-Tr; EBT00001659813.
DR   EnsemblGenomes-Tr; EBT00001659814.
DR   EnsemblGenomes-Tr; EBT00001659815.
DR   EnsemblGenomes-Tr; EBT00001659816.
DR   EnsemblGenomes-Tr; EBT00001659817.
DR   EnsemblGenomes-Tr; EBT00001659818.
DR   EnsemblGenomes-Tr; EBT00001659819.
DR   EnsemblGenomes-Tr; EBT00001659820.
DR   EnsemblGenomes-Tr; EBT00001659821.
DR   EnsemblGenomes-Tr; EBT00001659822.
DR   EnsemblGenomes-Tr; IL_SC0001-1.
DR   EnsemblGenomes-Tr; rRNA_16S_1-1.
DR   EnsemblGenomes-Tr; rRNA_16S_2-1.
DR   EnsemblGenomes-Tr; rRNA_16S_3-1.
DR   EnsemblGenomes-Tr; rRNA_16S_4-1.
DR   EnsemblGenomes-Tr; rRNA_23S_1-1.
DR   EnsemblGenomes-Tr; rRNA_23S_2-1.
DR   EnsemblGenomes-Tr; rRNA_23S_3-1.
DR   EnsemblGenomes-Tr; rRNA_23S_4-1.
DR   EnsemblGenomes-Tr; rRNA_5S_1-1.
DR   EnsemblGenomes-Tr; rRNA_5S_2-1.
DR   EnsemblGenomes-Tr; rRNA_5S_3-1.
DR   EnsemblGenomes-Tr; rRNA_5S_4-1.
DR   EnsemblGenomes-Tr; tRNA_Ala_1-1.
DR   EnsemblGenomes-Tr; tRNA_Ala_2-1.
DR   EnsemblGenomes-Tr; tRNA_Ala_3-1.
DR   EnsemblGenomes-Tr; tRNA_Ala_4-1.
DR   EnsemblGenomes-Tr; tRNA_Ala_5-1.
DR   EnsemblGenomes-Tr; tRNA_Arg_1-1.
DR   EnsemblGenomes-Tr; tRNA_Arg_2-1.
DR   EnsemblGenomes-Tr; tRNA_Arg_3-1.
DR   EnsemblGenomes-Tr; tRNA_Arg_4-1.
DR   EnsemblGenomes-Tr; tRNA_Arg_5-1.
DR   EnsemblGenomes-Tr; tRNA_Asn_1-1.
DR   EnsemblGenomes-Tr; tRNA_Asn_2-1.
DR   EnsemblGenomes-Tr; tRNA_Asp_1-1.
DR   EnsemblGenomes-Tr; tRNA_Asp_2-1.
DR   EnsemblGenomes-Tr; tRNA_Cys_1-1.
DR   EnsemblGenomes-Tr; tRNA_Gln_1-1.
DR   EnsemblGenomes-Tr; tRNA_Gln_2-1.
DR   EnsemblGenomes-Tr; tRNA_Glu_1-1.
DR   EnsemblGenomes-Tr; tRNA_Glu_2-1.
DR   EnsemblGenomes-Tr; tRNA_Glu_3-1.
DR   EnsemblGenomes-Tr; tRNA_Gly_1-1.
DR   EnsemblGenomes-Tr; tRNA_Gly_2-1.
DR   EnsemblGenomes-Tr; tRNA_Gly_3-1.
DR   EnsemblGenomes-Tr; tRNA_Gly_4-1.
DR   EnsemblGenomes-Tr; tRNA_His_1-1.
DR   EnsemblGenomes-Tr; tRNA_Ile_1-1.
DR   EnsemblGenomes-Tr; tRNA_Ile_2-1.
DR   EnsemblGenomes-Tr; tRNA_Ile_3-1.
DR   EnsemblGenomes-Tr; tRNA_Ile_4-1.
DR   EnsemblGenomes-Tr; tRNA_Leu_1-1.
DR   EnsemblGenomes-Tr; tRNA_Leu_2-1.
DR   EnsemblGenomes-Tr; tRNA_Leu_3-1.
DR   EnsemblGenomes-Tr; tRNA_Leu_4-1.
DR   EnsemblGenomes-Tr; tRNA_Leu_5-1.
DR   EnsemblGenomes-Tr; tRNA_Lys_1-1.
DR   EnsemblGenomes-Tr; tRNA_Lys_2-1.
DR   EnsemblGenomes-Tr; tRNA_Met_1-1.
DR   EnsemblGenomes-Tr; tRNA_Met_2-1.
DR   EnsemblGenomes-Tr; tRNA_Met_3-1.
DR   EnsemblGenomes-Tr; tRNA_Met_4-1.
DR   EnsemblGenomes-Tr; tRNA_Phe_1-1.
DR   EnsemblGenomes-Tr; tRNA_Pro_1-1.
DR   EnsemblGenomes-Tr; tRNA_Pro_2-1.
DR   EnsemblGenomes-Tr; tRNA_Pro_3-1.
DR   EnsemblGenomes-Tr; tRNA_Ser_1-1.
DR   EnsemblGenomes-Tr; tRNA_Ser_2-1.
DR   EnsemblGenomes-Tr; tRNA_Ser_3-1.
DR   EnsemblGenomes-Tr; tRNA_Thr_1-1.
DR   EnsemblGenomes-Tr; tRNA_Thr_2-1.
DR   EnsemblGenomes-Tr; tRNA_Trp_1-1.
DR   EnsemblGenomes-Tr; tRNA_Trp_2-1.
DR   EnsemblGenomes-Tr; tRNA_Tyr_1-1.
DR   EnsemblGenomes-Tr; tRNA_Tyr_2-1.
DR   EnsemblGenomes-Tr; tRNA_Val_1-1.
DR   EnsemblGenomes-Tr; tRNA_Val_2-1.
DR   EnsemblGenomes-Tr; tRNA_Val_3-1.
DR   EuropePMC; PMC1855776; 17194796.
DR   EuropePMC; PMC539801; 15596722.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; AE017340.
DR   SILVA-SSU; AE017340.
DR   StrainInfo; 371300; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2839318
FT                   /organism="Idiomarina loihiensis L2TR"
FT                   /strain="L2TR"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:283942"
FT   gene            362..1726
FT                   /gene="dnaA"
FT                   /locus_tag="IL0001"
FT   CDS_pept        362..1726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="IL0001"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80845"
FT                   /db_xref="GOA:Q5QY39"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QY39"
FT                   /protein_id="AAV80845.1"
FT                   /translation="MNNSLWQQCAERLQSELPLQQFNTWIRPLQAKLNGETLTLFAPNI
FT                   YSVDWVRDKYLKTINTYLEALCDDKVPNVVLKVGEASPTQRDSGSPQRAAATRRKTPNF
FT                   SSGNTDVEVPFESNIHPEYTFDNFVEGKSNQLARAAAIQVAENPGGVYNPLFVYGGTGL
FT                   GKTHLLHAVGNGIMAHKKDAKVFYIRAERFVQDMVNSIRNSSTNEFKRYYRSVDALLID
FT                   DIHFFANKKGSQEEFFHTFNALLEGNQQIIMTSDLYPKEIDGVEDRLKSRFGWGLTIAI
FT                   EPPELETRVAILMRKADERGLHMPHEVAFFIAKRLRSNVRELEGALNRVVANVQLTGRP
FT                   ITIDFVREALRDLIAAQEKLVTIDNIQKTVAEYYNIKLADILSKRRSRSVARPRQLAMA
FT                   LAKELTNHSLPEIGDAFGGRDHTTVLHACRKIQELKDAQHDIKEDYRNLIRTLSS"
FT   gene            1758..2861
FT                   /gene="dnaN"
FT                   /locus_tag="IL0002"
FT   CDS_pept        1758..2861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="IL0002"
FT                   /product="DNA polymerase sliding clamp subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80846"
FT                   /db_xref="GOA:Q5QY38"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QY38"
FT                   /protein_id="AAV80846.1"
FT                   /translation="MKFSINRDAFLKPLQVVSGAVERRHTLPILSNLLLQVDNGQLKLT
FT                   GTDLEVELVSAVPLESADMDAAVTVPAKKLLDIVRSLPEGSTIEFTSQEDSATVKSGRS
FT                   KFKLSTLSSDDFPNIDDWKSDIHLVTEQAVLKDLMLKTHFSMANQDVRYYLNGMLFETD
FT                   NGMLRSVATDGHRLAMSTCAIDQPGLAQRQVIVPRKGVVELLRLLGDDDQEVSVSIGNN
FT                   HIRVETPELVFTSKLVDGRFPDYRRVLPSGGDKVIVAHRDALRQSFGRASILSNEKFRG
FT                   VRLNLSSGELCITATNPEQEQAEEVIEVDYQGDDLEIGFNVSYLLDVLNNIDDEQVSFT
FT                   LSDSNSSALIEPQHDESCCYVIMPMRL"
FT   gene            2874..3938
FT                   /gene="recF"
FT                   /locus_tag="IL0003"
FT   CDS_pept        2874..3938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="IL0003"
FT                   /product="Recombinational DNA repair ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80847"
FT                   /db_xref="GOA:Q5QY37"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QY37"
FT                   /protein_id="AAV80847.1"
FT                   /translation="MFIETLNLSHFRNFSEVALSPSPKINIITGDNGSGKTSLLEAIYL
FT                   LGFGRSFRPGGFRQLIKEGNSGFTVFCRSQDYAIGVRRSTDGEQSLRLNGANVQRMSDV
FT                   ARLVPVQLLTPESVDILLEGPGQRRQFIDWGVFHVEHSFYSDWVAYTQLLKQRNSLLKQ
FT                   RSLPVREDRYWKEQLAYYGERISKSREKYLEELNDYIQELAKSFLSDVTMEVRLKSGWD
FT                   TSQSLFDALESHTEKDKKYGFTSVGAHKADIKVIADGVEVKHRLSRGQLKTAITALKLA
FT                   QGKHYQKIKRQPCIYLVDDLTSELDSKNQALLCRELENLDAQVFITAITGKQLSDKFQK
FT                   SPRMFHVEHGVINE"
FT   gene            3954..6371
FT                   /gene="gyrB"
FT                   /locus_tag="IL0004"
FT   CDS_pept        3954..6371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="IL0004"
FT                   /product="DNA gyrase subunit B"
FT                   /note="type II topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80848"
FT                   /db_xref="GOA:Q5QY36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QY36"
FT                   /protein_id="AAV80848.1"
FT                   /translation="MEENNYGSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSEIMVTIHSDGSVSVKDDGRGIPVDIHEEEGVSAAQVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGISVVNALSEKLQLTIRRQGQVYEQTYHMGEPDSDVKPVGDTDT
FT                   TGTELRFWPSHETFTDTEFHYDILAKRLRELSFLNSGVGIRLRDERDDREDLFKYEGGI
FT                   AAFVNYLNKNKTPIHEKAFYFTTQREDGIGVEVSMQWNDSFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAALTRTLNSHMEKEGYNKKSKTSATGDDAREGLTAIISVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVEQAMNEQLADYLLENPGEAKLIINKIIDAARAREAARKAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSVEVGTLITAMGCGIGRDEYNPDKTRYHRIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPEIIERGYIYIAQPPLYKVKKGKQEVYIKDDPALIRYLTSLALDNASLHVNETAPGI
FT                   SGEKLENLVNGYQMAQENIKRLSRRMPERFLQRLFYAPRLTDERLKDKDYMEKWVKTLN
FT                   DDLTAREINSATYTVSLHEDTERKMWLPSTTIRQHGVDTDYPLNYEFLMSKDYEQIVTL
FT                   GEEIDSLVEPDGYVLRGEKKQPVTHFVEAVEWLIGESKRGLYVQRYKGLGEMNPDQLWE
FT                   TTMDPDTRRMLQVTIEDAIGADQLFTTLMGDEVEPRRAFIESNALKVANLDV"
FT   gene            complement(6465..8531)
FT                   /gene="glyS"
FT                   /locus_tag="IL0005"
FT   CDS_pept        complement(6465..8531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="IL0005"
FT                   /product="Glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80849"
FT                   /db_xref="GOA:Q5QY35"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QY35"
FT                   /protein_id="AAV80849.1"
FT                   /translation="MQKENLLIELGTEELPPKALKSLRDSLKSGIESGLKNAELSFDSI
FT                   EAYATPRRLAVLVKQVETEQQDKEVEKRGPAINVAFDDTGKPTKAAEGWARSNGITVEQ
FT                   ADRLKTDKGEWLLHKATVKGQALSVLVQGILEAAIKALPIPKPMRWGDSTAQFIRPVHT
FT                   LTVMLGSELIDAEILETKSARFIQGHRFHSPQGFELDHVDNYLFKLREAKVIANFEERI
FT                   ETIQSEVSRLASELGGQVIQDDELVEEVAALVEWPVALTASFDQGFLAVPKEPLIVTMK
FT                   DDQRYFPVEDGKGNLLPQFIFITNIESRDPQQIIKGNEKVVRPRLADAQFFFESDKKVT
FT                   LESRVAALDSVLFQKQLGSIGDKARRISVLAGKIANQLTADVKASERAGLLCKADLVSD
FT                   MVSEFPETQGVMGKHYALNDGESPVVAEAIEQHYWPRFSGDELPLTKEACAVALADKLD
FT                   TLVGIFGIGQVPKGDRDPFALRRAALGLLRTLVERKLSLDLHELLAASVEGFGDKLSNN
FT                   TVATDVFDFLLGRFRPWYQDQGITVDVIQSVLARSPSKPTDFDQRVKAVQSFKSMDSAA
FT                   SLAAANKRVGNILAKSDEEISGNVDEALLQEESETTLYRLVKQTEGAVKPLIAAGKYSD
FT                   ALTHLSELKEPVDAFFEHVMVNADDDKVRINRLNLLFRLRQLFLEIADISLLQ"
FT   gene            complement(8544..9470)
FT                   /gene="glyQ"
FT                   /locus_tag="IL0006"
FT   CDS_pept        complement(8544..9470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="IL0006"
FT                   /product="Glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80850"
FT                   /db_xref="GOA:Q5QXI2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI2"
FT                   /protein_id="AAV80850.1"
FT                   /translation="MRMSTYDVKTFQGLILALQDYWAQQGCAVVQPLDMEVGAGTFHPM
FT                   TFLRSLGPEPASFAYVQPCRRPTDGRYGENPNRLQHYYQFQVIMKPSPKDIQELYLGSL
FT                   EMLGFDTLTHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIECRPVAG
FT                   EITYGLERLAMYIQGVDSIYDLVWTDGPRGKILYRDVFHQNEVEQSTYNFEYADVDVLF
FT                   RRFDDCEKECELLIEKSLALPAYEQVMRASHAFNLLDARHAISVTERQRYILRVRTMAK
FT                   AVAEVYYQTREALGFPLADDKNKPAAN"
FT   gene            9558..10157
FT                   /gene="tag"
FT                   /locus_tag="IL0007"
FT   CDS_pept        9558..10157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="IL0007"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80851"
FT                   /db_xref="GOA:Q5QXI1"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI1"
FT                   /protein_id="AAV80851.1"
FT                   /translation="MTNNQPERCSWCESADDYRAYHDNVWGRPVSDPIELFAKLCLDGQ
FT                   QAGLSWLTILRKQSGYEKAFLGFDPQAIVAMSDADRELLYSNRDIIRSKAKIDAIFTNA
FT                   EAYIRLEEKGVKFERWLWEFVGGSPIINAYSTQSEIPTETEASQSMAKALKKEGFKFVG
FT                   PTICYAFMEAVGMVNDHVTSCHCYQPVADQMKQFTL"
FT   gene            10174..10665
FT                   /locus_tag="IL0008"
FT   CDS_pept        10174..10665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0008"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80852"
FT                   /db_xref="GOA:Q5QXI0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI0"
FT                   /protein_id="AAV80852.1"
FT                   /translation="MIEITLADYSNPKHRNAVIAMLDAYAKDPMGGGEGISDDVKESLI
FT                   DEMAKRDHVFSLLAYDGDTPIGVANCVEGFSTFAAKPLMNIHDIAVIPEYRGQGVARKL
FT                   LEEVKTLAEFRGCVKLTLEVLENNDRAKKAYENFGFAPYELGDVGQAEFWEMYLNKDKA
FT                   "
FT   gene            complement(10684..10923)
FT                   /gene="sirA"
FT                   /locus_tag="IL0009"
FT   CDS_pept        complement(10684..10923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="IL0009"
FT                   /product="Predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80853"
FT                   /db_xref="GOA:Q5QXH9"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXH9"
FT                   /protein_id="AAV80853.1"
FT                   /translation="MTQINCDKELDTLGLKCPEPVMLVRAAIRKMDVGQVLLIIADDPA
FT                   TTRDIPGFCEFMEHELVGSETEEIPYRYWVRKSH"
FT   gene            complement(11193..12356)
FT                   /gene="fadA"
FT                   /locus_tag="IL0010"
FT   CDS_pept        complement(11193..12356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="IL0010"
FT                   /product="Acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80854"
FT                   /db_xref="GOA:Q5QXH8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXH8"
FT                   /protein_id="AAV80854.1"
FT                   /translation="MKDIVIVDCIRTPMGRSKNGVFRHTRAEDLSAALMKGLLERNPEV
FT                   DPEELEDIYWGCVQQTLEQGFNIARNSALIAGIPHKVAGVTVNRLCGSSMQALHDATRA
FT                   IMNGDGDIFMAGGVEHMGHVPMTHGIDFHPGMNKSVAKASGSMGMTAELLSRKFGITRE
FT                   QQDEFGARSHRKAHEATVEGRFAKEIYAMNGHNADGELVRVTEDEVIRPETTAEGLSQL
FT                   RPVFDPANGTVTAGTSSALSDGAAAMLVMSADKAKELGLTPRVKIRSMAVAGCDPSIMG
FT                   YGPVPATEKALKRAGVSIDDIDVVELNEAFAAQSLPVLKGLKLFDKMEEKVNLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEEKDAKLGLATMCIGLGQGIATVFERV"
FT   gene            complement(12377..14533)
FT                   /gene="fadB"
FT                   /locus_tag="IL0011"
FT   CDS_pept        complement(12377..14533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="IL0011"
FT                   /product="Fatty acid oxidation complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80855"
FT                   /db_xref="GOA:Q5QXH7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXH7"
FT                   /protein_id="AAV80855.1"
FT                   /translation="MIYQGESIRVDFIEPGFAELQFDAKGSVNKFDQATLEEFSEALTK
FT                   LQNTDDLRGVIVTSSKSTFIVGADITEFLTLFSDQEKTRSWVAKASRVFDQLEDLPVPT
FT                   VGAVTGFALGGGCEALLACDYRVADTTATIGLPEVKLGLIPGFGGTMRLPRVIGPDNAL
FT                   EWITTGKNNKALDALKVGAVDAVVEPENLTKAALNLAKAAAAGQQDWKAKRQPKLEPLK
FT                   ANDTELMMTLVTAKGMIAAKAGKHYPAPHKALEAIENGAREHREGALTAENNAFFDLTQ
FT                   TEACQAQVGIFLADQAVKGKSKKYAKAATKEIKTAGVLGAGIMGGGIAYQSALKGVPAV
FT                   MKDIKQDALDLGMKEAGKILKKGVERGKVNNEKMIKILSSITPTLLNDAVKDVDIVVEA
FT                   VVENPKVKGSVLAEIEGVIGDDAILTSNTSTISITELAKNLKRPEKFCGMHFFNPVHKM
FT                   PLVEIIRGEKTSDDTVNAVVAYALKLGKTPIVVNDCPGFLVNRVLFPYLAGFAGMVDEG
FT                   VDFVGIDKVMEKQFGWPMGPAYLSDVVGIDTADHCTVVMEAGFPTRMKRDESSAIAKLA
FT                   AAERYGQKNGKGFYVYGTDKKGKPTKEADPATYELLGCEQGKKLDADEVIARCMIPMVN
FT                   EVVRCLEEDIVGSAAEADMALLYGLGFPPFRGGPFRYLETLGMDNFIQLADKYAHLGEI
FT                   YQVTDGMREMAKAGKSYFDTTSAK"
FT   gene            14669..16618
FT                   /gene="slt"
FT                   /locus_tag="IL0012"
FT   CDS_pept        14669..16618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="IL0012"
FT                   /product="Soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80856"
FT                   /db_xref="GOA:Q5QXH6"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH6"
FT                   /protein_id="AAV80856.1"
FT                   /translation="MKKQSFIIRYSAPLFFVLSLLSIGAVQSEPVDAKQREQQRELFKK
FT                   AEYAAKRGRLGEYRLLLKKLKDYPLLPYLELARLEQIGYLANEDRVLAFLDKYEKTPLD
FT                   WQLRQPWLTYLAGQEEYSRFIRDFRYPGTLTHRCQFIESQREKGLDDGPFRRQVDAIWK
FT                   HGFSLPSACDPILDEWQELGGRTEDKVWERLELAAEHGNPTLLPYLTGLLPELQQYLGE
FT                   FYHKVRYSPAAIEDDSWYKGRYPGKEAQIVTYALTKLVWRDENIALRSYKKLSSQLPFT
FT                   EQQEGRIAEEFAVALSLNSHPEARVWHDRVPVNALNERVLQWRLAIYLKDKDYEGLRDA
FT                   IQSLPVAIRQGNQWRYWLARSQEITGNALAAQELYEDLADERHYYGFLAAARLQKPVSL
FT                   EQEKLEVSVVQLEQIRNHPSVQRAYELIQLERWVDARREWNHLLTQLDGEEQKVAAYLA
FT                   SEWGWHDQAIWTLAQIGHFDAVGIRFPLAYKDILGRASQAAGIDESWALAITRRESNFR
FT                   HDAYSSAGARGLMQILPGTAKQLDTKNNSWRRLNDPAVNVRLGTDYLSRLKHRFENNWL
FT                   LATASYNAGYYRVKEWLPDEPVAADVWVETIPYHETRDYVKAVLSYQQIYRMLGGNEDN
FT                   LFEQVVDMTIVDTE"
FT   gene            16630..17988
FT                   /gene="pepQ"
FT                   /locus_tag="IL0013"
FT   CDS_pept        16630..17988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="IL0013"
FT                   /product="Proline aminopeptidase P II"
FT                   /db_xref="EnsemblGenomes-Gn:IL0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80857"
FT                   /db_xref="GOA:Q5QXH5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXH5"
FT                   /protein_id="AAV80857.1"
FT                   /translation="MTATADLWPLFPDHIKQLQTRAERLFKRENLDLVAIHSGQQKRWF
FT                   LDDMNYPFRANPHFKAWCPETQLANAWVILKPNTRPTLVLLSSPDFWHTTASLEGAPWL
FT                   EEFHVEHISSPEAIEKLLPYDKKSAAYLGEHIEVAKALGFENINPDPVLHFFHYHRLFK
FT                   TDYEIACLTQANHIAAEGHVAAADAFFNGASEFDCLLKYMAATRQGQNEVPYNHIIGQN
FT                   ENASVLHHWMPDKKASGSLKSMLVDAGAEVCGYAADISRTWSKQHNEYEELIAALDQIT
FT                   LALIDKMKPGVEFPALHQLAHEQIANVLFAFGFVSCSPEQMIEDGITTVFLPHGLGHPL
FT                   GLQVHDVGAAQADERGTPIAPPSGHLTLKTTRTVEPRQVYTIEPGIYFIEPLLQKLANS
FT                   RNKHLINWRRVDEFKPFGGVRIEDNIVVYRERNDNLTRQTALDAYVKKVTRLA"
FT   gene            17981..18598
FT                   /locus_tag="IL0014"
FT   CDS_pept        17981..18598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0014"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80858"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI9"
FT                   /protein_id="AAV80858.1"
FT                   /translation="MHDQDYDIPASETEVEIEVKGSRFIACLAHTANVDSASEFLAVIK
FT                   KRWPKASHYCSASLFSAPNNSQSMAYSDDGEPSGTAGRPMLMALQNSGVGEVTAIVVRY
FT                   FGGVKLGTGGLQRAYTDATVAALAELEKEQRVFKQRFQLNFAYTDQGDVEPLLLEANAE
FT                   TESSEYEESVRLKVLLRPVNVGALQKKLQAATRGRVQLKELD"
FT   gene            complement(18595..19971)
FT                   /gene="trkA"
FT                   /locus_tag="IL0015"
FT   CDS_pept        complement(18595..19971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="IL0015"
FT                   /product="K+ transport system, NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80859"
FT                   /db_xref="GOA:Q5QXI8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI8"
FT                   /protein_id="AAV80859.1"
FT                   /translation="MKIIILGVGQVGGTLAENLVGERNDITIVDTNNDLLDDLQDKYDL
FT                   RVVVGNGAHPDVLRRAGADDADLLIAVTSSDETNMIACQVAYSIFNTPKKIARIRSEEY
FT                   IRYKDQLFHNQDAPVDHIISPEQLVTSYIRRLIDYPGALQVMEFANGRASLVAVKAYYG
FT                   GKLVGHAISTLREHIPNIDTRVAAIYRQGKPIRPTGTTIIEADDEVFFIADTRHISTVM
FT                   QELQKLEDKYRRIMIVGGGNIGAGLAKQLEVDHRVKLIERSETRAEELSQSLEHTLIFR
FT                   GDASDQKLLEEEHVEDIDVFIAVTNDDEANIMSAMLAKRMGARKTMVLIQRSAYVDLVQ
FT                   GGEIDIAISPQRATVSALLTHVRRGDIVNVYSLRKGAAEAIEAIAHGDEDTSRVVGKAI
FT                   KDIKLPPGTTIGAVVRGQEVLMAHSETIIHSDDHVILFLLDKKYIDQVEKVFQPSAMFF
FT                   "
FT   gene            complement(19968..21296)
FT                   /gene="sun"
FT                   /locus_tag="IL0016"
FT   CDS_pept        complement(19968..21296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sun"
FT                   /locus_tag="IL0016"
FT                   /product="tRNA and rRNA cytosine-C5-methylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80860"
FT                   /db_xref="GOA:Q5QXI7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI7"
FT                   /protein_id="AAV80860.1"
FT                   /translation="MSRQKNSENGGQGATSRAAAATAIFHVLEKGESLSAALPHATGKL
FT                   SDADKRLASAISYGVLRVLPSLNKLVGAKLDKPLKGKLKVLHYLLLVGAYQLYCLRIKD
FT                   HAAVSATVEAARILGKRNHKGLVNGILRQLLREAPATDESQQRELPVDAMQNHPRWLFE
FT                   AIQADHPQQASDILIENNAHPPMWLRVNRRFFNRDDYLRQLEDSGIAAEGDTLAGDAIR
FT                   LHSPVPVERLPGFDRGHASVQDRSAQLAADYLNVKASHRVLDCCAAPGGKLLHLLERND
FT                   FEQPVQAIDIDAKRLERVDENLERAGLSAVVHCADVAETEDWWDGEQFDRILLDAPCSA
FT                   TGVIRRHPDIKWLRRAEDINELAQLQSQILNSLWPLLKNGGELLYATCSILSKENQTQI
FT                   ESFLKQQSSASLIPIDEKQKTLQLLPGERNGDGFFYARLKKVE"
FT   gene            complement(21293..22243)
FT                   /gene="fmt"
FT                   /locus_tag="IL0017"
FT   CDS_pept        complement(21293..22243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="IL0017"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80861"
FT                   /db_xref="GOA:Q5QXI6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXI6"
FT                   /protein_id="AAV80861.1"
FT                   /translation="MRIVFAGTPDFAAQHLQQLLDESHQVVGVYTQPDRPAGRGKKPQP
FT                   SAVKKLALEHQLPVYQPESLKSEEDQAALADLKPDVMVVVAYGLLLPQAVLDIPTKGCL
FT                   NVHGSLLPRWRGAAPIQRAIWAGDLESGVCIMQMEAGLDTGPVLHEERCAISPDETSAS
FT                   LYHKLESLGPEALTKVLKDLDGYQSQAKPQSDANATYAKKLTKQEGKIDWTQPAAFIER
FT                   CVRAFNPWPMSWCQSEHLKAGQNTVKIHAAELIQGASNKGPGTIINSTHEGIDVVTGDG
FT                   ILRITQAQMPGKKAQPASTLVNGYSNVFSPGLELQ"
FT   gene            complement(22243..22767)
FT                   /gene="def"
FT                   /locus_tag="IL0018"
FT   CDS_pept        complement(22243..22767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="IL0018"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80862"
FT                   /db_xref="GOA:Q5QXI5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXI5"
FT                   /protein_id="AAV80862.1"
FT                   /translation="MAKMTVLQYPDERLRKVAQKIEKVDDNIRSVIDDMFETMYEEQGV
FT                   GLAATQVDVHRRLFVSDCSEDQNEPLVFINPEITEAEGHFKNDEGCLSFPGVYAKVERA
FT                   ERITVTALDKNGERFSRSAEGLLAICIQHEIDHLDGKLFVDYLSPLKRERIRKKLEKEQ
FT                   RLAEKQAAEAQ"
FT   gene            22857..23867
FT                   /gene="smf"
FT                   /locus_tag="IL0019"
FT   CDS_pept        22857..23867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="IL0019"
FT                   /product="Predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake"
FT                   /db_xref="EnsemblGenomes-Gn:IL0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80863"
FT                   /db_xref="GOA:Q5QXI4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXI4"
FT                   /protein_id="AAV80863.1"
FT                   /translation="MGMTRALNKVQKAARECTSWEAIFERWGQSLKPVEARWLNAAENW
FT                   CRSDYQGVISYFSEDYPTALKAIANPPWLLYYRGRKELLQGVSVAIVGSRKATHSGLQI
FT                   ADWFSERLVAAGVVVVSGLAMGIDAQAHKTAADKGKTIAVLGTGIDQYYPRRNKALQDF
FT                   IAHQGLLISEFPPGQTARIDHFPRRNRIISGISQAVVVVEAARKSGSLSTAIHALNEGR
FT                   EVGAVPGSVLLPEHQGCHWLIQQGAKLINTPQDILDWFSVDDTEVAIEGDTECRDESLA
FT                   NNRLFASLSSEPRTIDDMVQLSGLEVAEVMEKVVLLELEGLVAAVPGGYIKVGRR"
FT   gene            23871..24344
FT                   /gene="smg"
FT                   /locus_tag="IL0020"
FT   CDS_pept        23871..24344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="IL0020"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80864"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXI3"
FT                   /protein_id="AAV80864.1"
FT                   /translation="MFDILMYLFENYIHSEMEVVVDHDELTNELTRAGFRHQEIQKALA
FT                   WLERLADLQQMETKSYLDVAPQQSTRIYTAAEMTRLDSQSRGFLMYLENLGVLDFATRE
FT                   VVIDRVMELETPNFTLDDLKWVVLMVLFNVPGQEAAYDQMEGLLFEEAEGPLH"
FT   gene            24344..24856
FT                   /locus_tag="IL0021"
FT   CDS_pept        24344..24856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0021"
FT                   /product="Zn-finger domain associated with topoisomerase
FT                   type I"
FT                   /db_xref="EnsemblGenomes-Gn:IL0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80865"
FT                   /db_xref="GOA:Q5QXJ6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ6"
FT                   /protein_id="AAV80865.1"
FT                   /translation="MSSDERCPRCERPLVIKHVGHNSFLGCTGYPDCDYKRGLREQSEI
FT                   EPEDLGVPCPECGQELQLKSGRYGLFVGCSGFPECEFVTEPNVEEEETIRCPECGKGQL
FT                   HQKTSRRGTVFYACDQYPKCEFTVNQPPVDETCPKCRYPLLVKKKTAAGIRKVCPQKQC
FT                   DYKSDAL"
FT   gene            24884..25444
FT                   /locus_tag="IL0022"
FT   CDS_pept        24884..25444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0022"
FT                   /product="Possible translation factor, Sua5/YciO/YrdC/YwlC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80866"
FT                   /db_xref="GOA:Q5QXJ5"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXJ5"
FT                   /protein_id="AAV80866.1"
FT                   /translation="MADTWEAAHSAIKTGIIAYPTEAVFGLGCDPRNEVAVQKLLSLKQ
FT                   RPAEKGLILIAADYSQLLPYVEDSAIAQDKRFSVLSHWPGPVTLILPVRKGVSTLLTGG
FT                   RDTIAVRVTAHEPARALCRELGHALVSTSANLTGQEPARTAAEVRQQFGDSVDWIMDES
FT                   TGGAANPTRIINPLNNQVFRDDA"
FT   gene            25437..26351
FT                   /gene="hemF"
FT                   /locus_tag="IL0023"
FT   CDS_pept        25437..26351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="IL0023"
FT                   /product="Coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80867"
FT                   /db_xref="GOA:Q5QXJ4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXJ4"
FT                   /protein_id="AAV80867.1"
FT                   /translation="MHNDYLKQVKSYLMSLQDAICQQLAQADGEQSFQEDSWDRPGGGG
FT                   GRSRIMKNGAVFEQGGVGFSHVYGEKMPASATAHRPELEGRDFNACGVSLVMHPENPMV
FT                   PTVHMNVRFFIAQKEGEEPVWWFGGGFDLTPFYPFDQDIIEWHQQAKNALDSVDEKLYP
FT                   EYKAWCDDYFFLKHRDEARGVGGIFFDDLNDRSFDECFSVIKAVGDAFTKAYLPIVERR
FT                   KNLAYTQQQRDFQLYRRGRYVEFNLVWDRGTLFGLQTGGRTESILMSMPPLARWEYNWQ
FT                   AEPGSAEEQLTEYYLKPRDWLSV"
FT   gene            26348..27187
FT                   /gene="aroE"
FT                   /locus_tag="IL0024"
FT   CDS_pept        26348..27187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="IL0024"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80868"
FT                   /db_xref="GOA:Q5QXJ3"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXJ3"
FT                   /protein_id="AAV80868.1"
FT                   /translation="MKSVTSLGVFGNPIAHSLSPRIHALFAQTRQDSINYQRYLSTPGH
FT                   FPRRVAEFFRHGGQGANVTLPFKQQAASLVTKLSDRARLAGAVNTLIPYGNGLLLGDNT
FT                   DGEGLIIDLKNKGLNVSERSLAVFGAGGSARGIIPLLLEQKPRCLYLVNRTAKKAEMLK
FT                   SQLETLGLVAANRIQVRSSASEIDEPIDLLINATSSSLNGQRLTLPPLLSENASGYDLM
FT                   YADQPTVFMEQLTQAGCKNVSDGFGMLIEQAASSYQLWMGDERPDTAFVMAEMRTPS"
FT   gene            27587..30352
FT                   /gene="polA"
FT                   /locus_tag="IL0025"
FT   CDS_pept        27587..30352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="IL0025"
FT                   /product="DNA polymerase I"
FT                   /note="3' --> 5' polymerase, 5' --> 3' and 3' --> 5'
FT                   exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80869"
FT                   /db_xref="GOA:Q5QXJ2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ2"
FT                   /protein_id="AAV80869.1"
FT                   /translation="MATSVPENPFILVDGSSYLFRAFHAPPHLTNSKGEPTGAIYGVVN
FT                   MLRSLLKRYKPSHMAVVFDAKGKTFRSDIYQDYKANRPPMPDDLRSQIKPLHDIVQAMG
FT                   LPLLCIDDVEADDVIGTLARQAGDKGRFTLISTGDKDMAQLVNEHVMLINTMTDTLMDP
FT                   EGVEKKFGVKPNQIIDYLALMGDSSDNIPGLPKVGEKTAQALLQSIPSIDAIYENVDAV
FT                   TELSFRGAKSMPAKLNEYKEQLLMSRELATIKLDVAMDLQPEELKIQTADSEKLQELYS
FT                   RCEFRRWLDELMETGAATNQVLGETDGEKPTSDINRDAYGVLMTEKEVSDYITQLNKFD
FT                   YFAFDTETTSLNYMEAELVGVSLAMAPGEAVYIPVGHDYMEAPDQVGRDWLLEQLKPLL
FT                   EAEKPQKVGQNLKYDSHILRRYKIRLAGILNDTMLASYVFNSVGSRHDMDTLSLHYLNH
FT                   KTISFEDIAGKGAKQLTFNQIALEQAGPYAAEDADITYRLHDVLWNKVKETGSELQSVL
FT                   TDIEVPLVPILCDMEQYGVRIDANLLGKQSQEIAEKLDALEKKAFEIAGEEFNLGSPKQ
FT                   LQRIFFEKLELPIVKKTPKGAPSTAEEVLHELAHDYPLPDVILQHRGLSKLKSTYTDKL
FT                   PKMINPDTGRVHTSYQQAVTATGRLSSTDPNLQNIPIRTAEGRRVRQAFIPEQGYKIVA
FT                   IDYSQIELRIMAHLSQDESLLKAFAEGLDIHRATAAEVFGCKADEVSNDQRRQAKAVNF
FT                   GLIYGMSAFGLARQLGIARHEAQHYMDKYFERFPGVLRYMEDTRKQAKEQGYVKTLFGR
FT                   RLPLPDIKASNGARRKGAERAAINAPMQGTAADIIKKAMLKVADWIDSNNCQDDVRMLM
FT                   QVHDELVFEIKESKLTDYIEQLTEVMEKAASLDVPLIAEAGKGNNWDEAH"
FT   gene            complement(30480..31313)
FT                   /locus_tag="IL0026"
FT   CDS_pept        complement(30480..31313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0026"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80870"
FT                   /db_xref="GOA:Q5QXJ1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ1"
FT                   /protein_id="AAV80870.1"
FT                   /translation="MLIKKGLLAFGPMEVGALRISSAGLVLAPFIARRLNKITRKHWLK
FT                   LASVGLVGSLIPAFMFAIAQTQLASGVTGVLNALTPIATLVIGALFFHQKARLAQVIGV
FT                   AIGLFGTLLLVTASANGSWDFNLYALLVLAATVCYGLNLNLIKHKISDLSPLTITGISL
FT                   LMAAVPATIYLFAGTEFITQVQQPGAMLSLFSVLALGIAGTAGALVIFNHVVQLTNTVF
FT                   TSSVTYLIPIVALILGILDGEDFWLQQGVGMLAILVGVWFANRRGRSGMAGIPQK"
FT   gene            complement(31378..31998)
FT                   /gene="engB"
FT                   /locus_tag="IL0027"
FT   CDS_pept        complement(31378..31998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="IL0027"
FT                   /product="GTPase essential for cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:IL0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80871"
FT                   /db_xref="GOA:Q5QXJ0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXJ0"
FT                   /protein_id="AAV80871.1"
FT                   /translation="MADQQLDYASAKFVTSAPDISKLPPDSGIEVAFAGRSNAGKSSAL
FT                   NTLTRQKALARTSKTPGRTQLINVFELTTGQRLIDLPGYGFAKVPLAVKEKWQRSLSEY
FT                   LQQRDSLKGIVVLMDIRHPFRETDQELIYWAVDCDLPVLALLTKADKLKQGARKSTVLK
FT                   AKQAAIAFNGDVQVEAFSSLKRIGVEQVEEKLNQWYSKEYDDE"
FT   gene            32194..32820
FT                   /locus_tag="IL0028"
FT   CDS_pept        32194..32820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0028"
FT                   /product="Cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:IL0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80872"
FT                   /db_xref="GOA:Q5QXK3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXK3"
FT                   /protein_id="AAV80872.1"
FT                   /translation="MKKFAIFLGLFFGTAGIAVAQSGDAEAGKEKSQVCAACHGPNGES
FT                   PTDMYPHLAGQHQKYLLKQLKDFKLASETGGEEGRNNPIMMGQVASLSEEDMADLAAFY
FT                   AAKDSPKGETPEDIIAKGEDLFRRGNPDSNMPSCAGCHGPRGNGMGLAAFPDISGQHAA
FT                   YTKSQLEMFRSGERANDPNEMMQGVTEKMTDEEIELLSKFLSGLY"
FT   gene            33432..33845
FT                   /locus_tag="IL0029"
FT   CDS_pept        33432..33845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0029"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80873"
FT                   /db_xref="GOA:Q5QXK2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXK2"
FT                   /protein_id="AAV80873.1"
FT                   /translation="MTRQKKTRKAGPLAQPKTPRDARATDAASKGKKKGKGQAPGQRHS
FT                   SAKVLQQSKTKGDEKDPRHGSRRKIALVMTPEQELKQLQEDTKLQLLAERFENDESLTA
FT                   EEQSYLDEKSERYEQLIAKLGYELDEEWDDEEN"
FT   gene            33845..34303
FT                   /locus_tag="IL0030"
FT   CDS_pept        33845..34303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0030"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80874"
FT                   /db_xref="GOA:Q5QXK1"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXK1"
FT                   /protein_id="AAV80874.1"
FT                   /translation="MSSELYWIIAIVGVLIIVALGWYASTLLLRLRTQTQVREAAVQKR
FT                   VDRIDESIITIAKAMQQEQCPLSEGCLRIVVLLDHRPEAVDYDYSNDYPAMHDMYEKIK
FT                   HMPTHESRKKFPKKKVKEMDDEREGYEKSMRDIILSDVDKLLKQFPAA"
FT   gene            34313..35140
FT                   /gene="cysE"
FT                   /locus_tag="IL0031"
FT   CDS_pept        34313..35140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="IL0031"
FT                   /product="Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80875"
FT                   /db_xref="GOA:Q5QXK0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXK0"
FT                   /protein_id="AAV80875.1"
FT                   /translation="MAFFKGVKEDIASVFARDPAARNTMEVLFHYPGLHATWFHRVSHK
FT                   LWGWKLYWLARFVSNISRWLTGIEIHPGAKIGRRFFIDHGMGVVIGETAEIGDDVTLYH
FT                   GVTLGGTSWHKGKRHPTLKDGVVIGAGAKVLGPITVGKSARIGSNAVVVRDVPELTTVV
FT                   GIPARVAQSGVDKETTERRKKMAQEYGFDAYAISADNPDPVATAIGRMLDHVQVLDNKV
FT                   SDLCQAVNKLGGDVCGEIPEVDMDDVEFLEESERAAKRRAHKDDASASDTQEP"
FT   gene            complement(35137..36708)
FT                   /gene="aer"
FT                   /locus_tag="IL0032"
FT   CDS_pept        complement(35137..36708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aer"
FT                   /locus_tag="IL0032"
FT                   /product="Methyl-accepting chemotaxis protein (PAS/PAC and
FT                   MSP doamins)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80876"
FT                   /db_xref="GOA:Q5QXJ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ9"
FT                   /protein_id="AAV80876.1"
FT                   /translation="MKNNGPVTGKENRFPDHYRLISSTDLKGVIKHCNEDFVSVSGYTR
FT                   DELIGSPHNVLRHPDMPGGVFEQMWKTIKRGKPWMGLIKNRCKNGDHYWVSAYVTPIVE
FT                   NGKPVGFESVRVAASDNRKKRAQGVYDRLNAGKHAIPLSKRLWLGFKDLMPVVAPGLIA
FT                   SATIAILGEPLSALIALVATAVTTFAYGAYIGRMLQGLLTLRPEAFDSELVGMTYFDKQ
FT                   GREAKLAMQLVSEGARNQTALSRMKDAVGGLLKVTDDTYEQAQLSKQYVDKQTAATEQT
FT                   ATAMNEMASAIQEVADTVERNAQQAESAKANVSESVGLAREASEVIVRLHDAVREIAKT
FT                   VEELDQSTGAIGEAADLISSIADQTNLLALNAAIEAARAGEHGRGFSVVADEVRSLASR
FT                   TTQSTEGIHKVIQQLRDRARNAVEVSKQGEQAAAEGVDKVRQADNALAEISVAIQDISD
FT                   MSAQMASAVEEQSGVADHISEQITEIANTARQTQQTAEQTQHSSNELQNTSKELYSLIE
FT                   RFNLKD"
FT   gene            complement(36876..37082)
FT                   /locus_tag="IL0033"
FT   CDS_pept        complement(36876..37082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0033"
FT                   /product="Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80877"
FT                   /db_xref="GOA:Q5QXJ8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ8"
FT                   /protein_id="AAV80877.1"
FT                   /translation="MSTTTGKVKFFNEAKGFGFIEQENGADVFVHFSAIQSDGFKTLAE
FT                   GQQVSFTVAQGPKGPQAENVVPM"
FT   gene            complement(37266..37811)
FT                   /locus_tag="IL0034"
FT   CDS_pept        complement(37266..37811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0034"
FT                   /product="Amidase related to nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80878"
FT                   /db_xref="GOA:Q5QXJ7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXJ7"
FT                   /protein_id="AAV80878.1"
FT                   /translation="MLLSAKDSLLLIVDAQEKLLPAIHQRDVVTSRMRWLGEIAMQLDL
FT                   PILITEQYPKGLGYTVDSLEEIIEAARVVEKTHFSALRDDTFRDVLSEYNKKQVVIMGM
FT                   ETHVCVLQTAMELQASGYQVFLPADTVGSRRPTDKASAIERMRNAGVEIITSEMAAFEW
FT                   LEKSGTDTFRHISRNWLK"
FT   gene            37998..38489
FT                   /gene="purE"
FT                   /locus_tag="IL0035"
FT   CDS_pept        37998..38489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="IL0035"
FT                   /product="Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80879"
FT                   /db_xref="GOA:Q5QZV6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV6"
FT                   /protein_id="AAV80879.1"
FT                   /translation="MAPVLILMGSQSDWPVMQKAAEMLESLGIKWQAKVVSAHRTPDLL
FT                   KSTMEQAEQDGVPVVIAGAGGAAHLPGMLAAYTAIPVFGVPVPSKQLKGLDSLLSIVQM
FT                   PKGVAVGTLAIGDAGAANAGLLAAQVIGSFDSDVRKRVHEFRTAQKEKVMANSDLELPK
FT                   "
FT   gene            38486..39574
FT                   /gene="purK"
FT                   /locus_tag="IL0036"
FT   CDS_pept        38486..39574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="IL0036"
FT                   /product="Phosphoribosylaminoimidazole carboxylase (NCAIR
FT                   synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80880"
FT                   /db_xref="GOA:Q5QZV5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV5"
FT                   /protein_id="AAV80880.1"
FT                   /translation="MKILILGNGQLGQMLGKAVIQQGHECVLYSDRQDQVMALGSQQPL
FT                   SMTLAEANEWADVTTWEHEHLGEELVAKAADKFLLQPERFNLLVDRRSQKALCDELDIP
FT                   TSAWKAYENAAELSAILNGCDHAVVIKSAKGGYDGKGQWRWRPGDDIAAVAEDAGQRPG
FT                   IVEDMIDFTDEVSVVGARSHKGEQRCFPLTLNVHTQGILSYSLAGAEHFSKKLETLAKE
FT                   HHQKLTNALDYVGVLAIEFFVVGEGDNQHLLVNEVAPRVHNSGHWTMSGANCDQFNLHI
FT                   RAITGLPLPDLLIAPTLMVNVIGVAGIPEALWEAAAADCHWYGKEARHGRKVGHVNIMI
FT                   DSFERGENLASSWAEKLQLLVG"
FT   gene            complement(39611..40261)
FT                   /locus_tag="IL0037"
FT   CDS_pept        complement(39611..40261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0037"
FT                   /product="Phospholipase/carboxylesterase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80881"
FT                   /db_xref="GOA:Q5QZV4"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV4"
FT                   /protein_id="AAV80881.1"
FT                   /translation="MSLEVIKHEPAGNADAVIIWLHGLGASGNDFVPMTEHIKINNAQV
FT                   RFLFPHAPQMPVTINQGMVMPAWYDITDMSIDRQIDSQQLRESAAKVHAMIDEQVAQGI
FT                   DSKRIIIAGFSQGGAVGYEAALTYPKPLAGLMAHSTYFATAGDIEVNEANAQLPILVQH
FT                   GTQDPVVPEVLGQKACAVLKEKGFTVTYQTYPMPHSLCMEQVQDMQKWLNERF"
FT   gene            complement(40261..41082)
FT                   /gene="pheA"
FT                   /locus_tag="IL0038"
FT   CDS_pept        complement(40261..41082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="IL0038"
FT                   /product="Prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80882"
FT                   /db_xref="GOA:Q5QZV3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV3"
FT                   /protein_id="AAV80882.1"
FT                   /translation="MRIATLGPAGTFSEVAAGLYQPERQHQIQLLDSLVSCLDAIGNDC
FT                   DAAVVPIENLTEGFVSPVVDYLVQRPLHIQAEIRIPVGFQCLANSAQPQQIWAQFVAAG
FT                   QCNQCLNELGLPVIHTASNALSLDALLATEKPSAAVVPKHVNCPASLQILNSNIADNPR
FT                   NETRFVVLSATSETPEFDKSTHWKSSLLLIDDNDHPGLLVDSLQVFAKQQINLTSIVSR
FT                   PAGSQFGDYHFFIDFDGHLSEPGVAAALQELAKMNNIHWLGSYPAAAIGNQ"
FT   gene            complement(41079..43118)
FT                   /locus_tag="IL0039"
FT   CDS_pept        complement(41079..43118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0039"
FT                   /product="Acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80883"
FT                   /db_xref="GOA:Q5QZV2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV2"
FT                   /protein_id="AAV80883.1"
FT                   /translation="MWLKQSVIVGSLALLFTSVPALSQETFQADDIFQLEYANQVSISP
FT                   DGKYIAYIRNSFDDMKDNTRRSLWLIDTETGQHLPIFDDKFNYGSLAWSNDGTRLAFAS
FT                   NRSEKNQIHVHWIKEQRTAKVTHVSESPGSISWSNDDTQLAFTLSVKAEATPFAKSVKK
FT                   PTKPKGAKWSDSPIIVQEAYYQRDGTGVLEPAHTQIFVVPAEGGSARQLTDGPYRHGGP
FT                   LAWTADNKHIVFSGNRSEDWAYQVNESDLYNVSLDSKEVTQVTDKPGRESSPQFSPNGE
FT                   HLAYLHSSNEPVPYHKSQLWIMDWSERSEAELQADFDRSFSSPQWTGNDSLAVSYADQG
FT                   KTVVADVTLSNELTNRVDDVSGVYVSRPYTMGSFTASQTGAIAYTKGSEYRPADVGYQP
FT                   QGGEAVQFTQLNEDLLGHRKLGEVHEIRYESRYDGQEIHGWYITPPNYDENKEYPLLLE
FT                   VHGGPHLSYGPHFAAEHQRYAAEGYVVLYVNHRGSTSYGKDFAMLLDGNYSSPYDFADH
FT                   MSGIDLLIDKGIADSNNLFIAGGSAGGIATAYAVGLTNRFNAAAATNPVINWVSKVLTA
FT                   DSSIGQITNQFPGMPWEELEHYWQRSPLSMVGDVETPVLLFTGEEDRRTPISETEQFYQ
FT                   ALKLQKVDTAMVRVPGAFHGVTARPSNMIAKIEHALAWFEQYKK"
FT   gene            43258..44349
FT                   /gene="dadX"
FT                   /locus_tag="IL0040"
FT   CDS_pept        43258..44349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dadX"
FT                   /locus_tag="IL0040"
FT                   /product="Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80884"
FT                   /db_xref="GOA:Q5QZV1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV1"
FT                   /protein_id="AAV80884.1"
FT                   /translation="MHYRQTRAEISSSAIQHNAKWVRRKMAGGKLLGVVKADGYGHGVV
FT                   PAVNALEELVDGMAAGFMEEALAVRETGYKGPLVILEGCFSATELNLCCEHQLSPVVHC
FT                   EQQLEYIEQAKLTSPLWVWLKVDTGMHRLGWSEEQAPQALKRLRASKNVAGVTLMSHLA
FT                   NADAEHRLNARQKQQFCQLSETLKDYQARSFHNSAGLLNPDTQWSLQDNDWARAGLLLY
FT                   GVNPSTVTEVQAELKPAMRLVAPVIALHQLEKGESVGYGSGWSADKPSVIATVAMGYAD
FT                   GYPRQAENGTPAMVRGKRVGLAGRVSMDMLTIDVTGIENLQLGDDVELWGPNIDVREVA
FT                   ACADTISWHLLTGVSGRVPRVLV"
FT   gene            44482..45870
FT                   /gene="appC"
FT                   /locus_tag="IL0041"
FT   CDS_pept        44482..45870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="appC"
FT                   /locus_tag="IL0041"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:IL0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80885"
FT                   /db_xref="GOA:Q5QZV0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV0"
FT                   /protein_id="AAV80885.1"
FT                   /translation="MFESFDALFLARFQFAFTIAFHIIFPAFTIGVASYLAVLEGLYLK
FT                   TRNPVYQQLFRYWVKIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPVIGPLMGYEVL
FT                   TAFFLEAGFLGVMLFGMNKVGEKLHFFATLMVAVGTAISAFWILSVNSWMQTPAGYAMN
FT                   DVGQFVVTDWFEVVFNPSFPYRLAHMLLAAYLTVAFVVGAVGAWHLLKDKTNAAARKMF
FT                   SMAMWMALIVAPLQVLVGDFHGLNTQEHQPSKVAAMEGHFHTEARAPLYLFGMPNEETA
FT                   EVDYALKVPGLASIILKHDIDAEVTGLDQYPREDWPPVVTVFWAFRIMVGVGMLMVLAG
FT                   LWSGFQRLRGKLYDNKTLLRFSLFMGPMGFVAVIAGWIVTEVGRQPWVVYGLLRTADAA
FT                   SPIDKAGVAGSLIAFIVVYFLVFGAGTFYILRKMAGNPEQVAIPDYAKHKPTMAAERIY
FT                   DEEV"
FT   gene            45874..46875
FT                   /gene="cydB"
FT                   /locus_tag="IL0042"
FT   CDS_pept        45874..46875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="IL0042"
FT                   /product="Cytochrome bd-type quinol oxidase, subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:IL0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80886"
FT                   /db_xref="GOA:Q5QZW4"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW4"
FT                   /protein_id="AAV80886.1"
FT                   /translation="MDYALIWAILISVAVFAYVALDGFDLGIALLFPWFKKEEDRDVMM
FT                   NTVAPVWDGNETWLVLGGGGLLAVFPLAYSVLMPALYMPVIAMLLGLIFRGVAFEYRFK
FT                   TKRAKGIWDLSFITGSLIAAMSQGIMLGAMLQGIQVTDRAYSGGWFDWLTPFTIFCGVA
FT                   VVIGYMMLGATWLVMKTSGDLQRQSYRAGWYTTILLVACIAFVSLYLPYVDMFIAERWF
FT                   TYPASVGLWALPILLAVMTIGLLRSLHRKQEGRPYLWGLGMFLLAYTGFAVSIFPYLVP
FT                   RSITLWEAAAPDNSLKFLLVGAVFLLPIIFAYTGYTYWVFRGKVDPDSGYHD"
FT   gene            46875..46979
FT                   /locus_tag="IL0043"
FT   CDS_pept        46875..46979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0043"
FT                   /product="Uncharacterized conserved membrane or secreted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80887"
FT                   /db_xref="GOA:Q5QZW3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW3"
FT                   /protein_id="AAV80887.1"
FT                   /translation="MKPVFKKWLWFVGLWCLGVLAVTLVGGLIRWALL"
FT   gene            47025..48383
FT                   /locus_tag="IL0044"
FT   CDS_pept        47025..48383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0044"
FT                   /product="Amidohydrolase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80888"
FT                   /db_xref="GOA:Q5QZW2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW2"
FT                   /protein_id="AAV80888.1"
FT                   /translation="MKLTHLLAATVAALFLSACNNAEPQNNETRSADYVIKNVTLVDWL
FT                   KGEPNVSEQQTLVVNDGYISGVFANAEAPAFDDNTQVIDAEGKYVLPGMAEMHGHVPPA
FT                   TDFGDFPKRYADDMLFLYVANGVTTVRGMLGYPHQLQLKSDIESGKRQGPTLYLAGPSF
FT                   SGNTIESVEQVTKRVIAQRDEGWDLLKVHPGLTLEEYEAMASTARQAGMDFAGHVPADV
FT                   GLKRAMEAGQRTIDHLDGYLAYVDAMNREITQDELDLLVSMTLEKDVAVVPTQALWKTL
FT                   IGAADPDKLKDYPEIQLVPKAVREGWLNYYDNPSSYFNKEQAQVQQENRQKLLHALHEG
FT                   GAEIIFGTDAPQLFSVPGYSIHHEIQLMSEAGIPMADILRSATVAAGDYFADEDTFGRI
FT                   AAGHRADFILLKDNPLENADTLRENQGVMVRGQWLSREAIDKKVEEIRAAYAD"
FT   gene            48411..49970
FT                   /locus_tag="IL0045"
FT   CDS_pept        48411..49970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0045"
FT                   /product="Beta-lactamase class C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80889"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW1"
FT                   /protein_id="AAV80889.1"
FT                   /translation="MKPLFKILSSVSLGVTLLASAPVWAQSADSIRNTAEETLEAFNIP
FT                   GLAVVAVKDGEVILAEGFGVRDIDSGEPVNANTLFGIASNTKAFTAAAMATLVEQGKLN
FT                   WDDKVIDYIPEFRLADPAITQSLTIRDILSHRSGLGLGAGDLMIWPNTDKSTSDILAGL
FT                   AHVPIDHGLRERFAYNNLMFVTAGEVIHRVTGMPYREYVEKTFFQPLNMDESVIGFSHI
FT                   PESNDNVAVGTIEMNGELHRFPLDFLEDFGAAGATAASVDDLSNWLITQLQGGVSPSGE
FT                   RLFSEDSQQAMWQLTTPLGTSPEAAEQGTYFGGYGMGWFVKDYQGVKRVYHSGGILGML
FT                   SLTTLIPEKNFGMVVLSNQQAFGGLTAITEEALEDLLDLPNRDWVEEEQQKYQAFMKRK
FT                   AEFAVEEPEEIREALPLKSYAGTYNDAWYGDVEISYEQEKLRINFTHTPMLQGTLEHYN
FT                   DDTFIVRWDEPLLEADAFIDFSVNRNNEVHSATLEAVAPYTDFSFDFHNLNLKKQKQET
FT                   GD"
FT   gene            complement(50016..50654)
FT                   /gene="gst"
FT                   /locus_tag="IL0046"
FT   CDS_pept        complement(50016..50654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="IL0046"
FT                   /product="Glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80890"
FT                   /db_xref="GOA:Q5QZW0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW0"
FT                   /protein_id="AAV80890.1"
FT                   /translation="MKENMSKNTKEIVFYTNPESRARIVRRMLEEVGQPYTVKVLNYNG
FT                   EMKTPEYLKVNPLGKVPAIQHGDLVVTETAAICAYLADQFPEKNLAPPLDSPERGTYYR
FT                   WLFFAAGPVEMANSAKACGWNLEDNLQMVGSGSHDDVLKALELAVSKGPYICGEQFTAA
FT                   DVYVGSHISWGMQFKTLEERDSFKRYVERIEKRPAFQRATKLDDELSKG"
FT   gene            50780..51724
FT                   /locus_tag="IL0047"
FT   CDS_pept        50780..51724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0047"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80891"
FT                   /db_xref="GOA:Q5QZV9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV9"
FT                   /protein_id="AAV80891.1"
FT                   /translation="MTGPTTRVLALLELLQSHKRLSGTEIAEMLGVDKRTVRRYISALE
FT                   ELGIPVTTEHGPHGGYMLVAGFKLPPMMFTHEETLALSLGLLAAKTLQLTDASPALTSV
FT                   QAKLERVMPEHIQARARSITQHTNLLLPDSGLPQEQSLLMPLMEAIESQRRVQVVYVGK
FT                   AEPGQQRELDPYGMFYRLGHWYIGGFCHLRQALRTFRLDRLAEVTLLKATFERPLNYNA
FT                   AEQFKQSLCAMPGNLKVRVLLHTDLDTATRELGTSASILTQEDNAIFIETVVDSTEWFA
FT                   WWLVRLPFDFTIISPDSLKQALRRRAEQLMGYC"
FT   gene            51807..51881
FT                   /locus_tag="tRNA_Arg_1"
FT   tRNA            51807..51881
FT                   /locus_tag="tRNA_Arg_1"
FT                   /product="tRNA-Arg"
FT                   /note="anticodon: CCG"
FT   gene            complement(52179..52457)
FT                   /locus_tag="IL0048"
FT   CDS_pept        complement(52179..52457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0048"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV8"
FT                   /protein_id="AAV80892.1"
FT                   /translation="MGKTTAEKDALESVDPGIVGEIIGKWDAKNGLETTMYLYSENGKH
FT                   YIAQVFGPGEISKHEVTLSDIKHGTKIENVEENTFGEYFVMNDSGWL"
FT   gene            complement(52616..53041)
FT                   /locus_tag="IL0049"
FT   CDS_pept        complement(52616..53041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0049"
FT                   /product="Riboflavin-specific deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80893"
FT                   /db_xref="GOA:Q5QZV7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZV7"
FT                   /protein_id="AAV80893.1"
FT                   /translation="MSEKFMLEALNISKQALPHCEPNPPVGCVLVKDGEVISKGFTQAI
FT                   GGSHAEVEALNAHSGDLSGVTAYVTLEPCSFVGRTAACASTLLASGIKHVIIAMLDPDI
FT                   RNNGKGAEILTAGGVKVEVGLCAELVAQFLSPYLAKS"
FT   gene            complement(53223..53609)
FT                   /gene="tra5_1"
FT                   /locus_tag="IL0050"
FT   CDS_pept        complement(53223..53609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra5_1"
FT                   /locus_tag="IL0050"
FT                   /product="Transposase Tra5 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80894"
FT                   /db_xref="GOA:Q5QZX1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX1"
FT                   /protein_id="AAV80894.1"
FT                   /translation="MGWSMHHRQDRYMVVRAVEMAVWQRTGNQPVILHSDSGSQFTSGD
FT                   YQRALKFNNLISSMSAVGNCSDNAGCEGFFGILKRERVNYRHYRTRDKARSDIFDYIER
FT                   FHNPRMRRRLAKQDQQFSAILNRP"
FT   gene            complement(53653..53997)
FT                   /gene="tra5_2"
FT                   /locus_tag="IL0051"
FT   CDS_pept        complement(53653..53997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tra5_2"
FT                   /locus_tag="IL0051"
FT                   /product="Transposase Tra5 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80895"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX0"
FT                   /protein_id="AAV80895.1"
FT                   /translation="MSPNGYYAWAAQPPSARDVENQRILTRIKEIHEDSGGVIGAPRMH
FT                   EDLSIEGERVSLNRVARLMAVNGFQGWTHKKGRGRKRPAARPAGLKDHLARDFTATEPE
FT                   TKWRSQNHRR"
FT   gene            complement(54263..55111)
FT                   /locus_tag="IL0052"
FT   CDS_pept        complement(54263..55111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0052"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80896"
FT                   /db_xref="GOA:Q5QZW9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW9"
FT                   /protein_id="AAV80896.1"
FT                   /translation="MDRSLLMAIIMLVLGNNIVILSDSLIKLLDGFEAPFQFVLYRQIS
FT                   ATLMLLPFMLLFKRPLLPKNIRWHATRAHIFLLGTVFMVISLTTLPLATANAIFYAAPI
FT                   ITVVLARMFFKERVTRLSLITAVLGMVGVLVIVNPSSTNIFALAALVVATTLALNNLLV
FT                   KKLPAEHSILDTLYLTNLLGIPLASAMAWFEGASFDVSTFLISVGSSLFAMIYAGTCVF
FT                   AYRAAESNKVTSAEYTGLIGAVILGIVFFTETPDARFYIGSVLIIAPLTVLTLRNSNRS
FT                   A"
FT   gene            55214..56110
FT                   /locus_tag="IL0053"
FT   CDS_pept        55214..56110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0053"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80897"
FT                   /db_xref="GOA:Q5QZW8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW8"
FT                   /protein_id="AAV80897.1"
FT                   /translation="MSLPLRSIHYFVEVARCESFSLAAERLHVSQSAVSHQVALLEGYL
FT                   GDDLFVRRGRKILLTAVGENYFNEVAGAINAIEGATANVRQYDTRQVKLAVHGSLAVKW
FT                   LIPALDEFRQRYPNVELTLQMLTQDGNFDTQWADCFITTQPPGMGYQRYHLYDETLKPY
FT                   CSKALWAEAHRLESAGDLIQYPLLSAISAFASGEPGTDWQRWFKKANLRLPVSARVHHF
FT                   SHLLLAAEAAKYGQGIALLNEFMTTEQEREESLFELPFHSIQTDDSFYFVYPSSTAKSP
FT                   GLESLGDWLVALCRTRH"
FT   gene            56928..57470
FT                   /locus_tag="IL0054"
FT   CDS_pept        56928..57470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0054"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /note="similar to sigma E"
FT                   /db_xref="EnsemblGenomes-Gn:IL0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80898"
FT                   /db_xref="GOA:Q5QZW7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW7"
FT                   /protein_id="AAV80898.1"
FT                   /translation="MTLQQHKAKISDLALQHGRLVFHCAYRLLSDTHLAEDVTQDVFIK
FT                   LFKKSLKSMNEVKNWPAYLKSMAVTTAIDYLRRNKRLAEDDLESVPENESDTSRHPLNQ
FT                   VLRDRDLILFKQALLQLTEQDAHIYCLRHVEGYSYQEIAELMHVSSNSVGVSLHRSQLK
FT                   LSSIVGKSEYLGARHEH"
FT   gene            57460..58314
FT                   /locus_tag="IL0055"
FT   CDS_pept        57460..58314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0055"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80899"
FT                   /db_xref="GOA:Q5QZW6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW6"
FT                   /protein_id="AAV80899.1"
FT                   /translation="MNTNHDSIQTMLNKVKGQKPSEHDDIAMQSRLHAAIDAQDNPVDE
FT                   EEPGNGMIRLWSWLKTASQPKRFGFAGTAAALVLTAVLIITTSVSKPAFASVVKKLSEI
FT                   TSMVYTGQMQSDDQVIMTVEVFYQSPSKIRVVNTPLPDIEGAPSVVNVMDTKLGKGLIL
FT                   FPERKVAMPINFTPGQNAKEALENELLDWHTKILNYDGEVKSEPGVVIDGIETTVFTVE
FT                   PENMRLTLWVDPKTELPIRIRVETMDGPYFVFEADVAFNEAIDPEMFDLAPSGYEIMGA
FT                   DSE"
FT   gene            complement(58709..59119)
FT                   /locus_tag="IL0056"
FT   CDS_pept        complement(58709..59119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0056"
FT                   /product="Membrane associated protein containing xre-family
FT                   DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80900"
FT                   /db_xref="GOA:Q5QZW5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZW5"
FT                   /protein_id="AAV80900.1"
FT                   /translation="MIKKLRERKNWSQEQLAIMSGLSVRTIQRIESGNKASMESLKSLA
FT                   SVFEVDVSKLTEEITVIDKESKYWKQQPVWFKLSLFGVNRRNKLVWVEYLSVLLGLATW
FT                   IIHPDIFATSAFFLAAYLISKLVNRADSRKVW"
FT   gene            59279..59599
FT                   /locus_tag="IL0057"
FT   misc_feature    59279..59599
FT                   /locus_tag="IL0057"
FT                   /note="uncharacterized conserved protein, fragment"
FT   gene            59992..60264
FT                   /gene="hipB"
FT                   /locus_tag="IL0058"
FT   CDS_pept        59992..60264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="IL0058"
FT                   /product="Transcriptional regulator, HipB ortholog"
FT                   /db_xref="EnsemblGenomes-Gn:IL0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80901"
FT                   /db_xref="GOA:Q5QZX9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX9"
FT                   /protein_id="AAV80901.1"
FT                   /translation="MKITDPKALSIYLRDERRRRGLSQAKVGDLVGLRQGTVSKFESMP
FT                   EKMQLDTLFRLLSALELELEVKPKGTVLKKNVDSSTPGDEWTEEW"
FT   gene            60264..61577
FT                   /gene="hipA"
FT                   /locus_tag="IL0059"
FT   CDS_pept        60264..61577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipA"
FT                   /locus_tag="IL0059"
FT                   /product="HipA"
FT                   /note="involved in persistence to inhibition of murein or
FT                   DNA biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80902"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX8"
FT                   /protein_id="AAV80902.1"
FT                   /translation="MNTLDVYMNGYRVGHLSRNDSGAHTFRYDEMWIDKEGARPISLSM
FT                   PLRHDAYSGREVINFFDNLLPDNEEVRDRIVARYQADSDQAFDLLAAIGKDSVGALQFV
FT                   PAGEKPGNIRELRYEKLTEEKLERVLKGYQSKAPLGMLRELDDFRISIAGAQEKTALLK
FT                   IDGAWCIPNGNTPTTHIIKLPIGKIQSHDHTIDLSDSVENEMLCLKIARAFGFEAPDCE
FT                   VIITPNVKALAIERFDRTYSSDHSWLMRLPQEDYCQVLGLPSARKYESDNGPSIASIMK
FT                   HLQGSADSTGDREAFMGAQVLFFLLGATDGHGKNFSVHIEPYGAFRLTPLYDIISAYTA
FT                   VGGTGINIRDLRLAMSLRGAGGKKRNIYQIFKRHFLNAAKEAEFSPTRMSEIINALCDQ
FT                   VDDVIERVKGDLPNDFPTRVSTPIFDGMQERKRRLLIE"
FT   gene            complement(61796..62305)
FT                   /locus_tag="IL0060"
FT   CDS_pept        complement(61796..62305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0060"
FT                   /product="Membrane associated protein containing LuxR-like
FT                   DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80903"
FT                   /db_xref="GOA:Q5QZX7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX7"
FT                   /protein_id="AAV80903.1"
FT                   /translation="MTIDRLLMVIFLLIAFANVSDVVADYHMQVATWHLAIEGITVVIS
FT                   IAAFIVLWWRVLRRNQELKQVKVALSRHQQREKESTANHEPGKERDKSPDSYTAVQSWF
FT                   KQWKLSPSEQEVAVLLIKGLSFNEIAEVRSTKEKTVRQQASSVYAKSGLSGRNQLSAWL
FT                   IDALLY"
FT   gene            62404..63600
FT                   /locus_tag="IL0061"
FT   CDS_pept        62404..63600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0061"
FT                   /product="Outer membrane protein"
FT                   /note="TolC-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80904"
FT                   /db_xref="GOA:Q5QZX6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX6"
FT                   /protein_id="AAV80904.1"
FT                   /translation="MSLLRATSGKLFFSLLASTFFLLSPLAKGDNLSQQTLLESVVERL
FT                   KTDGLLIDTDFSQRQWLSATPRLSLMHWQTNDDAIGSNETELVLELEFLSPEQRKLINN
FT                   SEKLVERYQQLQQRQLELTASGVIRELFWQAKRLQAELAYAEKVTNQLNQLQRQTQSLV
FT                   AAGERPVYAGIIVKQQHQRSLSQVAEKQIALQQLERVWQQLTGVNNVPQSLQESVRPHA
FT                   STAAHPALQTLQLQWQLALNATQQTVAVQKSWGINAGYKYIDAPNQSENQWGLGFSLPL
FT                   DFSQSLNASELVALQQQQSELNQSLRQTQIRLELDMANAQSQLEQLKQKHQTDRQNAEL
FT                   SHNAIEQLDNLYEQGQIDTRLYIERLLEQLSYQQAAQLSQIELQLANALLNQAQGMTL"
FT   gene            63597..64637
FT                   /locus_tag="IL0062"
FT   CDS_pept        63597..64637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0062"
FT                   /product="Membrane fusion-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80905"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX5"
FT                   /protein_id="AAV80905.1"
FT                   /translation="MKRCNLSRLAATLSPIVSVIALALSGLATTTTVLAAQSISVEQVS
FT                   NYDLRPQAAVNVDNVAFAPVTGSYQTTPGSVLTLPNPFENAAVDYQVVDGQAVESGTLI
FT                   AQLHGPSVEHFFHRVETLQEQYDVAAKQYQSKKKLYQNNAIAADEWQQFLTQYISLNDT
FT                   LHEINVVLRRVKQTAEQSAQLIATEPGVWRTSSNGQQLGTLIAHARLAIVAEVPIEQAK
FT                   RISSLNINGQKLRVSQREQTVRNGFVRIWSEPPQDINWTIGQRVNVVPQAAIENAYLLP
FT                   ASAIATLQDQPIIFSIENATINAVPIELLSLSGEHYFVQSTTPLNIIATHSVAALKVIA
FT                   EDEEAQ"
FT   gene            64637..67705
FT                   /locus_tag="IL0063"
FT   CDS_pept        64637..67705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0063"
FT                   /product="Divalent cation exporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80906"
FT                   /db_xref="GOA:Q5QZX4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX4"
FT                   /protein_id="AAV80906.1"
FT                   /translation="MISRILSFSLKNRLFVFITFLLLIAAGIQSLRQLPVDAFPEISPT
FT                   QVNVILRAPGMAAERVENQVTHPLETELLGIPNQTILRSTTKYGITSITLDFDEGTDIY
FT                   WARQQVAEKLAAVSKDLPDGIQGGMAPMSTPLSEMFMFTIENPGMNLEQKRHLLDWVIR
FT                   PTLRTVEGVADVTNLGGKVRTFQFTPSASKLSDAGISLQTIKDALADANQVGNLGRITQ
FT                   GTETFSARVTGRIVALDDLAAISVTNQYQQVYRLDQLGDVALSYLPRFGAITKDGEEAV
FT                   EGLVVGLKGANAAAVVEAVEQKLAQIKPSLPKDTDINVFYNRKGLIDTAIAGISDALMQ
FT                   SIVLVIAVLVFFLRNVRASILVSLSIPVAALITFICLQLLGLSANLMSLGGLVIAIGMI
FT                   VDSSVVITEKIETELNSQKQLPLLHKIYRASLSVAPSVVSGTVIIILVFLPLLTLTGLE
FT                   GKLFSPVALTIVIAITAALVTSLTLIPALGSLLMRPKARRNKSLERMQACYQRILSGAI
FT                   KRRSATLMGFAGVLALSVVSFIMVGKIFMPTMDEGDIIVQLEKSPTISLQESIELDTQV
FT                   ERELLAKIPEIKQIVARTGSDELGLDPMGLNETDVFMELNPKDSWRFDSKQELIDAIRE
FT                   VVSGYPGMNVNVTQPIQMRISEMLTGSSGDVSIKVFGDDMNTLANVTDRVVEQAKQVQG
FT                   AVDVQASVITGARFLSIVPNMQQLRFYGVTKQNFSEFILSQLSGFPVSEAVNGRIRTPI
FT                   VMGSQKPAGNYHSVSNIESLPIVTDNGETVALQQLAEITFEHGPAIIERENSNRYALIT
FT                   SNVENRDVVGFVNELQQRVSANVNLDPGYFIEYGGEFENQARASANLLMVIPVALLLIV
FT                   ILLFSSMGSIGLTTIVLTNIPFALSGGAISLWLSGEYMSVPASVGFIALMGVAILNGIV
FT                   MVSHFEQTRVHFSDFKTLVIEGAKDRLRPVLITAITAIFGLIPLLMSSGPGSEVQKPLA
FT                   VVVIGGLITATLATLLLLPILYLLVNRKARDVQ"
FT   gene            67695..68003
FT                   /locus_tag="IL0064"
FT   CDS_pept        67695..68003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0064"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80907"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX3"
FT                   /protein_id="AAV80907.1"
FT                   /translation="MSNKLLKLYFSREQKADLVDCLIQLDYLSGFSLYDIDGFSRNHER
FT                   FDIGEQIRGARRMMMAEVICAADDVTRIREALSQLNFKEPVRYVMQSVEDVGHSDYI"
FT   gene            complement(68135..68782)
FT                   /locus_tag="IL0065"
FT   CDS_pept        complement(68135..68782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0065"
FT                   /product="Predicted transcription negative regulator"
FT                   /note="similar to ChrR"
FT                   /db_xref="EnsemblGenomes-Gn:IL0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80908"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZX2"
FT                   /protein_id="AAV80908.1"
FT                   /translation="MLNLDFAKRVIIETAKQEWVDSPASGVRRKLLEREEAERGRATSI
FT                   VEYKPGASFSTHEHPLGEEILVLEGVFSDENGDYPAGTYIRNPPGSSHAPFSKDGCKLL
FT                   VKLHQFQPTDTQVVRINTHEAEWLPGQGGLEVMPLHSHGTEHVALVKWPANEVFKPHRH
FT                   LGGEEILVLSGEFCDEHGRYPEGTWMRSPHTSVHHPFVDRETIIWVKTGHLG"
FT   gene            68880..69308
FT                   /gene="trxC"
FT                   /locus_tag="IL0066"
FT   CDS_pept        68880..69308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxC"
FT                   /locus_tag="IL0066"
FT                   /product="Thioredoxin related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80909"
FT                   /db_xref="GOA:Q5QZY7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY7"
FT                   /protein_id="AAV80909.1"
FT                   /translation="MAEKMIVACPSCHKKNRIVVDKRNENAVCGHCRSLLFSGKIIVIN
FT                   SDEFRAHQSADMPLIVDFWASWCGPCQQYGPHFEQAATNMRYDAQFLKISTEKEPHLAQ
FT                   QYAVRSIPTTLFVKNGQEVARQAGVMSASQIQQWVARY"
FT   gene            complement(69376..69792)
FT                   /locus_tag="IL0067"
FT   CDS_pept        complement(69376..69792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0067"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80910"
FT                   /db_xref="GOA:Q5QZY6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY6"
FT                   /protein_id="AAV80910.1"
FT                   /translation="MYLSIFLTAFLAATILPAQSEFVVVAAQRMDYDVWIIWWLASIGN
FT                   TLGSVVNYVLGRFLVRYQDRRWFPFKPKSLARGHRWFERFGKWSLLMAWAPFIGDPLTF
FT                   IAGMLRLTFWQFLILVFISKAGRYAILLGITQLF"
FT   gene            69915..70250
FT                   /locus_tag="IL0068"
FT   CDS_pept        69915..70250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0068"
FT                   /product="Membrane associated protein containing Zn-ribbon
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80911"
FT                   /db_xref="GOA:Q5QZY5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY5"
FT                   /protein_id="AAV80911.1"
FT                   /translation="MAFEKCPKCEDQVLDNNYSCPACGFVKSEKSEQENQPGENSAITS
FT                   ENTSKSLQIQGVLSLVILIVGVLWFFLTSEESQQSNEINVIPLVMFIGGLIWYIVTRFR
FT                   IWRSHSS"
FT   gene            complement(70371..72422)
FT                   /locus_tag="IL0069"
FT   CDS_pept        complement(70371..72422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0069"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0069"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80912"
FT                   /db_xref="GOA:Q5QZY4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY4"
FT                   /protein_id="AAV80912.1"
FT                   /translation="MNKFIFTGAVFSLFSPVLFAQTADVENSDKEEKQIERISVVGAAT
FT                   NFSVTADDIEQFQANDLADIFRESPSVSVGGSVGVAQKIYIRGLEDAYLNVTVDGAQQT
FT                   STLFHHIGRVTLDPDLLKQIDVQAGAGEATSGPGAIGGSIRFKTKDAQDLLHNDEQFGG
FT                   RLKANYFSNDGTRYSGTLYGKLNDSFGLLGYFSTVDRNTMEDGDDNKIYGTAADQDLTF
FT                   LKASGDIANNHYVSFSFEQRDEEGEFSARPNWVVPEGSPLYPSAAKRDTYVANYRFDHS
FT                   DAVYLKATAYQTSSSFRGGRFDWLAEIDTQGFDIRNTSETLNHSFTYGVDYRSDEVESG
FT                   PAAGPKENSEESSVLGVYAQAHSHITADLLFSYGVRYDDYEFQQQILLDEYSGEPVTDT
FT                   PASLDDSELSFNAGLSYQLSQAWKFGLSYAEAARGKEIGDGFTLDEYLYDGNDIPVVAG
FT                   DVVPETVENIETSIEYSANNLNAKFSVYQSTIYDVIFSGFAGNSVYNNIGDVESTGVEF
FT                   NLAYRWNSLDMYFGFSSADSELSPRDGLYTESYDSIDLNAYEFNGLGNSRGNTIVLGAD
FT                   YFVTNDLSFGFNVTRVDDIHIKTLHQALENGWTDSLYTLNKPSYTVVDLYSAWDITNNF
FT                   SVNIAVTNLLDEQYINHSSVGDYSEVFPTVVGPYEAGRDIRLSATYDF"
FT   gene            complement(72895..73737)
FT                   /gene="ada"
FT                   /locus_tag="IL0070"
FT   CDS_pept        complement(72895..73737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ada"
FT                   /locus_tag="IL0070"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80913"
FT                   /db_xref="GOA:Q5QZY3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY3"
FT                   /protein_id="AAV80913.1"
FT                   /translation="MSDYTRIEKAMTYMSGHVSSQPTLEDVAAHVHLSPFHFHRVFCKW
FT                   AGTTPKRFLQALTLERSKRMLKGESSLMDVSLSMGLSGGSRLYDHFVKLEAVTPGEYKN
FT                   EGQGVTIQYGVNETPFGKIFVAITPRGVCRIEFLGSRAVDEILTDLCKDWPKAALVSNE
FT                   NATNYVANVLFSRLKDGQSNPLSLHVMGTNFQVAVWRALLRIPPGKLASYSQIANVLDC
FT                   PGASRAVGNAVGANPVAMLIPCHRVIQKSGALGRYRWGSAKKEMLQAWELLCEKPIEV"
FT   gene            74021..74632
FT                   /locus_tag="IL0071"
FT   CDS_pept        74021..74632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0071"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80914"
FT                   /db_xref="GOA:Q5QZY2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY2"
FT                   /protein_id="AAV80914.1"
FT                   /translation="MQRTKKAATKRQHILETGYRLVLKKGFAAVGLQEILKSCGIPKGS
FT                   FYHYFPSKEAFGCELLKEYTNDYGCKFEQLLTASGSGRDNLMRYWDAWIADPDDPTRGW
FT                   AEECLVVKLAAEVADMSETMRQILDDGVQQLIVKIATLIENGRSDGSLADGAPPLQLAR
FT                   MLYQMWMGAALLAKLSQDKEPLHEARNSTLLMLDCSDTKA"
FT   gene            74827..76209
FT                   /locus_tag="IL0072"
FT   CDS_pept        74827..76209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0072"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80915"
FT                   /db_xref="GOA:Q5QZY1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY1"
FT                   /protein_id="AAV80915.1"
FT                   /translation="MSNQITTINPSNGEQLKSYTKMDLAEVTQIIEESHAAFLQWRLES
FT                   LEQRAKSVKAIGKALQEHKEEFADLMVKEMGKLPEQARQEIDLCVGICDYTAEHGPEEL
FT                   ADEERKPGNGQRGIVTYSPIGIVYGIQPWNFPAYQVVRYSIANIMAGNTVLLKHAENVT
FT                   GSGLLLEKIYREAGLPENVFRTLVISHETSDEVIAHSLVRGVTLTGSDGAGRKVATQAA
FT                   KHLKKTVLELGSNDAYLVLDDADLDVAVDTCVMGRVFNTGQTCVAAKRFVVTEANYEAF
FT                   KERYVEKMKALKVGDPTQSDTDVGPMARVDLRDQLHKQVEESVSKGARILCGGEKPEGK
FT                   GAFYPVTVLENVEPGQPAYDDELFGPVAALIRAKDDEDAMRIANDSRYGLGGGIISKDV
FT                   QRATELASKYFDTGMVFINGFGVATPEMPFGGVKDSGYGREHGGFGMHEFVNVKAINVV
FT                   KE"
FT   gene            complement(76300..77385)
FT                   /locus_tag="IL0073"
FT   CDS_pept        complement(76300..77385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0073"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80916"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY0"
FT                   /protein_id="AAV80916.1"
FT                   /translation="MNIRGIISSALLMSVSLFTQAADNNASSHELSLSEANKLVELPLH
FT                   CVETPYPYKTGIILGSADDLKEPSVLHPVFYGCFDWHSAAHGYWSMVTLLRQFPDLEQA
FT                   DEVKAILKRNLTAEKVAREVDFFSKDINDSFERTYGWAWLLKLSDELHSWEDPMAKDLA
FT                   ANLQPLADLIVERYINFLPRLVYPVRVGEHTNTAFGLSFAYDYAVNQQHTGLQQLIAKR
FT                   AKDYFLEDKNCPIGWEPSGYDFLSPCLEEIGLMQRVLPKQQFLTWLDDFMPQLADPEFS
FT                   LAVGEVGDRTDGKLVHLDGLNFSRAWNLYALANQYPQYRHLRKIADKHMAHSYPNLIGD
FT                   SYEGGHWLGSFAIQALNQTQQ"
FT   gene            complement(77423..79585)
FT                   /gene="ptrB"
FT                   /locus_tag="IL0074"
FT   CDS_pept        complement(77423..79585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="IL0074"
FT                   /product="Protease II"
FT                   /db_xref="EnsemblGenomes-Gn:IL0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80917"
FT                   /db_xref="GOA:Q5QZZ6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ6"
FT                   /protein_id="AAV80917.1"
FT                   /translation="MQKLRPLYIALLSAALLQACSPANQNTDTSSSTSKQGVEAPVAEK
FT                   VPHEMTIHGDTRIDNYYWMRDDERKDPKVLAYLEAENAYTDEMLAHTEDLQQKLFEEMK
FT                   SRIAKDDNSVPVRDGDYYYSTEMRGDNEYPIYVRSTDFSGTNKQILLNVNELAEGKDYY
FT                   SVGSLEVSPDDAILAYSEDTVSRRMYEIKLKNMKTGELLPDQIKNTSGDIVWGNDGQHF
FT                   YYIKKDPETLLGYQVYRHKVGTEQQQDELVYEEQDTTFYTGIRKSKDDSKIYIIHDATE
FT                   SKGVSLIDANDPNAKPVEFVPREDGLEYSIAKHGDDYYVLTNLDAVNFRLMRVSADKLG
FT                   DKQHWQEVIPHKEDTRLEDIELFDQHLVYKQRQRGLTEVFVRNLNTGDEQELSFRDKAY
FT                   TLYFYGNKEADNPELRLYYTSMTTPGSHYNVDLNSLDKTLLKQQPVLGDFKPENYASER
FT                   LFVTARDGAEVPVTLVYRKDKFKKDGANPLYQYGYGSYGSTSEPSFSSNRLSLLDRGFV
FT                   FAIAHIRGSQMLGRTWYEDGKKLSKKNTFNDFVDVTKSLVEQGYGAEDKVFAMGGSAGG
FT                   LLMGAVINQAPELYLGVAAHVPFVDVVTTMLDESIPLTTNEFDEWGNPKEKVYYDYMLS
FT                   YSPYDQISAQDYPNLLVTTGLFDSQVQYFEPAKWVAKLRDYKTDDNLLLFKTEMEAGHG
FT                   GVSGRFKRLQNTALEYAFFLDLLKNQ"
FT   gene            complement(79774..80289)
FT                   /gene="dps_1"
FT                   /locus_tag="IL0075"
FT   CDS_pept        complement(79774..80289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps_1"
FT                   /locus_tag="IL0075"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80918"
FT                   /db_xref="GOA:Q5QZZ5"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ5"
FT                   /protein_id="AAV80918.1"
FT                   /translation="MNTSDKTAEFTAPGIKNESAQDAIALLDDRLVALLDLQLTLKHVH
FT                   WNVVGPNFIGVHEMLDPQVDSIREMTDTIAERIATMGGVPAGTPQSIVDRRSWKDYSIG
FT                   RGLVTEHLVALDKVYNGVNKDHRDALNKLAELDPVSEDMLTGQLAELEQFQWFVRAHIE
FT                   SASGELKS"
FT   gene            complement(80421..81509)
FT                   /gene="xenA"
FT                   /locus_tag="IL0076"
FT   CDS_pept        complement(80421..81509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xenA"
FT                   /locus_tag="IL0076"
FT                   /product="Xenobiotic reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:IL0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80919"
FT                   /db_xref="GOA:Q5QZZ4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ4"
FT                   /protein_id="AAV80919.1"
FT                   /translation="MSALFQPFELKDVRLRNRIAVPPMCQYMAEDGVVNDWHLSHYTSL
FT                   ARGGAGLVIVEATAVSPEGRITPNCTGLWNDEQAQAFAPVVENIKKAGAVAGIQIGHAG
FT                   RKASANRPWDGDDHIAENDTRGWQPISPSPIAFGANLPREPEEMSLDDIKRVQIDFVAA
FT                   AERARDLGFEWLELHFAHGYLGQSFFSAHANQRTDEYGGSFENRARFLVETVRAVKQVW
FT                   PDNFPLTARFGVIEFDGNDEQQMQESVKLTQLLKAEGLDFLNVSISFSTPNANIPWGPG
FT                   FMAPIAERIRKEVDIPVASAWGIDLPQLAEHTIAQGQLDLVMVGRAHLENPHWPYDAAK
FT                   VLRVEKPSWVLPAPYAHWLERY"
FT   gene            complement(81650..83557)
FT                   /locus_tag="IL0077"
FT   CDS_pept        complement(81650..83557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0077"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80920"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ3"
FT                   /protein_id="AAV80920.1"
FT                   /translation="MLIGALSAGAITLGCNSNDSYSAREVLSVEQKEAALAELQQKRKE
FT                   RKKKIQTIEDKALFEALEGEEFIAHRNIYRTIKFDEKPAQYFYVEPFKASYIGPLGRPY
FT                   TADRFKRLKDYESPQKLLDIYRNNFVASTASREGQWFQVREPFAFPFKSQLQFTQVVMD
FT                   NGDVKALPDLLDWVAQTDEIRYDPERFYFKEPRTEDDLQPVKLLGDVETELPKDVLQFE
FT                   FKASDVGKTQEQRGYSVTLVKAGDFNYDIKIEVPDDQAMPLRDEDIIGEALSPTERELQ
FT                   LRMDTTLQSDYHERMSEWLDEIIERAMRGEVDAETVRTEGNNLHDKLSVGEGRVLHKAF
FT                   AFMGPVATARVTLLPRKKTRDKVTHKIEIPIHFLGQQDNSDEIDLSTLPDIDLAGPVYD
FT                   ERPKRRVDLTEEEMKQLIDIRYEKSRHLPEYQHTERIYLKYPPVQSQLFISSSDRYHFN
FT                   LEPKFKRVILTEMVKFFDDADETIELTRDKDEVFSFTTYGFAYTPEYMPESPARIEVRI
FT                   PLLTAPDIVKKSYSADNLPDGMRLDDNRLVVDYSVFTPEETLDGTRLNTKLRNRIFAKN
FT                   AEQKYLQPFDNVILLEREDGEPVHVFYYYGQPESIELWYRGETKVVDFKLDVETREQKG
FT                   "
FT   gene            83811..84659
FT                   /locus_tag="IL0078"
FT   CDS_pept        83811..84659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0078"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /note="contains internal repeats"
FT                   /db_xref="EnsemblGenomes-Gn:IL0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80921"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ2"
FT                   /protein_id="AAV80921.1"
FT                   /translation="MLKLKTLIAGLVLCLLSASAQAEILYKVTKEDQTIWVYGTLHAAK
FT                   KDLIKLSETAENALKNSETVWFEVHPEKIQSAQALFMQHARRSEGKLSDTVDSETWQQL
FT                   TTQVEKYGMNASALEQLNAWFAQIVIVSQAIAQSGYTAEGGSEGKLFELARNSDIPVKG
FT                   LETVERQIDALRAAQSESGEGELLEQTLAEVEKIEEVFADIQKTWLEGDLDKLTHYLNQ
FT                   NLPPKALDELITKRNNEWITKLAKVNEADTVFVAVGAGHLGGQQGVLEQFEKQGADIQK
FT                   M"
FT   gene            84786..86783
FT                   /locus_tag="IL0079"
FT   CDS_pept        84786..86783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0079"
FT                   /product="Alkaline phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80922"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ1"
FT                   /protein_id="AAV80922.1"
FT                   /translation="MTMKEKKLKIDISGVDPICNKSKGDDFYDVVNRQLSRRSFLKGGL
FT                   GVAVSSFMLSPLMAGCTSSKGTARSSAGLGFQAIAGNRTDVVDVPVGYRAQPFLPWGTP
FT                   LVPGAGEFKTDASNSALDQARQVGSHHDGMHFFPIDVKEGGASSKEGLLVMNHEYVDPQ
FT                   ILHASFSPNAPRPQQEVLKEMMAHGVSVAHIIRKPDGEWQLVEGSPYNRRITASTPMQM
FT                   SGPVAGHDKLVTRFSPDGTKTRGTINNCSHGHTPWGTYLTCEENWAGCFMNDDDTHPRE
FT                   HERYGVNRENSRYYWETATPGLDETLRFNASSTGSTAADDYRNEPNHFGWIVEIDPFNA
FT                   KSTPVKRSMLGRFAHEGIVFAPAVEGEPLVAYSGDDSRFEYIYKFVSAKPYYKATASGE
FT                   LLNEGTLYVAQFNDDGTGRWLPLDIENSEFQAKASEAGVGFHSQADVLLNTRLAADVMG
FT                   ATKMDRPEWGAVHPTTKEVYFSLTNNTRRTEVQTNAVNPRAENAYGHIVRWSEDNQQSA
FT                   ESFHWDIFLMGGEAGTRTPNAEGKDLTLTSNNQFACPDGLWFDHRGTLWIQTDMSGELL
FT                   SEGSFGNNGMYAANPESGELKRFLVGPVDCEITGVVTTPDGKTMFVNVQHPGDRLAPGK
FT                   FSSSWPAGNGARPRSATVIITREDGGVVGA"
FT   gene            complement(86848..87267)
FT                   /locus_tag="IL0080"
FT   CDS_pept        complement(86848..87267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0080"
FT                   /product="OsmC-like organic hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80923"
FT                   /db_xref="GOA:Q5QZZ0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ0"
FT                   /protein_id="AAV80923.1"
FT                   /translation="MDILYKAVATSTGGRDGQSESDDGKLKVKLTTPKELGGAGGDGTN
FT                   PEQLFAAGYSACFIGALKFAAGQEKVKLPKDTEVKAEIGIGQIEGGFGIDATLNIHLPG
FT                   MSQDEAESLAEKAHQVCPYSNATRNNIDVRLNVTV"
FT   gene            complement(87391..87846)
FT                   /locus_tag="IL0081"
FT   CDS_pept        complement(87391..87846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0081"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80924"
FT                   /db_xref="GOA:Q5QZY9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY9"
FT                   /protein_id="AAV80924.1"
FT                   /translation="MADNNSNKALRLDNQLCFALYSTSLAMNKLYKPLLSKLDLTYPQY
FT                   LILLLLWERDGVTITEISRKLFQEKGALSPVIKRLEQRGLITRKRNIDDERQLHLYLTE
FT                   QGRQLEQSACDVPEQVFCATQLEPDEALALKHTLESLRAQLQDKPDH"
FT   gene            88025..89410
FT                   /locus_tag="IL0082"
FT   CDS_pept        88025..89410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0082"
FT                   /product="Xylosidase/arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80925"
FT                   /db_xref="GOA:Q5QZY8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR007934"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR036195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZY8"
FT                   /protein_id="AAV80925.1"
FT                   /translation="MPNKLMTMLGGFVLAASAIGSAVAGNPIIKERFTADPATLVHDGV
FT                   VYLYVGHDEAKEDGDFFVLREWSIYSSENLKDWTLEGAFPRTEFEWAKGDTAWAAQATE
FT                   RDGKFYWYVTVLNDDPAPEKQGFAIGVAVSDDPVNGWKDAIGGPLITADMTESPEFMKD
FT                   EPWDNIDPTVFIDDDGQAYLYWGNTHLYYARLKDNMTELDSEIHKVDINNMPGTFTEAP
FT                   WLHKYQDKYYLTFAMNYPEELAYAVSDSPEGPWEYQGLIMDVLPDSGTSHQAVLEFEEQ
FT                   WYLVYHTAALPTGGNYRRSVSIEHLEYNEDGSIQKITPTASGIHYNAKQLQAFSNKEFL
FT                   TYQGDGAAVAAGEKENYSQLWHLQSLRGEKNTVSFQPEASPGFYLVSENGKLTVSKHDG
FT                   SDSFIANATFKQVEGLSNSEWSSYHLADKPEVYLVLHEGSLKLSKPSSNEEKEAATFRP
FT                   SAP"
FT   gene            89503..90297
FT                   /locus_tag="IL0083"
FT   CDS_pept        89503..90297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0083"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80926"
FT                   /db_xref="GOA:Q5R004"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R004"
FT                   /protein_id="AAV80926.1"
FT                   /translation="MHIDLNGKHAIITGSTAGIGFAIAEGLAKAGANVVITGRTQQRVD
FT                   EAIAKIKKAAPDAGIEGVAADLGTAEGCKTLTEQQPDTDILVNNVGIFGPEDFFEVDDD
FT                   TWQQFFDVNVMSAVRLSRHYAKGMKERDWGRIQFISSESGINIPSEMVHYGMTKSALLS
FT                   ISRGLAKVLSGTQVTVNAILPGPTRSEGVLNMLKDMAEEEGVSQETIESRFVQENRPSS
FT                   IIQRLATPEEVANMSVYVASPQASATTGAALRVEGGIVDTLT"
FT   gene            complement(90301..91110)
FT                   /locus_tag="IL0084"
FT   CDS_pept        complement(90301..91110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0084"
FT                   /product="Calcineurin phosphohydrolase superfamily protein"
FT                   /note="similar to UDP-2,3-diacylglucosamine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80927"
FT                   /db_xref="GOA:Q5R003"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R003"
FT                   /protein_id="AAV80927.1"
FT                   /translation="MPQARLNARTLFISDVHLGSKDCKAEFLLHLLKRVDIERLYLVGD
FT                   IVDFWAMKRQIFWPDQHHKVLQQILAMARNGVEVIYIPGNHDEVMRKYRHPDVASIRIQ
FT                   RQAIHTTADNKRLLVMHGDAFDAETCHSRWLSFVGDHLYDFLLWLNRTTNRIRNLFGHN
FT                   YWSLSAYVKSQIGKAEEVIGRYRAASFRETKKRGLDGIVCGHIHHPELVESDGLLYANT
FT                   GDWVENCTALFENHDGELSLMKYTFSDAQPARLSRFRRRRRAYNNAA"
FT   gene            91519..91809
FT                   /locus_tag="IL0085"
FT   CDS_pept        91519..91809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0085"
FT                   /product="Uncharacterized conserved coiled coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80928"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R002"
FT                   /protein_id="AAV80928.1"
FT                   /translation="MDNKDAFEKKHEAKIEEMKAEIDRLKAKAKQSEAESEIKYEEKIS
FT                   ELEALRNDAETKLEEVKKSSKDAWSDVSKGLESATESLSTALKSASQQFKK"
FT   gene            complement(91825..92064)
FT                   /locus_tag="IL0086"
FT   CDS_pept        complement(91825..92064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0086"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80929"
FT                   /db_xref="GOA:Q5R001"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R001"
FT                   /protein_id="AAV80929.1"
FT                   /translation="MTQEEINSQEWHDESNWSRPLWLGIYFSKKDTRSWVPKFYPMLGW
FT                   TINLGKRAGAAWFIAIIAGALAAAFFAGWLTASK"
FT   gene            92179..92427
FT                   /locus_tag="IL0087"
FT   CDS_pept        92179..92427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0087"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80930"
FT                   /db_xref="GOA:Q5R000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R000"
FT                   /protein_id="AAV80930.1"
FT                   /translation="MSSLLNWMKTLGTIPLALCVLFVVFLPSILFAAFIVWIFDLLFLD
FT                   LAWMSWSTFWWILGVWVVTMIIALAGQADKILFGTPK"
FT   gene            complement(92429..94399)
FT                   /locus_tag="IL0088"
FT   CDS_pept        complement(92429..94399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0088"
FT                   /product="Alkaline phosphatase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80931"
FT                   /db_xref="GOA:Q5QZZ9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ9"
FT                   /protein_id="AAV80931.1"
FT                   /translation="MIKPILPIAELLRPIFLFFVSALALLSGFRFLHFSLYSNRVSEAI
FT                   GLGEFFILGLRADLMQVSYFIIIPFLAFPLFIPFMNRYRVQSLWYRAALLWFTLCFIIL
FT                   WFMEISTPAFLAQYDTRPNRLFFEYLEYPAEVFSTLWNGFKTWLMIGAASTLLTIYILK
FT                   RIARIIAQRFQPEPMRRRYLLGVYPLLLVMVVLGIRSTLAHRPANPAFFAVTSDAMVNS
FT                   LILNSTYTLEYALYNLKHESKANLIYGDMKTDEVLTTVKQNTHLKEYEFPYKDYPTVHF
FT                   QPATRKREKPLNIVIILEESLGATFVESLGGVPVTPNLERLKSDGWWFERLYATGTRSV
FT                   RGIEAVVSGFLPTRARSTVKLSNSQRQFFTLADVLSRQGYFTEFIYGGQAHFDNMANFF
FT                   VGNGFQSIIDQDDYKTPNFTGSWGVSDEDLFNKLHQRLVVNTAKHPTFTLAFSSSNHEP
FT                   FKFPDNTIKLHEEPKNTVNNAVKYADYALGEFFRKARQSNYWDNTLFLVVADHDTRVYG
FT                   DDLIPVNKFHIPGLILGADLEPRTIKSTASQIDLAPTLLSLAGVSAYLPTVGQDLSRTD
FT                   KAPGNRAMMQFGDNYGWLEGETLTVLRVNKPTEHYRYIPEVDKQEPIEDPLSPEQLKKI
FT                   RAFAMLPSILYQSREYYVPKD"
FT   gene            94523..94882
FT                   /locus_tag="IL0089"
FT   CDS_pept        94523..94882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0089"
FT                   /product="Diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80932"
FT                   /db_xref="GOA:Q5QZZ8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ8"
FT                   /protein_id="AAV80932.1"
FT                   /translation="MKPGKKGLERIWYATFNSLRGLKSAWQYEAAFRQEALMCLILVPV
FT                   AFYVEASLAERLLLLASLFILLITELLNSAVEAVVDRVGAEFHELSGRSKDLASAAVFF
FT                   ALLFMLVVWVSILFF"
FT   gene            95027..95629
FT                   /locus_tag="IL0090"
FT   CDS_pept        95027..95629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0090"
FT                   /product="Thermostable hemolysin related protein"
FT                   /note="belongs to Acyl-CoA N-acyltransferase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80933"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022050"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZZ7"
FT                   /protein_id="AAV80933.1"
FT                   /translation="MRYQWVTTTQANRSSVEAFICERYWLNFNACLSQLPEVLLALYEN
FT                   DTLVAACGIQFAEQKPLFSEFYLDKPLQQYSVGNKPMPALENIAEVGSMAALAPPYLPL
FT                   LFQAVIDSLLSRGITAVVFTATRALQKYFARQGIELTLLAEAKKNALPESVRDIWGNYY
FT                   EHTPLVLGGWLSQGHALFTKQRPASVFRSTVGAASCL"
FT   gene            95620..96969
FT                   /locus_tag="IL0091"
FT   CDS_pept        95620..96969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0091"
FT                   /product="Long-chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80934"
FT                   /db_xref="GOA:Q5R012"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R012"
FT                   /protein_id="AAV80934.1"
FT                   /translation="MPVTEFFDQLQAHAKSNPNQLSVSDEQTAITYHTLLSRVAARRDY
FT                   YLQQPDPVVLIDKPNSIDWVIDDLALLWAGKVSVPVPPFFTEQQKQHLVQQTLSSPQLP
FT                   SMTAKITYTSGTTGEPKGVCLAAASQMETVKALAERLGAVKVKRHMVLMPLAVLLENIA
FT                   GVYLSLWLGNEVVLVGSETLGLKGSSSLCAESFFAALRLYQPDSLILTPALLAAIVSGV
FT                   EQGLLDSQQFKLLAIGGAKLPLPLESKALALGLPLVHGYGLSEFCSVVALNSPDRPVVA
FT                   SVGKPLPHAQVTIDEGEVVVSGNCMLGYLGEPDSWYPKRIRTGDLGSWDAEGNLRIGGR
FT                   IKNIIITAFGRNVDPEWPEALLSLQPNIRQAAIWGSEELPITALLYSPENIDSVAARVK
FT                   AVNQQLPDYAQIERYFLITEPFSQANQQLTGTGRLRRQQIANDYSELLTL"
FT   gene            96979..97656
FT                   /locus_tag="IL0092"
FT   CDS_pept        96979..97656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0092"
FT                   /product="Heme oxygenase related enzyme"
FT                   /note="probably involved in regulation of extracellular
FT                   enzyme genes (tenA-like)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80935"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R011"
FT                   /protein_id="AAV80935.1"
FT                   /translation="MSFFNTLCEQTQTEQQYLLSARPIQQALQGDISLPRYQAFLSQAY
FT                   HHVKHTVPLLMRCGSRLSLNDEWLRKAVIEYIGEEYGHERWILNDLDAAGGDVDMVQNS
FT                   EPHTPTQAMVSLVYNAIDNVHPTAFFGMAHVLEGTSVKLATAAAHKIQSTLGLPESAFS
FT                   YLLSHGDLDQDHVQFFEQLMNRVEDADAQRAIIQTAKHVYRLYGDMFRALPELAGEQPE
FT                   ASV"
FT   gene            97653..98450
FT                   /locus_tag="IL0093"
FT   CDS_pept        97653..98450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0093"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:IL0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80936"
FT                   /db_xref="GOA:Q5R010"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R010"
FT                   /protein_id="AAV80936.1"
FT                   /translation="MSKINWKSQSIVLTGACGGLGIQLAELLSAKGAKLLLLGRSEPEL
FT                   TALAAHLQQDCFVLDLCASDAISHLHQFIEQKNLRITGLINNAATTHEGLLEDATSEDI
FT                   QRVIDTNLTVPVALIHRLLPRLRANHGWVMNIGSVFGAIGFPGQALYCASKFGLRGFSE
FT                   ALQRELQPEDVRVLYCAPRAIQTQLNNGVISRLNQQLKTSADAPEWVAQQIVHQIEQQQ
FT                   PLKTLGWPEKLFARLNGLLPELVNRSMKKPRILLHQLIKEKSL"
FT   gene            98447..99100
FT                   /locus_tag="IL0094"
FT   CDS_pept        98447..99100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0094"
FT                   /product="TPR repeats containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80937"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R009"
FT                   /protein_id="AAV80937.1"
FT                   /translation="MKPITVLVTSMALAVTLYLSPVAAEEVSQLLSVQQRWAEVNYKIE
FT                   GDEQLKAFEELSAQAEKWVEQEPDNAEAHIWLGIIKSTQAGAEGGLSALGLAKDARKSL
FT                   QRALQLDPQALQGSAYASLGTLYYKVPGWPFGFGDDDKASELLQRALEINPNGIDPNYF
FT                   YADYLYEQGKYSDARKYAEHALSAEVREQRPLADAERRKEVQALLKKIHHELKR"
FT   gene            99109..99771
FT                   /gene="qseB_1"
FT                   /locus_tag="IL0095"
FT   CDS_pept        99109..99771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB_1"
FT                   /locus_tag="IL0095"
FT                   /product="Response regulator (CheY,wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80938"
FT                   /db_xref="GOA:Q5R008"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R008"
FT                   /protein_id="AAV80938.1"
FT                   /translation="MELLLVEDDAMLGQAVELGLSERQFLVQRVRTGAAAISELNRTHY
FT                   DAVVLDLGLPDLDGTRVLASLRKKGMTLPVLVLTARDQSSEIVKQLDNGADDYMIKPFD
FT                   MNELAARLRALVRRQRGYASPELKVGDIVLDDANHSVVVEGLAVNLSRREFELLKALMS
FT                   APERVHSRDKLEQVVFQNEAQVESNALEVHVHNLRKKLGHKEWIQTIRGIGYRLQCN"
FT   gene            99882..101105
FT                   /gene="qseC_1"
FT                   /locus_tag="IL0096"
FT   CDS_pept        99882..101105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC_1"
FT                   /locus_tag="IL0096"
FT                   /product="Signal transduction histidine kinase (contains
FT                   HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80939"
FT                   /db_xref="GOA:Q5R007"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R007"
FT                   /protein_id="AAV80939.1"
FT                   /translation="MSHEVDELFDAEMLQQAKTLSAFMSVNSERLPEAGVIIESIGAHN
FT                   YEDKLSYRIENTEELLLMQTEGAPDASAFEFIPGFSVKRVKDELWHAFGLENATGQRIL
FT                   MLQEDGFRSELRMDLTVDTVIPILLILPFMLWLGWWTINRNFSSFNRLAGELRRKRADD
FT                   YTNFVEDNDREEVALVKRSLNHYINRIEQTFLREKRFSADAAHELRTPLASLKAQIQSR
FT                   LGSATSEQQNELQPLLDSTERLVKLVESLLQLSKAELPPEQLKQVNVASVLRQVLADQY
FT                   VAAESKGLSYHAQLPTVFQQTSDESYLYLLFANALDNAIKYAVPGSHIGIEVTENQIFV
FT                   CNRVAADHVIDIDRITERFYRGKQLDVEGSGLGLSIVRNLAEQLGVQINFRHIDDEFCF
FT                   IVTFDTDQ"
FT   gene            101199..101708
FT                   /locus_tag="IL0097"
FT   CDS_pept        101199..101708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0097"
FT                   /product="Cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:IL0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80940"
FT                   /db_xref="GOA:Q5R006"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R006"
FT                   /protein_id="AAV80940.1"
FT                   /translation="MDIRYSGLSRINHWFSVIFVVVMLTLGYMMFFANDRASGSYAEAA
FT                   HIGVGFFAFWFLLWRTIYRLKMGFPAHKKQDRRHEFARVVHYLILLGLTLLIITGPLYL
FT                   FTENEGLAVFDWFTVNLDLTALSIVHEPAEEVHKITGLYVLPVLLVVHIAGAVVTYLSD
FT                   EGAARS"
FT   gene            complement(101703..102281)
FT                   /gene="araC"
FT                   /locus_tag="IL0098"
FT   CDS_pept        complement(101703..102281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="IL0098"
FT                   /product="AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80941"
FT                   /db_xref="GOA:Q5R005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R005"
FT                   /protein_id="AAV80941.1"
FT                   /translation="MLGRARGLAINQWHVALPDDISPLPTWKKWVKKVSSRPICGLSIP
FT                   AEQLQEHSPERNLAQYHQALSFCQMQHQTQARASVMLSVFKWLDYQLETGHDASLTELA
FT                   AEIGISLSSCKRLLASHGYSFQQIYDLVRLHKLLNLLQKHPYSNVELAQKLGYSNPNNF
FT                   RRACKRWLGIVPEELRQQQSALFISNSAL"
FT   gene            complement(102352..102750)
FT                   /locus_tag="IL0099"
FT   CDS_pept        complement(102352..102750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0099"
FT                   /product="Uncharacterized conserved domain often associated
FT                   with AraC-type DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80942"
FT                   /db_xref="GOA:Q5R020"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R020"
FT                   /protein_id="AAV80942.1"
FT                   /translation="MRLWPTNDQRRLLGKPFIRALLPLAERRGISSSELFRGTSLSEQK
FT                   LQINNFRLTDHEMLLLLASAEEKINDPHLWQLVVETLFSDRLNPLIDLTVHAKTLKQAL
FT                   IHLSRFQSLLQPFLFTPTQRLTTGLYSG"
FT   gene            complement(102731..103636)
FT                   /locus_tag="IL0100"
FT   CDS_pept        complement(102731..103636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0100"
FT                   /product="Signaling protein with membrane-bound sensor
FT                   domain and GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80943"
FT                   /db_xref="GOA:Q5R019"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R019"
FT                   /protein_id="AAV80943.1"
FT                   /translation="MQLINLRYISNWRVLLIAVVVLLCLLLSSQLGVVKPYEIVDPLDI
FT                   LGEGSTLFLTILIVIFMVTDRPRGNVTNLFYSGGLLLIFSMTLDVLDEFFRYPDALRLL
FT                   SWLESFPLPVGLIIISFAAAEWRRENKMLSRQLMVREKNLRSHQWVDPLTSLYTTPYFI
FT                   KLVEREIALQNSTDAESTVLVSVNFKNFAQYNHEMGTKAGDELLHQASELMVLLLRPQD
FT                   CLCREHSDHFLILLPQTRLSQADRLMKVIAQNLNSELELPNYMSVEVHTHRVEELSAVD
FT                   AITALHTQVEEMTHYAPLAN"
FT   gene            103833..106379
FT                   /locus_tag="IL0101"
FT   CDS_pept        103833..106379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0101"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80944"
FT                   /db_xref="GOA:Q5R018"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R018"
FT                   /protein_id="AAV80944.1"
FT                   /translation="MIMKKTYLAWLIAVSCGATSPLMAQETQDQSADKTAEEKRIEEVL
FT                   TIGYSDSIKRAVQEQRESSGIINVLKKDDMGKLQDDSVSDALQRIPGLSVERDQGEGRF
FT                   IRIRGLAPDLNSVSYNGTSLAAPEAGRRAVALDVIPADLLESVVVNKTLTPDISAGSLG
FT                   GNIELQSMTAFDREGSFYSFTADVGYNEQASETNPKVSGVVSNTFDVGDKADSFGIAFA
FT                   GSYQDRSFTTDNVETGGNWDLDEPGLEEFEQRAYSVTRERTGLALNLDYRPSDDSEFYL
FT                   RSLYSEFADTEIRQGIVTEFSDPIGAEASAGGEIVRELKDRKETQEITAIVLGTKQKFD
FT                   DWHVTLEAGTSKASEDQPFAIGGAKFTQEFDEGLGYSGLKRLQLNAPDTAYQASEYEID
FT                   EVEVSDAYTEETEKNVKLDVAYDWLQPSYQVTFKGGVKLSQRENSAEENIFIMKDFADL
FT                   GVTGLTLADYETSSNVEYGLDRFGPGASAGKLWDMINTFELQNFRDEVESRIASYEIDE
FT                   DISAGYLMADMGFGKWQVIAGARYEHEEREGRGNRYDDELETFTPVSDKFSDANWLPSV
FT                   VTRYDLSNDTIIRAAYSTGLVRPNFEQVRSSYYLENDDGDLKAEFGNPDLEPLTTQNLD
FT                   FGIEHYDETLGVISAMAFYKDIKNFVYEADVAGRPGYENFDEAVTYINGDDAYVYGLEV
FT                   NFVHQVSGFNNWLDNFLINTNLTFTDSEATVDWIDDGQLVSRDITLPSQSDTTANFALG
FT                   YEVYDVSLRLAANYKSKYLAELGDVEDSRYDIYEDDNLTLDFSAKWLINDHVSLSFAAN
FT                   NITDEPYYVYTGQKRYNAQYESYGRSFTLGVQLINW"
FT   gene            106421..108217
FT                   /locus_tag="IL0102"
FT   CDS_pept        106421..108217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0102"
FT                   /product="3-phytase"
FT                   /note="myo-inositol-hexaphosphate 3-phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80945"
FT                   /db_xref="GOA:Q5R017"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R017"
FT                   /protein_id="AAV80945.1"
FT                   /translation="MILSAVASSLMLLAACGTSATETNVRHKVALNNDYLKVTADGLSL
FT                   GDKRVAEGDFFHLRTLPLSNGETLIGAMEGNTQELVLWRASGKAIQPVWKGEITSRVVE
FT                   DICFYESYENQQLSVFLLGGRGGAEQRLLKQDEKWLKEPLVIRNMNVPFDSTACVVSNA
FT                   EQKLYVAEADQAVWAYNAEPEVDQGRDLIAAAKPFGVIEGEVKALELLDDGSLLVLEEE
FT                   PPRLLVYRQNEQGFKFDKAFAIDDAEALTDVSDLGNGELLLTEEDMTATSKLTIDTLES
FT                   KQRSVKKPVSQVEATLQTEPSPLRGDAIDDPAVWVHPEAPEKSRIMATDKRTGLYVYDM
FT                   SGNIVQEFPVGRLNNVDVRGSWAVASLRDNNSLQLFDISADGELSVGTNALTDIDEIYG
FT                   LCMGYNESTEQTSVYVNGKSGVIQQFVISNDGKMEKVRELSVPSQPEGCVVDDKTQRLF
FT                   VGEEDVAVWLFDAAADGSTSGEAIINVDQHEELVDDIEGVTFARVNGRDLLFVSSQGND
FT                   SYIVFEGQAPWSLLSHFRIRTNTELAIDGASETDGIDVTTRSLGKGFEQGAFMVQDGRN
FT                   RMPEAGQNLKLVPLENILKTIK"
FT   gene            108373..109719
FT                   /gene="pncB"
FT                   /locus_tag="IL0103"
FT   CDS_pept        108373..109719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="IL0103"
FT                   /product="Nicotinic acid phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80946"
FT                   /db_xref="GOA:Q5R016"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R016"
FT                   /protein_id="AAV80946.1"
FT                   /translation="MTGTERQDLGLFTDLYQLTMLDAYLQEGMQDDAVFTLFVRRLPNE
FT                   RKFLLAAGLDPLLETIENLSFSDDDLRYLKEQNFSQQLIDYLRDFEFTGQVRALPEGTV
FT                   FFENEPIVEIKAPLPQAQLIETLVMNQIHLQTLLASKGARVAHAAEKRPVLDFGARRVH
FT                   GIDAGKKGSRALYLSGIAATSNMLAARTYGLPVAGTMAHSYIQAHDSEYQALKNFTQVF
FT                   PETVLLVDTIDTLKGVEKVIQLANELGDDFKVKGIRLDSGDLGDLAVKARKLLDEHNLH
FT                   HLEIIASGGLDEHKIAQLIADRAPIDGFGVGTGMGVSDDAAALDMAYKLVEYAGKGRLK
FT                   LSSGKPVLPGEKQVFRESGDNFRRDTIARAEEQLPGEPLLKKVMQSGKRLPSHQRDIEE
FT                   IRQYAQQQLNKLPEYVSSISSKEKSYPIEISDKLASYQKEITEHLKQEG"
FT   gene            109745..110302
FT                   /locus_tag="IL0104"
FT   CDS_pept        109745..110302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0104"
FT                   /product="Pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80947"
FT                   /db_xref="GOA:Q5R015"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R015"
FT                   /protein_id="AAV80947.1"
FT                   /translation="MKATFEQNDALIIVDVQNDFCPGGKLALDEGDEVVPVINALSAQA
FT                   QEAGIPVFVSRDWHPRHHVSFDERGGPWPEHCVQDTKGAEFHPDLILPENARLVSKGAR
FT                   FDIDQYSAFDKTGLVSELVHLNIKRVWVVGLALEVCVKATALDATKNDYETFLVEEGTR
FT                   FIDRADAEKAREELREAGVIFK"
FT   gene            complement(110314..110817)
FT                   /locus_tag="IL0105"
FT   CDS_pept        complement(110314..110817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0105"
FT                   /product="Predicted phosphatase"
FT                   /note="similar to the C-terminal domain of histone
FT                   macro-H2A1"
FT                   /db_xref="EnsemblGenomes-Gn:IL0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80948"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R014"
FT                   /protein_id="AAV80948.1"
FT                   /translation="MKYECVHGDINQQTEIEAIVNAANAKLQTGGGVAGAIHRAAGPEL
FT                   EKATRSLAPIKPGEAVITEAFDLPNKYVIHCLGPVYGSDEPSDKLLADCYKNALDLTEK
FT                   HKVESIAFPAISTGAFGYPFEEATDLAIKTVKAHVEKLSHLKMIRFVLFSDSDFAYYQQ
FT                   ALNN"
FT   gene            complement(110862..111509)
FT                   /locus_tag="IL0106"
FT   CDS_pept        complement(110862..111509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0106"
FT                   /product="N-terminal Zn-ribbon domain fused to
FT                   SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80949"
FT                   /db_xref="GOA:Q5R013"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R013"
FT                   /protein_id="AAV80949.1"
FT                   /translation="MQCTLCSSISQPFCADKKRQYFRCTECDLIFADPDTLLSQTEEKL
FT                   IYDYHENGPNDIGYCEFLNHLTTPLLDKLSPGMKGLDFGSGPGPTLNLMLEEQGMKMSV
FT                   YDIYYAPDTGQLSRQYDFVTCTEVAEHFREPDKSWAQLIGLVKPGGWLGVMTCMFTKET
FT                   ADDFNLWSYKGDPTHISFYTPKTIQWIARHFRLELEIVNDRVILFRKNKVAL"
FT   gene            111577..111858
FT                   /locus_tag="IL0107"
FT   CDS_pept        111577..111858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0107"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80950"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC4"
FT                   /protein_id="AAV80950.1"
FT                   /translation="MYKHIFFIASVLLLSACGATKPEPYEKDVSPENREKYSGAEGMEQ
FT                   YQKDQSYIMNKELADKCASAKMELLIAESEENIKEMEKQKEIIEDTCV"
FT   gene            112099..114276
FT                   /gene="katG"
FT                   /locus_tag="IL0108"
FT   CDS_pept        112099..114276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="IL0108"
FT                   /product="Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80951"
FT                   /db_xref="GOA:Q5QXC3"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXC3"
FT                   /protein_id="AAV80951.1"
FT                   /translation="MTKSSGGGKCPIMHGSMTSEKKTNTHWWPNSLKLEILRQHDTKAN
FT                   PLDEDFNYAEEFKKINLEELKQDLKNFMTDSQEWWPADWGHYGGLMIRMAWHSAGSYRL
FT                   ADGRGGGGTGNQRFAPLNSWPDNVSLDKARRLLWPIKKKYGNKLSWADLFILAGNMAYE
FT                   SMGLKTFGFAGGREDIWHPEEDTYWGSEKEWLAETKNRYSSDEERDSLENPLAAVQMGL
FT                   IYVNPEGVDGNPDPLRTAKDVRETFKRMAMNDEETCALTAGGHTVGKCHGNGKEENLGP
FT                   EPEAADVEEQGMGWRNSGGKGVGRDTMSSGIEGAWTTNPTQWDNGYFYLLFNYEWELKK
FT                   SPAGAWQWEPIDIKEEDKPVDVEDPSIRHNPIMTDADMAMKMDPDYRKIAEKFYKDPEY
FT                   FADVFARAWFKLTHRDLGPKDRYLGADVPEEDLIWQDPIPKVDYSLSEQEIADLKEKLL
FT                   NTELTSYELISTAWDSARNFRCSDFRGGANGARIRLAPQKDWHGNEPEKLHKVLRVLED
FT                   LQSTLDKKVSLADLIVLGGTAAVEKAAKDAGYNVTVPFAPGRGDATDEQTDVESFEPLE
FT                   PLHDGYRNYLKKDYAVPAEELMLDRTHLMGLTAPEMTVLVGGMRALGANYGESEHGVFT
FT                   DRVGTLTNDFFVNLTDMNNVWKKADDHYEVRDRKTDELKWTASRIDLVFGSNSILRSYS
FT                   ELYAQDDNQEKFVKDFVKAWTKVMNADRFDL"
FT   gene            complement(114361..116556)
FT                   /locus_tag="IL0109"
FT   CDS_pept        complement(114361..116556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0109"
FT                   /product="Outer membrane protein"
FT                   /note="probably involved in iron transport"
FT                   /db_xref="EnsemblGenomes-Gn:IL0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80952"
FT                   /db_xref="GOA:Q5QXC2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC2"
FT                   /protein_id="AAV80952.1"
FT                   /translation="MDQSQKDGLEIIKVQGEKRERSLSETTSSVAVTTAQKIDQENLLD
FT                   LSDIITRTANVSETYGGSGFTIRGISDEGSSANPLATVYVDGVAIPSQVNDAGPTDLWD
FT                   IAQVEILRGSQSTVQGENSLAGAIIISTQDPTMDWTWKTRAIWSDPNDRRLAFAGGGPI
FT                   IDDELAFRVAVEKRDFDGYTKNITRNEMEDSVDSLVTRLKVLWNPAGLRDFTAKLNFMR
FT                   DDREDPYRFSYTRYDVENYYDNRVATSDHENVTDITTDIVSLDLSYELSEHWSLASVTS
FT                   QSDSDSLRLYDIDLTEKDERYGEMNHDYKNQSQEIRLSFDYPDFHGLFGGYWSNREKDA
FT                   MDNQLAGVATPVTTIVDVLQNMGLDETTATQFANSYSQELPLIPVDYESDVYDRSTNRA
FT                   IFADVEYALAENIALIAGFRYDTERYTYESLTETAFAGTLPDPTNYGEPGTAPHSIISG
FT                   INQEVLNLVDRAGNSIPESTRDFNAFLPKLAVRWDYDNNDSLALTVQRAYRSGGSSYNI
FT                   ARAEVFAYDPEFTTNYELAWRSHLLDNSLFVSSNLYYIDWEDKQVSANFGLNSFDSHTV
FT                   NAGKAHLYGMELEARQYVNSYMDWYGSYSYSRTQYDQFEAIAGAQVRNFSGTEFIYAPK
FT                   HTAALGVNLYPARDWTVNVNANYRDSVLMSTRETDSRVSSRTLFNAKISYDKFDWSAYI
FT                   FANNIFDKGYIEYARTDVPLAIFGAPRVIGVGFEAEF"
FT   gene            116851..117525
FT                   /locus_tag="IL0110"
FT   CDS_pept        116851..117525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0110"
FT                   /product="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:IL0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80953"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC1"
FT                   /protein_id="AAV80953.1"
FT                   /translation="MSKVLLITGASSGIGEASARKAAKEGLKLILTARRKEKLDALVKE
FT                   FGADNAIGVAADAGNYDQLAEAVKQGVDKFGQLDAVFANAGTGVSTAGTEEGDPDEWKS
FT                   MVDVNINGLLYTAKLTLPHLRKTTGHFLMTGSAAGRITLKGSVYGATKWFVHGFAQNLA
FT                   EEMKEWNGRCTTIAPGMVNTPFFDEPKPDKLAPEDVADAVLYSINANPRNCVREVFLMP
FT                   AY"
FT   gene            117640..119541
FT                   /locus_tag="IL0111"
FT   CDS_pept        117640..119541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0111"
FT                   /product="High-affinity Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80954"
FT                   /db_xref="GOA:Q5QXC0"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC0"
FT                   /protein_id="AAV80954.1"
FT                   /translation="MFSRFFFPIALIGTLLFSGQALASSSADTQSSDMRQLLQLAEYVG
FT                   VDYSEAVANGEVINPDEYSEMTEFAGLIGEKTEQAPQAVQAEMRQLVNKLKQLIHDKAD
FT                   PEAVVTLTSELRNTLLSALPKLSLPSKLASEKHVEQLFQQNCSACHGAAGQGDGPGATG
FT                   LEPAPTNFTDRERANNRSLLGLFDAVSDGIDGTAMASFSHLSEEERWALTFYVGSLAFN
FT                   DSADSEQKVALSELINYSPNTLLQRGISSNAIDYSRTHARDYFSESSVNSPIAIARTTL
FT                   GQALKAYQQDNYSEAKRLAISAYLDGFELAENSLNAKAPELMRTIERDMMALRGVISKP
FT                   GKLQQVEQMTAKLQQELDVAANTLSEDKLSESALFAASAVILLREGLEALLIVLAIGTV
FT                   LARSGRKDGLRYVHAGWITALIAGVGTWLVAEYFISISGASREIIEGGAALLAAVILFY
FT                   VGYWMHSKTQSQQWQRFIQEKVQTQLKQGALWGLAGLAFLAVYREVFETVLFYQSLLLQ
FT                   AQDNGSSVAYGFVFGLVVLAVVAWAVIKYSVKLPMNTFFKFTTYIILALVFVLLGKGVS
FT                   ALQEAAWFSHTAFPVDVTFDWLGIYASWETLGAQLVYLILVMALFKRQVSSKLNKVV"
FT   gene            complement(119656..121773)
FT                   /locus_tag="IL0112"
FT   CDS_pept        complement(119656..121773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0112"
FT                   /product="Outer membrane protein"
FT                   /note="probably involved in iron transport"
FT                   /db_xref="EnsemblGenomes-Gn:IL0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80955"
FT                   /db_xref="GOA:Q5QXD3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD3"
FT                   /protein_id="AAV80955.1"
FT                   /translation="MNKRHKTTRGFAKSLLATAIFATLQATVYAADLAKPTLETDEILV
FT                   VTGSRSKEKLEDVAGAVSVVTAEEIDIQVSNSLSDIFRYDPSISSTGSQGQAQTLSIRG
FT                   IGGNRVVYIKDGRRLNDAYAGGGGYLVGRGYLDVSQLSQVEVAKAAASPLYGSDGLGGV
FT                   IVLTTPDPDDLLQGESNALSLQAGFDSIADERSLGVQAAKQFSGSQASIQLTARKGNET
FT                   QNYEESLPEFDYDSVGVLAKWAIALENNNELKFTLDHYQQNNEQLQEPPEQTEDEDKQT
FT                   AFSIDYLNNSSNWLTDTQNWQLYLSHYEQNSDQIVQGADQGGPYIDNNDYGFEQRIIGA
FT                   RWQGETLLSGNQVEQDLVFGFDVDYYDTERPRFKTRTAADGTLLQDNEPQKAFPGAETW
FT                   LAGLFLQDNIQLKDSPIKFIAGVRIDHYRMTPQDNALYDMSLLSDVRETALSPKLAAIY
FT                   TFSNDIRGYVQYAEGFKIPPHDQAYQNHGIEPFYAILPNPDLDPESSRSLETGLKFADN
FT                   NTRWNLSAFYSKFDDFIDTQVVGTSPTYIPGVDRVEYQYVNKDEVTIKGVEASVTHWLN
FT                   DNIQLASSVAYTTGKDETTDDYLTTLSPLSGNASVGYHGNDWYVRGVVTAVNSMSRVPT
FT                   DESIQTPGYATVDILVGISLTNWQVNLAARNLTDKYYVPYQSVAGLQSEASTEQYSQPG
FT                   RSFGVQVKYTF"
FT   gene            121913..122779
FT                   /gene="hmuT"
FT                   /locus_tag="IL0113"
FT   CDS_pept        121913..122779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="IL0113"
FT                   /product="ABC-type hemin transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80956"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD2"
FT                   /protein_id="AAV80956.1"
FT                   /translation="MTGRQFLVHAGAAFLLLFSWFGQAEDTLDTDVNQLITAGGTLTDI
FT                   VFALHKDDSLIGVDTSSTSPAAVNRLPKVGYYRNLSAEGVLSFEPEHLWVLEGGGSDKV
FT                   LQQIERAGVSVVVFDKPTSLQELYELIENMADRFGAQAEGKQVIAGIKSDLTTTSSRKE
FT                   PLKALFVLQASERGVVAAGTDTVPDLLFSYSDINNVFSHVGFKTVSTEYLLAEQPDFLV
FT                   APEHVVKSHGSKEAFCQAQALKLLEAGKNCRVLVMDSLLALGMTTRIAEAQRVVAEFAN
FT                   ELAAGRE"
FT   gene            122784..123800
FT                   /gene="hmuU"
FT                   /locus_tag="IL0114"
FT   CDS_pept        122784..123800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="IL0114"
FT                   /product="ABC-type hemin transport system, pemease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80957"
FT                   /db_xref="GOA:Q5QXD1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD1"
FT                   /protein_id="AAV80957.1"
FT                   /translation="MPLERRYWLLVGVMGIAVSSVLLLSSGPVMSDWRLPFIWLPGVLS
FT                   EATDIQKTVLIDIRLPRLVLGLMVGAVLAQSGTAMQTLCRNPLADPGLIGISGGAAVFA
FT                   LAVIALGPEFGLQGQLWVSGAAFTGALLTTFVVYHLAGGRSGVHVATLLLAGVAINALA
FT                   GSILGLLSYYANDDALRLMSFWQMGSLAGADWQQLPLGFLFMGVSCVALFIHRRAINTL
FT                   LLGERQARYLGVNVGTLKRRIIFFVALGVGGAVALTGMIGFIGLIIPHIARMLVGANVR
FT                   WLMPVSMLFGAAILVLTDWLAKTLVAPAELPIGIITAAIGAPFFIYLLMKQRRRFYA"
FT   gene            123793..124569
FT                   /gene="hmuV"
FT                   /locus_tag="IL0115"
FT   CDS_pept        123793..124569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="IL0115"
FT                   /product="ABC-type hemin transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80958"
FT                   /db_xref="GOA:Q5QXD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXD0"
FT                   /protein_id="AAV80958.1"
FT                   /translation="MLDIDVSNLSIGRQQVLTSLNLSLEAHQFVAIVGENGAGKSTFLN
FT                   MLAGELPYNGSIYLNGRELNSWDALKLAPIRAVMEQHQAAPEGLSVKELVAMGRYWSQE
FT                   SDADAEQRATQWLSRFDLTPMGERGIETLSGGEQQRAHLARCLCQLDKDLPGEQLLLLD
FT                   EPTSALDVYHQHAVLHEIKSFSQKGNLVLSVMHDLNLASLYADQVIVLGNNCIQHVDSP
FT                   ESVFREDILERTYRTPVHVSSHPSFLKPMIFTEPRH"
FT   gene            124583..125317
FT                   /locus_tag="IL0116"
FT   CDS_pept        124583..125317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0116"
FT                   /product="Uncharacterized metal-binding protein"
FT                   /note="involved in heme iron utilization"
FT                   /db_xref="EnsemblGenomes-Gn:IL0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80959"
FT                   /db_xref="GOA:Q5QXC9"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC9"
FT                   /protein_id="AAV80959.1"
FT                   /translation="MNERIKAAREARVLAQNSDTAVLSTISKKLMGYPFGSVSPFMLSA
FT                   EGQVIFYVSDIAQHARNLSVDNRLSITVFDAAESGDQNTHGRLTLTGNARFLVDESLGE
FT                   LYFQRFPDALSYRNAHDFKFWQMDVEHIRYIGGFGKIFWINPAEWLLPEPQWNSTDALQ
FT                   MIQHMNDDHADACGLILRHQKVEFRNYAGSVKMSSIYPDGFHLIADERSVFIPFETDCV
FT                   TSGEVRKQLVKMTNAARNVIAA"
FT   gene            125461..128283
FT                   /locus_tag="IL0117"
FT   CDS_pept        125461..128283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0117"
FT                   /product="Outer membrane protein"
FT                   /note="probably involved in iron transport"
FT                   /db_xref="EnsemblGenomes-Gn:IL0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80960"
FT                   /db_xref="GOA:Q5QXC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC8"
FT                   /protein_id="AAV80960.1"
FT                   /translation="MKARKYRNKNSVSKKTKLSQAVQQVLLGMALSSSAYALQAQELNE
FT                   NDSAEKDDIEVIAVSGSYVKSLEKAVDIKRSNISFSDSIVATDIADFPEQNLAEALQRM
FT                   PGVTIERNKGLGSRVNVRSLPTEFTHVSINGLATASGSGGRDVEFDIFASEIIQSVTVK
FT                   KSPTAADEEGGIAGSVLISTARPFDYDETQLVASVEAAHNSISEEVDPKFSFLASDTFG
FT                   DWGALVSFSRSERTNRTDSNSGIDFRPLSRWTEKSGDSQWQSDQTIAVLERDTGVVIDD
FT                   PLDSDETGRAVFMNKVGDRAYLNEQEKWGATASIQYKPSNDFSLTLDAMLGGYDNTEDE
FT                   YDAAAYSASSVSALERIHEYDDTTFSEYGMVVLSDVSYAATQHEFLSKENVHETDFSQL
FT                   SLSLDWQLGEWTVTGLMGYSGAEKTSDRTNLKHTAYAPSRTRYTSTGGETIPSDNPDTI
FT                   DMYNSPGSYLFDFYDVDLEEITDDKYAAQFDFSRGIFWDAFPALAKVQFGARYTDKSKE
FT                   RNLGNVQVKGPTAGDSSWSGERTLEDSELTLISDLVPGGAYLPEVEGKGGWSQVSNGYA
FT                   RNEFRYDGFNVPFQDNQFYRVDEEVLSIYAMADFEFNIGQFPVSLNTGVRAVDTSVLSF
FT                   GYHQVQMPDGSTGYTDEPVSKKGSYTEVLPSLNMVVELSDSVLLRAAASETFIRPALGD
FT                   IAYKRTVSVNEFKYFDGNPDLKPTYADQWELGVEWYLDNGGILAASYFDKTVEGVVRES
FT                   LTGVVKDVTKYNDNGTLDGVYDFDVYQKVNDEGSYDVSGIELIAQFPLKALHSSLEGFG
FT                   INSNYTKLDNSLTGSSDLGIPTPPPGLAETTYNFTAYYENNSFDARVSYNYKDDYVERI
FT                   ERSMYPVYRDAYGQVDVSLGYKINDSIKVVVEGINVTDEATKGYTMDPKFPTMYEFSGR
FT                   RISLGIRGSI"
FT   gene            128308..130269
FT                   /locus_tag="IL0118"
FT   CDS_pept        128308..130269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0118"
FT                   /product="Calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80961"
FT                   /db_xref="GOA:Q5QXC7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC7"
FT                   /protein_id="AAV80961.1"
FT                   /translation="MLLALLFMAAQVKADNKEVPAVAFMPDIHFHDVYADFNDGSFKGL
FT                   PNSRSKDHATIRTMQAQLHSTRLFNENYFALLAALDDAAARGIKLIALPGDFSDDGQQV
FT                   HLRGLQKILKHYQQKYDMRFFAAPGNHDPVRPFSRPAGKPDYLGTDGHRQRIFSKGAAE
FT                   CTGYKGKQAVIKTENPLPTICTEEVQELGYKGVLSILGEHGFSPQPEYIYWETPFSGYS
FT                   YEDYDLAKGKASAELTARQYEICSNGSGGEFKAENAVNCGEITDASYLVEPVEGLWLLA
FT                   IDANVYIPKAQTGKKSLSANDFHGSGNAGYNKVLTHKKHLMGWIKDIVKQADERGKTLL
FT                   AFSHFPMTEFYDGQSDTISELFGEATFQLARRPDDSVSKLLAETGLKVHVGGHMHMNDT
FT                   GVTRSGEQFLVNIQAPSLAAYVPAYKVLRPGKSGSLAVETIVIKEVPRFNELFEHYREE
FT                   YQQLLSTEADKLWDKEVLTAKNYQEFTSWHIRELTRQRFLPDDWPADLRDWVFSLNGEQ
FT                   LLSLSQLTEQRSWPEAKAAGESLARSKGFKPSDFSQWTGFEFAVDFYRIRNAGRLALKD
FT                   ISKSRLRQYQLLAVSLSELAKKVKAPEQVVQETESKHQLAAALAHRFGPVLDIFLALQE
FT                   GEPDDNFIIDWQSGELSR"
FT   gene            130355..131419
FT                   /locus_tag="IL0119"
FT   CDS_pept        130355..131419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0119"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80962"
FT                   /db_xref="GOA:Q5QXC6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC6"
FT                   /protein_id="AAV80962.1"
FT                   /translation="MAASAEEEKQYKASWKRLTLFSVLFVLLTAAGFYAIYDHFSGRSL
FT                   TFDFRLFAPEVLSAAVLLLLVYFAADGLRLYYTLRALGYRIPKKAMAKLVFINIFFSNI
FT                   TPMATGGGFAQVWFLHEHGVPIGRATAATTIRTVLAIFFIFSLTPVFLLVLEPLQNKAI
FT                   IGEIGTALAVFIVLYLLFFAVVLLRAHWLIGPLSYLCKAVHKLQLISPERHLRWQYKTR
FT                   REMLRFSRSFSEYCRGSKVAIALSVLSTVVFLLSLFSFPALLMWGLGYDVDYLVSLGLL
FT                   VVTTFIMYFAPTPGASGISEGVFGSFFNDILANNHLLLVTFSWRFLTIYLGMLLGLFIL
FT                   QRYLVQSAKVQGIQ"
FT   gene            131416..133635
FT                   /locus_tag="IL0120"
FT   CDS_pept        131416..133635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0120"
FT                   /product="Membrane-associated protein"
FT                   /note="contains glycosyltransferase (C-terminal) domain
FT                   fused to Calcineurin-like phosphoesterase (N-terminal)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80963"
FT                   /db_xref="GOA:Q5QXC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXC5"
FT                   /protein_id="AAV80963.1"
FT                   /translation="MNKTKLLKVLFYLNIAVVVGLIGYKIYLNLVTSEFEAEHTEQLSD
FT                   ISARLEGQDSYSFAVVGNINNSVGIFERRIIPMLNDTDIDFLVSAGNAVSSGGEDKYRA
FT                   IKGTLSRLDMPYLLTFGNNEYEEFGSFRFYDHYGPHFFSFTADDSRFIFLDSTGKTPWQ
FT                   WQLRWLTDILKADDSKHRFVFIGHPPLEPEEEFFLAQEDDFLQPMEFRHALLQTISNFG
FT                   VDRVFSSNISIYSEREHNGIPYITTGGAGGLVLNQDESFYHYVKVTVNADGSVEHSVEE
FT                   LEIGQHPILKQLESLWFFIHSLFYVGYLNFILLVSLFLVISTKLYNAVFVGKDYYPDYD
FT                   IDPQPWFKKPLRVAMFTNNYLPFIGGVPISIERLRLGLVKLKDKVLVVAPRYQQSSEKE
FT                   EHVVRMPSLFSFGEKSEFQFANIFSGAVRKKVKAFKPDIIHVHHPFWIGSLGVFIARRL
FT                   KVPVVYTYHTRLEHYAHFVFLPGSLFRNIIAHFLVRRFANKCDGVIVPTQSTEEYLRMI
FT                   GVKKPTFVQPTGIEFERFQQVDDKQIEELRQQQKLGDETVFVSVSRLSNEKNIDFMIEA
FT                   VAQLKDQTDKPFRLLIVGDGHQRHRLQERIDNMKLQQYITLVGSVPPEQMAAWYQLGDA
FT                   FLFASQSETQGMVILEAMAAGLPVVAVRSSGIDDVVEDGHNGFKTPAKQALWCERVKQL
FT                   LDDEALRQSLAENALAFARDYSVEKFSDDVRHIYAETLARYHEKK"
FT   gene            complement(133650..134105)
FT                   /locus_tag="IL0121"
FT   CDS_pept        complement(133650..134105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0121"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80964"
FT                   /db_xref="GOA:Q5QXE1"
FT                   /db_xref="InterPro:IPR021836"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE1"
FT                   /protein_id="AAV80964.1"
FT                   /translation="MNKGKNWLIYTLGFLGLIPFLASSLAALMHTGTWWGISPLEFLIT
FT                   YGAVILSFLGGTLWGRALHRAESEKTTGLLLLSNVFALAAWFTILINAPAWSLGMQMVG
FT                   FALVLYFEQKLARSSAMTAYMGYYRIRVLLTTIVIVCQLLVFGNHIL"
FT   gene            134193..135542
FT                   /gene="phrB_2"
FT                   /locus_tag="IL0122"
FT   CDS_pept        134193..135542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB_2"
FT                   /locus_tag="IL0122"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80965"
FT                   /db_xref="GOA:Q5QXE0"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014133"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QXE0"
FT                   /protein_id="AAV80965.1"
FT                   /translation="MNTKQQLVFIMADYRLGLFVFRNDLRVEDNLALYEAAQRSETLIC
FT                   CFCFNPTQNKYGHYGIPAMGKHRFTFLQQSLKQLRTELEMRGQKLIVLTGTFDRILTEL
FT                   ISERQVDAIFLSQHQGYYERLQLGLLQQRFPFLPFHETPNNTLFSEQELPFELADLPET
FT                   FSQFRKKVEPLSRNFSVQPVNALPSLPKNISYPGFKAETLNELASDDFEGGERAALTHL
FT                   TSYFSGESAGTYKQTRNALDDFSSSTKFSPWLAQGCLSVRQIMAALRAYETEFGENESS
FT                   YWISFELLWREYFFWYALKHGKRLFAFSGLSGKSPKTSFYSERFQKWCSGNTPYPIVNA
FT                   CMKQLNATGYMSNRGRQLVASCFVHELSLDWRYGAAYFEQQLIDYDVSSNWGNWQYLAG
FT                   VGADPRGHRQFNLEKQTERYDPDNEFIERWAGDLSGQPIDSVDAADWPVR"
FT   gene            135661..136668
FT                   /locus_tag="IL0123"
FT   CDS_pept        135661..136668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0123"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80966"
FT                   /db_xref="GOA:Q5QXD9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD9"
FT                   /protein_id="AAV80966.1"
FT                   /translation="MKKQILVTGGCGFIGSHTVVELILSGYQVIVIDDLSNSNASVIDK
FT                   IQCITGERPEFHQVDICNRDALTKLFKQYAFDAVMHFAALKNPQESYHLKEKYFLTNVE
FT                   GTRRLLAVMEDCSVNHLIFSSSAVVYGNPSCVPVAESAPAGATTNPYGENKYRSECDLA
FT                   EFCEKNLAFSAISLRYFNPAGAHPSGVIGEQPIKPAANLIPAIGNVITRKVDSVQVYGG
FT                   DYSTCDGTAIRDYIHVCDVAKGHVAALEAGFARTGHHIFNLGTGKGESVLGVIHAFEQA
FT                   SGQIIPVNFSERRQGDVASCYAQADKALQELNWRAEHDLQTIARDYCHWLSLSN"
FT   gene            complement(136638..137195)
FT                   /locus_tag="IL0124"
FT   CDS_pept        complement(136638..137195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0124"
FT                   /product="Phosphopantetheinyl transferase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80967"
FT                   /db_xref="GOA:Q5QXD8"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD8"
FT                   /protein_id="AAV80967.1"
FT                   /translation="MVIGYRLYNEAASKKQVSAAAKDLLLRLVKKYWPATEPQRISIEN
FT                   SDSGAPLLNVDGCPVYCSLSHKSGCIAAAYSTTSTIGIDLENVHTRKDYHRIRDYYKDG
FT                   FLAGSTLTKSDFFHHWTLAEAFAKASGVPLLSVLERPLHRQKHSAKYFQIEPFLLCAYQ
FT                   SDSSEREDAVLLYQLDNDNQWQ"
FT   gene            137275..137943
FT                   /locus_tag="IL0125"
FT   CDS_pept        137275..137943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0125"
FT                   /product="beta-ketoacyl synthase N-terminal domain-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD7"
FT                   /protein_id="AAV80968.1"
FT                   /translation="MRAFVADSTLVETECRERLKQIPASTRRRLSSYAKVIMTAILELS
FT                   ERHPQLKETPVVLATRHGDLHRTEKLLRELVRGEVLSPTQFVLSVNNAVLGQYSMAADN
FT                   RQAMTTLSAGEQTYPLGWLEAVSQVQSETRQVLLVYADEVPPAVYSGQVHSPVRSFAHA
FT                   VLLDRENGQKLILDRLVEKESQLQEDVWLVANGVQQMLDSCSGKVVKDYNGVRWSWHVA
FT                   "
FT   gene            137933..138769
FT                   /locus_tag="IL0126"
FT   CDS_pept        137933..138769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0126"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80969"
FT                   /db_xref="GOA:Q5QXD6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD6"
FT                   /protein_id="AAV80969.1"
FT                   /translation="MLLSLWQIINRTWRRFATGLCFAVFGLGGLLLSITALPALALLSN
FT                   GNERQREARARRLVQMTFRWFIGIMKWTGVFNFDFQAIEQLKGTRGHVIIANHPCLIDV
FT                   VALISFVPNPDCVVKSHLWKNPFMRGVIRSTGYISNDDPEGLVTDCERSLARGNNLIIF
FT                   PEGTRTTPGKRIKFQRGAAHLALRTRAKITALRVDCLPVTLIKNEAWYCAPERKPTLSV
FT                   RYLGEIDSASYCDAEKLSIAARQLTRDLQNYYEKVLEDDGKPEARDQSLDYRVAGS"
FT   gene            138711..138983
FT                   /locus_tag="IL0127"
FT   CDS_pept        138711..138983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0127"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80970"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD5"
FT                   /protein_id="AAV80970.1"
FT                   /translation="MTENLKQEIKALIIESLDLEDVEIADINDSAALFGDDDDGLNLDS
FT                   IDALELGLAIKKKYDVKLDANSAETKKHFYSVDTLAEFVANNRGE"
FT   gene            138995..139246
FT                   /locus_tag="IL0128"
FT   CDS_pept        138995..139246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0128"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80971"
FT                   /db_xref="GOA:Q5QXD4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXD4"
FT                   /protein_id="AAV80971.1"
FT                   /translation="MKTRDEVYARLTQILEEDFEIDSGDISLDANLYQDLDLDSIDAVD
FT                   LVVKLREITGKKISPDAFKAVRTVEDVVEEVYKLVHSD"
FT   gene            139246..139794
FT                   /locus_tag="IL0129"
FT   CDS_pept        139246..139794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0129"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80972"
FT                   /db_xref="GOA:Q5QXF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF0"
FT                   /protein_id="AAV80972.1"
FT                   /translation="MKNGLRLLISGLLIAYPLLVWWLAQNGLTNWLLLVLLALLSLSIV
FT                   SQGIRHPRSWLTLAVLLVVSVTAIFADQLTGVLFYPVWMNSALLLVFLASLWRKPAVIT
FT                   RLAMLMEGSLSDKAVAYTEKVTLVWAIFFLVNGAISLVTAVHGDLKLWTLYNGFISYVL
FT                   IGLLFVIEWSVRRVVKHKH"
FT   gene            139772..141121
FT                   /locus_tag="IL0130"
FT   CDS_pept        139772..141121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0130"
FT                   /product="Acyl-coenzyme A synthetase/AMP-(fatty) acid
FT                   ligase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80973"
FT                   /db_xref="GOA:Q5QXE9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE9"
FT                   /protein_id="AAV80973.1"
FT                   /translation="MLLNINTEQWQLQWQQADAELAVVKGQSISASVWRKDIAAATHWL
FT                   SEQDGDALLYHRDWYHFSVWLFALLNSKKRIVLPANDKPATLSELSLHYSFRVPSELPQ
FT                   HASSEAPPLTLNGSLNSQLTFFTSGSSGKPKAVRKTLRQLWLEVITLEQTFAEQLGPAN
FT                   ILSTVTHQHIYGLLFTVLWPLAARRPVTLPLVDYPEQLQQILAKANRQRYALISSPAHL
FT                   QRLDNLPQLAKYSHSLATVFSSGGPLSNSVPEDFAEHELNAPIEVYGSTETGGIGWRRR
FT                   NPGSNENFQTLAGVDASCNHNGLLVIQSPYLNNPQKPYTTEDKARLQGQGDFQLLGRQD
FT                   RIVKIAEKRVALNEVEQFIQRHDWVESAKACVLHSPRVELGLVLILTPEGVNQLSTQGR
FT                   FKARQELRHHLLQRFEKVVVPKRFRYVQQLPYNGAGKVTQTDLQALFEEE"
FT   gene            141129..141485
FT                   /locus_tag="IL0131"
FT   CDS_pept        141129..141485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0131"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80974"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE8"
FT                   /protein_id="AAV80974.1"
FT                   /translation="MQTQLPDFISFSEGLSDKEKPLLCGRFKLAADCIYLQGHFPSTPI
FT                   LPGVAQMDWVIQLAGQHWSTPTSIQRIEVLKFNDMILPGATVDLLIERKRDDCITFKYS
FT                   DGDKALSSGRLVFN"
FT   gene            141487..142227
FT                   /locus_tag="IL0132"
FT   CDS_pept        141487..142227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0132"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80975"
FT                   /db_xref="GOA:Q5QXE7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE7"
FT                   /protein_id="AAV80975.1"
FT                   /translation="MSQYCFLIPIYNHDKTITATVERLLPYELPIIIVDDGSNDHTKEV
FT                   LATLAEEHKSLVLLHTLPENSGKGGAVMAGFHVAAEEGFTHALQIDSDGQHDSNDIPEF
FT                   LALSKQNPGALISGYPQYDESMPTSRRIGRKITHFWVHIETLSMQIKDTMCGFRVYPLY
FT                   QTVGLIKRRHIGTRMDFDIEIMVRLYWAGTPVLFIPTKVIYPQGGQSHFRALQDNLKIS
FT                   WLHTRLFFGMLPRIPLILLRRFKS"
FT   gene            142230..143174
FT                   /locus_tag="IL0133"
FT   CDS_pept        142230..143174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0133"
FT                   /product="Predicted acyltransferase, LSAT/HtrB family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80976"
FT                   /db_xref="GOA:Q5QXE6"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE6"
FT                   /protein_id="AAV80976.1"
FT                   /translation="MVEKHWAKKKERGSYWGIVIVLRAYQYGGHWLMRLILAPVITYFF
FT                   LTGGDPRRASLDFLRRVHSYAAERSPFTAEPGWRQSWYHFWQFGLHALAKIDAWVGKVS
FT                   KNQVRNCGDTHFDDLEKQPQGGILIGSHLGNLEVARALASKKYTRRMNVLVFTQHAQSF
FT                   NRALKDVNPKVDIDLIQVTDIDMGLTILLKERIEQGEFVVIVGDRTSVTQPGQTIEQDF
FT                   LGKPVSFALGPWILASVLECPVYFLFCLKNPNDGHYDLYLNHACDQLKLPRKSRREALQ
FT                   PVLKAYSETLEKLAMRYPYQWFNFFDFWKKDSQ"
FT   gene            143176..144723
FT                   /gene="hutH_1"
FT                   /locus_tag="IL0134"
FT   CDS_pept        143176..144723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH_1"
FT                   /locus_tag="IL0134"
FT                   /product="Histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80977"
FT                   /db_xref="GOA:Q5QXE5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE5"
FT                   /protein_id="AAV80977.1"
FT                   /translation="MTTSIIAFGGRPLTIKDVVEIANGKAQIALSDAPEFVEKVDAGVR
FT                   FLDELLEQDGVIYGVTTGYGDSCTVSVPENLVNELPIHLTRFHGCGLGDTFDEQETRAI
FT                   LATRLSSLAQGYSGVSWELLERLVVMLNENMLPLIPKEGSVGASGDLTPLSYIAGALIG
FT                   ERDVRFRNKVMNSAEAFELLGMSVHKLRPKEGLAIMNGTAVMTALACLAWDRAEYLTRL
FT                   SSRITSLASIALEGNSNHFDDLLFAVKPHKGQQQVASWIQQDLNHVEHPRNSSRLQDRY
FT                   SIRCAPHVIGVLKDSLPWFKETIENELNSANDNPIIDGLGEHVLHGGHFYGGHIAMVMD
FT                   SMKTAVANLADLHDRQMALLMDTKMNHGLPSNLSAAEGERKSINHGFKAVQIGCSAWTA
FT                   EALKLTMPASVFSRSTECHNQDKVSMGTIAARDCIRILELTEQVVVATLLAAYQGVELR
FT                   KRITDKPVNPSAGVLEMLRSLADQFELLTEDRQLEPELRYWLTQLRLKVWNLYQEPA"
FT   gene            144720..145130
FT                   /locus_tag="IL0135"
FT   CDS_pept        144720..145130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0135"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80978"
FT                   /db_xref="GOA:Q5QXE4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE4"
FT                   /protein_id="AAV80978.1"
FT                   /translation="MKQASLIIDVPFFDVDAMHVVWHGHYIKYIEMARSELLRTFNYDY
FT                   PDMEANGHLWPIVDLRLKYVASATYGQHIRVTATLVEWEHRLKMNYEIRCVESNELLTK
FT                   ATSVQVAVCKETREMLFESPDIVFEKLGVERS"
FT   gene            145127..145657
FT                   /locus_tag="IL0136"
FT   CDS_pept        145127..145657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0136"
FT                   /product="Outer membrane lipoprotein-sorting protein, LolA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80979"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE3"
FT                   /protein_id="AAV80979.1"
FT                   /translation="MIRLLVTTILLMLSVIAVANDDATAEALSALEKQSEPLPLSLEFS
FT                   QKKQLSGLPRPLVSAGQLDIRKDEIVWTTEHPQQQQLTINRQGIFEQGNEDSVSGSDTI
FT                   AQLLLAILQQDEAVLKQQFRLSLEQNCVVMVPEADALASVIEKIHSCGTDRVELVELFE
FT                   QNGNTTRIELSKR"
FT   gene            145664..147892
FT                   /locus_tag="IL0137"
FT   CDS_pept        145664..147892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0137"
FT                   /product="RND superfamily exporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80980"
FT                   /db_xref="GOA:Q5QXE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXE2"
FT                   /protein_id="AAV80980.1"
FT                   /translation="MKGVRAALATRLLLLFVVIVGVVAALSAQLSNTQWSSSLADALPN
FT                   EVSELQRSYLASQQPNAQQLLLGFESQQYSGSEILPIVQEQLKLLTEAEPTIKLAEMTN
FT                   PKAVLSFYQNQAGRLATPNDMQALASGDYGTLISEAQKALQSPAPVLVPLKQDPLLLTK
FT                   RFVQQLPDLMPGYKSHNGLYTRTSESIHQVLVPLRIAGDALSVTQSGQSVLVINDFIAK
FT                   VTEQLPGINVYRSGLLFHSDAAAKQAKQEMTWFGGLSLLLVLALLLWVFRSGQQLFYTL
FT                   LLLSVSAATGLLATLLLSSRPHVLMLVFATSFIGLCIDYVIHGFIARSHGAKAWSALKP
FT                   ALWLSGLTTIFGYILLLLLPLPLLQQLGIFMAVALFTAIVLVVVTLPWLPQPGASRPGW
FT                   QRFCHSMAQLYRQMRQPDTTAWLSVMALATLGLLLWSFTANDNVRLLASSPESLLQQEN
FT                   HLRKTTDFYFQPDVLLVSGETQQQALERTGGLGDINGSVSLYDYMLPASEQQQLLQQQQ
FT                   ELFKSPEGKTYMQWLGLGQLVLASDQQEHPLQNQFLYPTEEGWMSVVRLKQPFNHGDIT
FT                   ESPGKLEHFNPIEHASDALAEYRHSMQLWLIALLLVSLPILAMFLRNQQANKRRIQAAW
FT                   QVTCVMTLSVSTALLLAQLIQPLNLFHCIGAMFVLVLSIDYGVFCAGRLKREHALQAIY
FT                   LSAFTTMVAFGALSFSSTPAIAAFGIIVLIGVFMSALFSPLIIESPDN"
FT   gene            147904..149139
FT                   /locus_tag="IL0138"
FT   CDS_pept        147904..149139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0138"
FT                   /product="FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80981"
FT                   /db_xref="GOA:Q5QXF8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF8"
FT                   /protein_id="AAV80981.1"
FT                   /translation="MEESIYDVVIIGAGPAGSTAAAMLANVGKSVLVVEKQEFPRFSIG
FT                   ESLLPQCMTFIEEAGLLDAVLDNAERLGFQYKEGAAFYHQGKKVNFDFRKKSSEGPGTT
FT                   YQVKREHFDQLLAQGAAEKGAEIRHGVALEAIDFNDRNTVKLSLTGAAGTSEAKARFVL
FT                   DASGFGRVLPRLLSLESPSDFPVRQAVFCHVKSELAGGNFDRSKILITVHPQNPEIWYW
FT                   LIPFADGTASIGVVGATEYFAESDSEKEALWKLVADEPYLLEVLGEYQVSRAEQRITGY
FT                   SANVNCLFGDRFALLGNAGEFLDPVFSSGVTIAMQSSSLAVPLVLKELNDEPQNWQKLY
FT                   SDPLRVGITTFRTFVKGWYDTRFQDVIFYPHQQQQVKEMICSILAGYAWDTGNPYVRES
FT                   ERRLNVLAELCG"
FT   gene            149166..149723
FT                   /locus_tag="IL0139"
FT   CDS_pept        149166..149723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0139"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80982"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF7"
FT                   /protein_id="AAV80982.1"
FT                   /translation="MLVLMVAGCQSLGGQPAQVPIADGSYQLQHSWPREPVQLWQKVEW
FT                   KKGEQQRIFMVSAAFDNERLLLVALSPFGNELFRSELSRANGVTFKGSEAFDDSRLAMQ
FT                   VWSDLQMALWPLDSINANLSGVSLQATQTGRELWRNGELLWSSVSEDKNQQRVIQNKPM
FT                   GYQLTITTLEYELLETDENHLK"
FT   gene            149704..150897
FT                   /locus_tag="IL0140"
FT   CDS_pept        149704..150897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0140"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80983"
FT                   /db_xref="GOA:Q5QXF6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF6"
FT                   /protein_id="AAV80983.1"
FT                   /translation="MKITLSEPGAICALGHNCESLWQAALAGDQAGLKPAAFNTNDGTS
FT                   LFAGSVADNKLPDIGSLPAAMRTRNNQLVAAALQQIEEPLLALIDRLGSDRVAVVLGTS
FT                   TSGIASGESALAYDESEGGLPDTFYYAMQEMLAPAECIAALTGITGPVYSISTACSSSA
FT                   RVFMSARSLLRLGVVDAVVVGGVDSLCRLTLNGFKALESTSEGRCNPFSANRDGITIGE
FT                   AAGLFIATREEDNLQPSEVTLTGACATSDAHHMSAPHPQGRGALAAIQGALTDAGITAQ
FT                   QLGYINLHGTATPLNDLMEAYAVNALGAGNVPASSTKALTGHTLGAAGAIEAVFCWLAL
FT                   AKQDGLPKHAWDGVKDSDLADIHLYQGGSLQYPIEHCLSNSFAFGGNNVSLVFSRGK"
FT   gene            150899..151354
FT                   /locus_tag="IL0141"
FT   CDS_pept        150899..151354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0141"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80984"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF5"
FT                   /protein_id="AAV80984.1"
FT                   /translation="MGHDLAELIKHEPPMRLIDKLCSAEQGKGQCCLTVTSDNLFYSEQ
FT                   HKGLPVHVGIELMAQTIAAVAGYQSKTDGGEIKLGFLLGSRKYQCDIDSFKLGERYDIF
FT                   VEELHVESSGLSVFECDIRHNDKVVAQARLNVYQPPDETAFIEENYG"
FT   gene            151347..152087
FT                   /locus_tag="IL0142"
FT   CDS_pept        151347..152087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0142"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80985"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF4"
FT                   /protein_id="AAV80985.1"
FT                   /translation="MVEGMAERVLVTGSGKGIGRAIALQLAKDGFDLAIHCRSDKASAE
FT                   QVVDEVKSLGRQASLLVFDVSDREAARNAIEQDIADNGAYYGAVCNAGITRDGAFPSLT
FT                   EDDWDSVLQTNLGGFYNVLHPLIMPMIQQRRGGRVVTIASVSGIAGNRGQVNYSASKGG
FT                   VIAATKALSLELAKRKITVNCVAPGLIETDMTEELEHGKEILSMIPMRRAGKPEEVAGL
FT                   VGYLFQPSAAYITRQVFSVNGGLV"
FT   gene            152087..153325
FT                   /locus_tag="IL0143"
FT   CDS_pept        152087..153325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0143"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80986"
FT                   /db_xref="GOA:Q5QXF3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF3"
FT                   /protein_id="AAV80986.1"
FT                   /translation="MKRVVVTGMGCLTAFGDNWQSFRSQLESGKNAVVSMPEWERFDGL
FT                   NTRLAAPIRPAFKKPSHYSRKAVRSMSTVSLMATRATELALTDAGLLEHPCISDGSCGV
FT                   AYGSSTGDTEQMKIFGNMLESGDMTGLNATTYIKSMGHTTAVNLGVFYNVKGRVHTTSS
FT                   ACTSASQGLGYAYEAIRYGHQKVMIAGGAEALCPSEAVVFDTLFATSTRNDEPQLTPRP
FT                   FDKNRDGLVIGEGAGTFILEELDHALERGAHIYAELVGFGTNSDGAHVTQPTADTMAIA
FT                   MKLALQQAQLEPEQVGYVNAHGTATDRGDVAESLATASVFKRSVPISSLKSYLGHTLGG
FT                   CGTIEAWASINMMRESWFAPTLNLTDIDPECGDLDYITEQARELDTDYVMTNNFAFGGI
FT                   NTSLIFKRWNNSN"
FT   gene            153342..153779
FT                   /locus_tag="IL0144"
FT   CDS_pept        153342..153779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0144"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF2"
FT                   /protein_id="AAV80987.1"
FT                   /translation="MKKLFVATVVLLSSLLSLQAEARDDLVTLELKPVMESNKAKEALL
FT                   DVPVYFAGQSHPEVAQSKGVITTSRKTNAVNKSDREACEWVLLSALKVLQDNARENGYD
FT                   AVINIKSNYDHNEFSSAEEFQCGAGFLMAGVALKGEVVKFK"
FT   gene            153791..155929
FT                   /locus_tag="IL0145"
FT   CDS_pept        153791..155929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0145"
FT                   /product="Prolyl endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80988"
FT                   /db_xref="GOA:Q5QXF1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF1"
FT                   /protein_id="AAV80988.1"
FT                   /translation="MKYLLGAVAVSLLTACSQNAETEQEANTQSMSYPETRKGDVVDTY
FT                   FGTEVADPYRWLEDDRSEETENWVKAQNEVTFAHLESIPYRETIEKRLTELWNYEKISA
FT                   PFKEGDYTYFYKNDGLQNQYVVYRQKGDEDPEVFLDPNTFSEDGTTSLAQLTFSDDGSL
FT                   AAYSISEGGSDWRKIRVIDAETKEQLEEPLVDVKFSGISWVGNEGFYYSSYDKPEGSEL
FT                   SAKTDQHKLYYHELGTDQSDDKLVFGGTGAEKHRYVGGYVTDDDRYLMISAANSTSGNK
FT                   LFIKDLTEEDSKLVTVLDHTDSDTRVLDNDGSKLYLVTNLDAPNQRVATVDASNPTPEN
FT                   WEDFIPETENVLSVSTGAGYIFAEYMVDAVAKVKQYAYNGDMVREVQLPGVGSIGGFSG
FT                   KKEADELYYTFTNYSTPSTIYKFDPDQGGSEVYAESGADFDSANYESKQVFYTSKDGTE
FT                   VPMIITYKKGTKLDGSNPTILYGYGGFNISLTPSFSIANAAWLEMGGVYAVANLRGGGE
FT                   YGKDWHKAGTKMQKQNVFDDFIAAAEYLIEKDYTSPERLAIRGGSNGGLLVGAVMTQRP
FT                   ELFAVALPAVGVLDMLRYHTFTAGAGWAYDYGTANDSKEMFEYLLGYSPVHNVEEGVAY
FT                   PATLITTGDHDDRVVPAHSFKFAAELQDKAGGENPQLIRIETNAGHGAGTPVSKTIEQY
FT                   SDIFGFTLYHMGFEELPE"
FT   gene            156051..156965
FT                   /locus_tag="IL0146"
FT   CDS_pept        156051..156965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0146"
FT                   /product="Membrane protease, stomatin/prohibitin family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80989"
FT                   /db_xref="GOA:Q5QXF9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXF9"
FT                   /protein_id="AAV80989.1"
FT                   /translation="MNNDFNIMWVVAAVVVLLLLIASVRIVPQQSVYLVELFGRYRRML
FT                   TPGLNFIIPLIEQVAHKQSMRTRQLDVDVETKTNDNVFVIVRVSVQYRVSNETAVYNAF
FT                   YQLENPEWQMQSYVFDTVRAQIPKQNLDAVFDNKDSISKDVKEQLRDTMEEYGFEIIAS
FT                   LVTDIDPDQSVKDSMNQINAAERERRAAEHKAEAEKIMLVKQAEADKESKILQGQGIAG
FT                   QRLAIAEGLRDSIAMVTDQANDITSKDVIDLLKFTNYVDVLGSFDTAASKVIMLPQPTG
FT                   QLDSLSSDILSAMEAAKDSKKDG"
FT   gene            156958..158160
FT                   /locus_tag="IL0147"
FT   CDS_pept        156958..158160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0147"
FT                   /product="Intracellular signaling protein (EAL-mHD-GYP)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80990"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG6"
FT                   /protein_id="AAV80990.1"
FT                   /translation="MAETFPLLAAQPIYDNKNRFYAVELLYRSALNLTAETVGDTAATS
FT                   EVVFNLCAGITSQTEHYDATAFINVSSEFLVSQSFLPLEPDKVVIELVERIKPTRAVVN
FT                   AVARWYEKGFRFALDDFEFDPAWEPLLQYASYIKVDVSTLTLAQARVFKQKLSGFKGKW
FT                   LAERVEDEATKQAYEELGFELFQGYYFAKPAIVYGTRLEPSSLQLAKVLSLCFEEEPDL
FT                   TELSRVISEDPQLSVCLLKIVNSPLYPTASPITRVKDVIMRLGIEKLRRWIALIGAVTA
FT                   SSPEASRMVLVRAQMCYELAKWKSSPGLDADQCYFVGLLSGVDIMLGVDKASFFEKLPL
FT                   SEQTRKAVEDCDGPMGQCLRIALKLERLVRMKEGLDKVDSRLLTTYQSVSTKVQELFNT
FT                   I"
FT   gene            complement(158157..158573)
FT                   /gene="sufE"
FT                   /locus_tag="IL0148"
FT   CDS_pept        complement(158157..158573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="IL0148"
FT                   /product="Cysteine desulfurase SufE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80991"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG5"
FT                   /protein_id="AAV80991.1"
FT                   /translation="MNLPSTDEIIDDLEFLDDWEQRYQYIIDLGKALPGLPESQHKDEY
FT                   LVRGCQSNVWLISEEKDGKLLLHVDSDAVIVQGLLTLVMAAYHDKTPEQILAFDIDNYF
FT                   AQLDLENHITPTRGNGLRAIVGRIQQLAKHNSQA"
FT   gene            complement(158618..159151)
FT                   /gene="paaD"
FT                   /locus_tag="IL0149"
FT   CDS_pept        complement(158618..159151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="IL0149"
FT                   /product="Predicted metal-sulfur cluster enzyme"
FT                   /note="may be involved in phenylacetic acid catabolism
FT                   pathway"
FT                   /db_xref="EnsemblGenomes-Gn:IL0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80992"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR017776"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG4"
FT                   /protein_id="AAV80992.1"
FT                   /translation="MQQKMVSTTREVKARRVPTGEPKVIPKGEFVTITQDLGGNYTVTF
FT                   QGNMLRIDGTDADAIGRKPEKLDFEPPANGKVSEDQVWEALETIYDPEIPINLVSLGLI
FT                   YKVAVDKDSGTVTIDMTLTAPGCGMGPVLVGDVEYRVSLVPHVKNVNVELVFDPPWSRD
FT                   MMSEEAQLEAGVFF"
FT   gene            complement(159166..159522)
FT                   /gene="sufA"
FT                   /locus_tag="IL0150"
FT   CDS_pept        complement(159166..159522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufA"
FT                   /locus_tag="IL0150"
FT                   /product="Fe-S cluster assembly scaffold protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80993"
FT                   /db_xref="GOA:Q5QXG3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG3"
FT                   /protein_id="AAV80993.1"
FT                   /translation="MSVETFVPSSSLISMTENAVRYFESRLKDEPGKLIRLSTKQSGCT
FT                   GYAYVLDSVDAMEDGDEVVDINDNIKVAIASNALELVRNTEIDYVKEGINGVVKFNNPN
FT                   VVNECGCGESFNVQ"
FT   gene            complement(159539..160756)
FT                   /gene="csdA"
FT                   /locus_tag="IL0151"
FT   CDS_pept        complement(159539..160756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csdA"
FT                   /locus_tag="IL0151"
FT                   /product="Selenocysteine lyase/Cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80994"
FT                   /db_xref="GOA:Q5QXG2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG2"
FT                   /protein_id="AAV80994.1"
FT                   /translation="MSLNVAQIREQFPILQRQVNGKPLVYLDNAATTQKPQAVIDALTD
FT                   YYTQCNANVHRGAHYLSDEATRRYEAARKTVADYIHANRQEEVIWTSGTTEGINLVANG
FT                   VAQRLKPGEEVLVTEMEHHANLVTWQQACKRSGATLKVVPINEDGSLNTEQFHALLSEN
FT                   TAFVSMPHISNALGTINPIKELTAAAKAKDALVMIDGAQGVAHGAIDVQDIGCDFYAFS
FT                   GHKLFGPTGIGVLWGCYEVLKDWPIWLVGGEMIATVSYQDATWGELPNRLEAGTPNIAG
FT                   AIGLAAAINWLQQFNKADILAHETALLARATQLAEQTDGLTIVGHADNKIGVLSFILEG
FT                   AHPADIGFLLDKQGIAIRTGDHCAQPLMKRLKVPGTARASFTIYNTLDEVDKLFEGINK
FT                   ARLMLA"
FT   gene            complement(160753..162003)
FT                   /gene="sufB_2"
FT                   /locus_tag="IL0152"
FT   CDS_pept        complement(160753..162003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB_2"
FT                   /locus_tag="IL0152"
FT                   /product="Cysteine desulfurase activator SufB"
FT                   /db_xref="EnsemblGenomes-Gn:IL0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80995"
FT                   /db_xref="GOA:Q5QXG1"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG1"
FT                   /protein_id="AAV80995.1"
FT                   /translation="MSQWLNHVLERASTVDDWLSPVRAQALDTLKQQQWPTRRTEAWRY
FT                   TSLHPVADLELKSSTGNATAEAPVIEGLNSLDLVFVDGQLSTDISKLKLPEGITISELS
FT                   APSEPAEAIFAQVKPSRHLFGLVNDVLAQQGVVIDIAAGAKVEQPIRIVNFASAGIESH
FT                   QRTLVRVGENAQATIIEHGSGSGNSLNTVFAEYDIAEKARLEHYRFALHEGEAIHIGGS
FT                   HFKLHDHARLNSTLIGYGSQLTRLDVDIEHAGEHAFAKFNNVYLLAPRQHFDLHSTIEH
FT                   ASPNGTTEENARGIIGDRAKAVFNGRIHIHRHAQKTLAELNNRNLLLTRGAQINTKPEL
FT                   EIYADDVQCAHGATVAEIDEEALYYMLTRGIDRQQALVMLNFGFVQEMVFQMPNKALAD
FT                   WLQPILKTRFESMMEKQ"
FT   gene            complement(162000..162758)
FT                   /gene="sufC"
FT                   /locus_tag="IL0153"
FT   CDS_pept        complement(162000..162758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="IL0153"
FT                   /product="Cysteine desulfurase activator ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80996"
FT                   /db_xref="GOA:Q5QXG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG0"
FT                   /protein_id="AAV80996.1"
FT                   /translation="MLSIKDLHARVEETTILKGLNLEIKPGEVHAIMGPNGAGKSTLGY
FT                   VLSGRDGYEVESGSVEMDGKDLLDMEVEERAQAGIFLAFQYPVEIPGVSNMEFMKESVN
FT                   AMREAHGESALSSAEFLKKAKEACKQVELPLDFLKRGVNEGFSGGEKKRNEIMQMIMLE
FT                   PKIAILDESDSGLDVDALQVVAKGVNSQRDGKRSFIVVTHYQRLLDYIEPDYVHILSKG
FT                   KIVKSGGPELAKEVEASGYAWLAEAEGADA"
FT   gene            complement(162762..164198)
FT                   /gene="sufB_1"
FT                   /locus_tag="IL0154"
FT   CDS_pept        complement(162762..164198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB_1"
FT                   /locus_tag="IL0154"
FT                   /product="Cysteine desulfurase activator SufB"
FT                   /db_xref="EnsemblGenomes-Gn:IL0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80997"
FT                   /db_xref="GOA:Q5QXH4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH4"
FT                   /protein_id="AAV80997.1"
FT                   /translation="MSEQIDQALARKYDAGFISEIESETFPIGLDEDVIARLSAIKGEP
FT                   EWMLEWRLKAYRTWLKMEEPDWAHVDYPKVDYQSISYYSAPKSMKDKPKSLDEVDPELL
FT                   RTYEKLGIPLHEQEMLAGVAVDAVFDSVSVVTTFREKLEEAGVIFCPISEALHKYPDLV
FT                   KKYLGTVVPRGDNFFAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTL
FT                   IVAEEGSHVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGI
FT                   YNFVTKRGLCEKNAKISWTQVETGSAVTWKYPSCILKGDNSVGEFYSVALTRGRQQADT
FT                   GTKMIHLGKNTKSTIISKGISAGRSNNAYRGLVRMGPGAEGARNFTECDSLLIGDQCGA
FT                   HTFPYIESSNPTAIVEHEATTSKVSDDQLFLCRQRGLDPEKAVSMIVNGFCKEVFRELP
FT                   MEFAVEAGKLLEISLEGSVG"
FT   gene            164558..165202
FT                   /locus_tag="IL0155"
FT   CDS_pept        164558..165202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0155"
FT                   /product="Response regulator, LuxR family (CheY-HTH)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80998"
FT                   /db_xref="GOA:Q5QXH3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH3"
FT                   /protein_id="AAV80998.1"
FT                   /translation="MGRYTRLALIEHQKRTQNLGLLAESLEISVVHRAFSELVDHSPEP
FT                   ETMVAYSLGSEQLSRSHITSEIAALTKTYPLFLVNARKDDVRPIQALNLGARGIIYEND
FT                   HLDRVLTAIKVISQGELYYPRSLLSDKIEEMMLRRQADDSFTTVSQINSLTPQELKVIE
FT                   LVATGARNKEIAEHLNISAHTVKTHLSSIFRKTGARNRVELLKWSSYATSV"
FT   gene            complement(165209..165964)
FT                   /gene="csgG"
FT                   /locus_tag="IL0156"
FT   CDS_pept        complement(165209..165964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgG"
FT                   /locus_tag="IL0156"
FT                   /product="CsgG"
FT                   /note="uncharacterized protein involved in formation of
FT                   curli polymers"
FT                   /db_xref="EnsemblGenomes-Gn:IL0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAV80999"
FT                   /db_xref="GOA:Q5QXH2"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH2"
FT                   /protein_id="AAV80999.1"
FT                   /translation="MRKVFLILASLVMSGCALMPKPTDINIQPAEIDAPSSTMTALKQR
FT                   QLPQTRIPVSVYAFRDQTGQYKPQANVSSFSTAVTQGATSMLTQMLLESGWFLPMEREN
FT                   LQNLLTERKIYNSGDNKELPPLSEARLLLEGGIISYDTNVSTGGIGAEYFGIGASELYR
FT                   EDQVSVYLRAVDVYSGQVLVSVSANKKVFSQELRAGLFRYVSLNRLAEFEGGYSTNEPV
FT                   QLSVKQAMERALVELIEKGLEMGYWRAES"
FT   gene            complement(165980..166363)
FT                   /gene="csgF"
FT                   /locus_tag="IL0157"
FT   CDS_pept        complement(165980..166363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgF"
FT                   /locus_tag="IL0157"
FT                   /product="Curli production assembly/transport component,
FT                   CsgF"
FT                   /db_xref="EnsemblGenomes-Gn:IL0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81000"
FT                   /db_xref="InterPro:IPR018893"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH1"
FT                   /protein_id="AAV81000.1"
FT                   /translation="MKLRWLFIGFLFTAVNAAATEIVYQPINPSFGGNPLNGNFLLQKA
FT                   QTQNAHSAPDSDRSFVDRFREALERNIINSLTRRIADGEIVEGLYDTGEYTVEVVGQPD
FT                   GSVIVYITHNGSGEQTVITMPSI"
FT   gene            complement(166375..166752)
FT                   /gene="csgE"
FT                   /locus_tag="IL0158"
FT   CDS_pept        complement(166375..166752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgE"
FT                   /locus_tag="IL0158"
FT                   /product="Curli production assembly/transport component,
FT                   CsgE"
FT                   /db_xref="EnsemblGenomes-Gn:IL0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81001"
FT                   /db_xref="InterPro:IPR018900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXH0"
FT                   /protein_id="AAV81001.1"
FT                   /translation="MLKKLILLVLLFTPVSQADEIELGGMVLDRTISRFGKDFFFYYTS
FT                   YWRDIPSTNGITVVIHEQVYPQAGTYLWVEMEQTKIFQTYFGRRQNDVKKMAEKAILIS
FT                   INEVARVKADSVFDTPQDNNF"
FT   gene            complement(166805..168292)
FT                   /locus_tag="IL0159"
FT   CDS_pept        complement(166805..168292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0159"
FT                   /product="Uncharacterized conserved secreted protein with
FT                   internal repeats"
FT                   /db_xref="EnsemblGenomes-Gn:IL0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81002"
FT                   /db_xref="GOA:Q5QXG9"
FT                   /db_xref="InterPro:IPR009742"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG9"
FT                   /protein_id="AAV81002.1"
FT                   /translation="MSKILIKKSAIALALGIAFAGSAVAENHIAVINQESAGAVEIGNE
FT                   VYVEQAGAAHWAYADQYGDDNVTSLLQFDDWHEAYAYVTGDFNLVEGEQSGLWNVFNAD
FT                   AVGDDNWLSAYQEGSLNSASIFLQGDGNTAVAEQSGDANEAAIDLSGDYNTAEIYQSGD
FT                   SNWSNFQISGSDNLFLSEQSGSLNESGYFNASGDRNTFEASQEGDGNVAGVVGADGDDN
FT                   EVYAQQYGSSNIFIARDLEGNENFVDVFQDGSANEFLIQPIQGEANFIVVQQQGNSNVV
FT                   EAANGMIGNDNLIDAYQRGDNNYAVFATEGDMHNVELEQAGDNNTAVGESYGEQNDIMV
FT                   SSRGDDNFNGVAVQGVSNDIQSRQRGDANTAEVVFVGDDNDVMSSQVGDGNVTLAYSYD
FT                   AGTTSGNTLDSEQQGDINLIDTIIGGNENLISFYQEGNSNVIAGDGGSFIVGGSNGSVD
FT                   IQQVGDYNVVTGGQASDGNTMSVYQQGDYNVATVVQY"
FT   gene            complement(168317..168724)
FT                   /gene="csgB"
FT                   /locus_tag="IL0160"
FT   CDS_pept        complement(168317..168724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csgB"
FT                   /locus_tag="IL0160"
FT                   /product="Minor curlin subunit CsgB, nucleation component
FT                   of curlin monomers"
FT                   /db_xref="EnsemblGenomes-Gn:IL0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81003"
FT                   /db_xref="GOA:Q5QXG8"
FT                   /db_xref="InterPro:IPR009742"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG8"
FT                   /protein_id="AAV81003.1"
FT                   /translation="MTYKKQLLAALVLLFVSLPGVAKDIPVALAGLLERQALANHAEIA
FT                   QLGSYNLTSVIQSGEQNYAYLVQSGFENTLSLEQQGFNNSVTAEQSGRGNSAIILQLGN
FT                   SNLIQLQQLGNDNAITIQQSGSAAEMSITQF"
FT   gene            169042..171576
FT                   /locus_tag="IL0161"
FT   CDS_pept        169042..171576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0161"
FT                   /product="Secreted subtilisin-like peptidase"
FT                   /note="conatins C-terminal PPC/PKD-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81004"
FT                   /db_xref="GOA:Q5QXG7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034204"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXG7"
FT                   /protein_id="AAV81004.1"
FT                   /translation="MANIKKLVVGISIALAAGSAVAATDKKADDDSLLVMFKQSVTKEQ
FT                   RQDLIKNAGGSLRALDDSGRDIAMRHIADGRIAKVNVRNAKQRDALIKRLSQHPLVEVA
FT                   EPNYVISINDSKDPKFNILATPDDPGFGDMWALENTGQSGGTPGADIDARPAWDITTGD
FT                   SNIVIGVIDSGVDYTHPDLAGNMWVNPGEICDNGEDDDGNGVVDDCYGYSAITSSGDPM
FT                   DENGHGTHVAGTIGATSNNGVGVTGVNWDVQIIGCQFLDADGYGSTAGAIECIDYMANL
FT                   KVNHGVNLVATNNSWGGGAYSESLKTAISDSIDQGIMFVSAAGNDGIDADVTASYPGGY
FT                   DLDGIVNVANTTRTDSMSGTSTYGLESVDLGAPGTEILSTYLNDGYATASGTSMASPHV
FT                   AGVAALVWSIDPSLTIAEVKQILMDSGESIPALSGKTVSGKRLNALSALEAADPDPAYR
FT                   LTLSPGRQEIVAGDSTTFTLDVGSIADWSGTVDLSVAAEPELDVSLSSSQADEGDSVDV
FT                   QVNTTDETQWGEYSITVSGSDVETGEITREVSSAVYVLPQGLSDFYYEDAANTDIPDDD
FT                   NEGISRVINVPETGVVFGADVSVDITHTWQGDLIVSLTSPEGTEHVLHDRAGGSTEDLV
FT                   RSWSVDTFNGEDMTGDWTLTVSDNAGADTGTLNHWSLTLTAVEEDDGLPDAPVASFEAS
FT                   VDDLTVTFSNTSSDSDGDIASYFWEFGDGSTSTEANPVYAYSEAGIYDVTLTVTDATEL
FT                   SDSVTQSVNVSITDIELSVYRATHLRNDTTLVDLRWSGAAGDVDLYRDGEFIETLDNSG
FT                   RYRDRFKSDGSDVVYELCETGTEACQSATASF"
FT   gene            complement(171664..173514)
FT                   /locus_tag="IL0162"
FT   CDS_pept        complement(171664..173514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0162"
FT                   /product="Secreted subtilisin-like peptidase"
FT                   /note="conatins C-terminal PPC/PKD-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81005"
FT                   /db_xref="GOA:Q5QWI5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034176"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI5"
FT                   /protein_id="AAV81005.1"
FT                   /translation="MMTKNKQHKTLIAIALSGLLAGTSVAAETLSQNGSDNGNNGAKPS
FT                   LKERSNGPATSFIVKLKDGSQVVQQMQQQSAEHPSSNAAAVAQQMRGFTSVLSKRTGKS
FT                   VAFERSMALQQHFVVKAQGRLSPEETKEYLQSLKADSDVEFVEENKILRHFATPNDPNY
FT                   DDQWHYYESVGGLNAPTAWDSVDGSGVVVAVLDTGYRPHSDLAGNILPGYDMISDSFIA
FT                   NDGDGRDSDAQDPGDWVSAGACGNGYPAQDQDSSWHGTHVAGTIAAETNNSTGVAGVAY
FT                   GAKIVPVRVLGRCGGTTADIADGIVWASGGSVPGTSPNANPADVLNMSLGGSGTCSTTT
FT                   QNAINTARNNGATVVVASGNSNDNSTNYNPGNCNGVVNVASTDRNGDRAYYSNYGSNVD
FT                   VAAPGGAMQSANDPNGVLSTYNTGTSTPGSDSYGYSQGTSMAAPHVAGAAALIKAADPA
FT                   ATPDDIEQILRNSARSFPGSCNGCGTGIVDAAAAVALASGGGNGGDNGGDDGGDDGSSG
FT                   GGGTVDDLSASTNEWNRFYLDVPAGMSTLTVTITGGSGDADLYLRQGSQPTQSNWDCRP
FT                   YNAGNEEVCTIDNPQEGRWHIGVFAYSAYSGVDLEARYEP"
FT   gene            complement(173801..174811)
FT                   /locus_tag="IL0163"
FT   CDS_pept        complement(173801..174811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0163"
FT                   /product="2OG-Fe(II) oxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81006"
FT                   /db_xref="GOA:Q5QWJ0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ0"
FT                   /protein_id="AAV81006.1"
FT                   /translation="MQSPIPVLSMRKLYLGASDRQQFIADLGRAARDVGFFYLEDHGIS
FT                   LAEQVKVLDTAKSFFALSDAEKKQVQMIHSPHFRGYSANYSELTAGRPDRREQFDIMDE
FT                   LPALSASAIHHEWQKLIGPNQWPRQLPAIKSQLLSWQDKLTEVSLQLLAALCESLEQPA
FT                   DALAETISNGPYRHTKLIKYPGSPEASGQGVGAHKDPGYLTLVLQDENSGLEVEYEQQW
FT                   YKVAPRPGAFVVNIGELLELASNGYLKATNHRVSSPKTGVTRYSSAFFMAAQLNASVPV
FT                   LKLPSHLAKHAKGPTSDPGNPLLHNVGENVMKGRKRSHPDVSARFYASEEKCSSC"
FT   gene            175014..175730
FT                   /locus_tag="IL0164"
FT   CDS_pept        175014..175730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0164"
FT                   /product="Uncharacterized conserved enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81007"
FT                   /db_xref="GOA:Q5QWI9"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWI9"
FT                   /protein_id="AAV81007.1"
FT                   /translation="MGRAYQNRKDSIAKTANAKSKVYSRYGREIYVCAKQGGGDPDGNL
FT                   ALRGLIDRAKKDQVPAHVIEKAIDKAQGGAGEDFSPARYEGYGPSNCMVIVECLTDNPN
FT                   RTFGDVRNCFTKSKSKIGAQGSVAHSFDHCAIFAFRHDNEDEVLEAMMEADVDVTDVEF
FT                   EDGLVTVFAPNTEYAAARQALTHAFPDIDFEADEIQFLPQVTTSIAEDDLPMFERLMDM
FT                   LNDLDDVQNIYHNAEH"
FT   gene            175804..176502
FT                   /locus_tag="IL0165"
FT   CDS_pept        175804..176502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0165"
FT                   /product="Outer membrane protein OmpW, putative"
FT                   /db_xref="EnsemblGenomes-Gn:IL0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81008"
FT                   /db_xref="GOA:Q5QWI8"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI8"
FT                   /protein_id="AAV81008.1"
FT                   /translation="MKLKALSCGVLLGLLSTSALANDFSINVGAISVMPDDSSSHLNVV
FT                   ESVAGLPENSTGVGVNTNTQLGLTFDYKLTENWTLELVAATPFSHDITATGSLAGLKIG
FT                   KTKHLPPTLLAQYHFDIDSEMFKPFVGIGVNYTAFFDEQVDPQLRSTLGDLGVVTDNDD
FT                   VSLALKNSWGYALQAGVNVDLSENWGLHFMVSRMDIDTTGDVRVNGNTIESVDVDIDPY
FT                   VAMAGVRYNF"
FT   gene            complement(176538..177059)
FT                   /locus_tag="IL0166"
FT   CDS_pept        complement(176538..177059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0166"
FT                   /product="Response regulator with a Fis-type DNA-binding
FT                   domain (CheY, Fis domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81009"
FT                   /db_xref="GOA:Q5QWI7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI7"
FT                   /protein_id="AAV81009.1"
FT                   /translation="MNKFRLLIIDDDEGFCGILQRRLGHHGVLVQMAHSGHQALALEGH
FT                   FDGILLDMMLGDDNGLALIQPLKERYSPCHLVVLTGYASIATTVEAMKRGATDYLTKPV
FT                   GTNELLRRFTNEKLELEDASVNRLTPTQIEWEHIQRVLTDNQGNVSKTARELGMHRRTL
FT                   QRKLSKRSPH"
FT   gene            complement(177052..178101)
FT                   /locus_tag="IL0167"
FT   CDS_pept        complement(177052..178101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0167"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81010"
FT                   /db_xref="GOA:Q5QWI6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI6"
FT                   /protein_id="AAV81010.1"
FT                   /translation="MCLALCLDIVLGNLLVAFNGGISNPFTSLLLIFIVIAFLLLPPTF
FT                   ALIVVLISILGQVAQIGLPSLLPGQQSHTAHALSDEMLKHAMGMVSGFVIAAAIIALSM
FT                   YYLKRQWFQSEKALQNARERQLRDEQLLTIGAAAAQLTHDVATPVQSLRLLNEELQECD
FT                   IELSLKQEFSEHLGKVEASLEQWRDAAEDVRTRRQHNYTVGEIITQLRQLLRIARPDAQ
FT                   VNWQCPERFKTTIISADRTLFPAIANLVINAISAGERSHQLVVSVQLNLTLVDANPQLT
FT                   IHILDNGDGLSQAQQRKIGKSMALSENGMGIGAVISHATLERLGGQVSWQSTSEGTLTL
FT                   VLLPVTAYE"
FT   gene            complement(178155..180173)
FT                   /locus_tag="IL0168"
FT   CDS_pept        complement(178155..180173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0168"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81011"
FT                   /db_xref="GOA:Q5QWI4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010100"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI4"
FT                   /protein_id="AAV81011.1"
FT                   /translation="MKAIYPLATCLLLPIVSYANETTDIQERIVIIGESMQSPSEWVVD
FT                   SKQPRQPLPAHDAGDFLKSLAGFSATRKGGASADPLFRGMGAGRLTIVNDGQMLQGGCS
FT                   SRMDPPTAYITPQSYDSVTIVKGPQTVLFAGSAASIHFEREATFFEVPEFTGYLNATTA
FT                   QYGRLNTTADLTWGAQPGYVRVNASAATADDYEDGSGNSINSQYERWSGDIDLAWTPSR
FT                   QHRLMLKLGVSDGEAAYADRSMDGVLFDRESVALNYQWQPDNRSLEELSVNTYFNTIDH
FT                   VMDNYSLREFTPSMMMPSPTASNPDRYSRGFKIASEWQLPPSGQLKTGLEHNESAHRNR
FT                   SSKDQFNQPFESLNRVDDAFIEQDGIYAEYRHSIDQEWQLVSGYRLDHWKMTDKRTDIQ
FT                   PMSAPAQSNPTANETRSENLHSGFLRIEKQLKNGYWYAGWGQAERFPDYWEAIGNSRQS
FT                   PTSESAFYTDAETNQQWDIGLDINTDKWRLDASIFYSRVDDFILLQKGMMMQPDTVRNI
FT                   NARTWGGETTLSYQLTQAWSVSSALAITRGSNKTDDNYLPQQPADELRIGTDYRHNALT
FT                   YSLLWRLVDKQERTAVNQGNVIGYDIGNSPGYGVLSANIDWKIDPKWQLSLGVDNILDK
FT                   TYAEHLSRSAASISGYQQIDKVNEPGRTVWLQTNYHF"
FT   gene            complement(180270..180581)
FT                   /locus_tag="IL0169"
FT   CDS_pept        complement(180270..180581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0169"
FT                   /product="Transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81012"
FT                   /db_xref="GOA:Q5QWI3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI3"
FT                   /protein_id="AAV81012.1"
FT                   /translation="MSATESQEMHQEEAQNAASFLRSLGNPHRLQILCRLALGEQSVGQ
FT                   LHQFFDLSPSAFSQHLAVLRQQQLVSIRKESQTVYYSIKDPDTEAFMTLLKDKFCPSL"
FT   gene            complement(180589..180807)
FT                   /locus_tag="IL0170"
FT   CDS_pept        complement(180589..180807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0170"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /note="similar to rhodanese-like sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81013"
FT                   /db_xref="GOA:Q5QWI2"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWI2"
FT                   /protein_id="AAV81013.1"
FT                   /translation="MSVERAITAFAGFMVLLSVALTYWVHPNWVWLTVFIGANLFQQSF
FT                   TGFCPAGIFMRKVLGLKTERELEKSGK"
FT   gene            complement(180831..182036)
FT                   /locus_tag="IL0171"
FT   CDS_pept        complement(180831..182036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0171"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81014"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ7"
FT                   /protein_id="AAV81014.1"
FT                   /translation="MPYRKILAFTVLFTLAQAASAQDSWGDDEWESDWGTEQDQGIDVY
FT                   GYVEAAIGGRFESSPYHKRLSIAEPRLQLGFDERWQDIAWTAKADGWYDGFDETWHGQI
FT                   RELNAQFTVFDNTDIKIGRQVLTWGTGDYLFLNDLFPKDWQSFFVGRDQEYLKAPSDAL
FT                   RITSYFDWFNLDFVWSPEFDPDNYIRGERISYFNPLTQQLTGDDPSIQFVEPTRDEYAL
FT                   RLFRNHEGVEYAVYGYDGFTKSPEAVTDNFQPTFGRLTVVGASVRMPLGPGLVNTEVAN
FT                   YNRHDAEDHWRALVGYEQELWTRFTGGFQAYVEKGDNQTRTVFTTRLTWRDERDDLNLS
FT                   LFAFVSPNQSDGYLRPTFDYRIDDNWSLSGGFNLFFRERPETFFGQFTENNNAYLRMRY
FT                   AF"
FT   gene            complement(182039..182839)
FT                   /locus_tag="IL0172"
FT   CDS_pept        complement(182039..182839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0172"
FT                   /product="Probable outer membrane protein"
FT                   /note="similar to LolA, lipoprotein-sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81015"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ6"
FT                   /protein_id="AAV81015.1"
FT                   /translation="MKHLFLTALSAAVLFVSGQAISAEKSAREIVEQAELNAYYSGDDG
FT                   RSAARMIITDNQGREQMRQFTILRKDQEDGGVQDMMIFFSRPADVRDTVFRVVKRVNDD
FT                   DDRWLYLPDLDLVKRISAGDKRTSFVGSHFFYEDVSGRDTALDSYEVLSEDDAKYVLKG
FT                   TPKDSDKVEFSYYEVVIDKEHMLPVESTFYNDSGEAYRKMEVLEIETVQGYPTVTHSRI
FT                   SDLENGGKTDMQFRFMQYDIGLPDSIFSERSLRNPPAEWLQLRD"
FT   gene            complement(182836..185352)
FT                   /locus_tag="IL0173"
FT   CDS_pept        complement(182836..185352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0173"
FT                   /product="Predicted exporter, RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81016"
FT                   /db_xref="GOA:Q5QWJ5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ5"
FT                   /protein_id="AAV81016.1"
FT                   /translation="MIDVIMKLATGYRRSVVWTLTLITIAAAAFIPSITIDTDPENMLP
FT                   DDNPQRVFHNEVKETFAMHDMIVVGVVNKNTVYNQKTLTDLHTMSNYAESLDGVISDDL
FT                   MSLANVDNITQEEPGTIRFEWMMKQPPESNAEAQYIQKQVKDLPLLYNTIVSGDDKSAA
FT                   IYVPIESKDQSYALAEQLREKIATLETNDDWHITGLPVAEDQFGYEMFVQMGISAPLAA
FT                   AVIFALLWFFFRNVRFISAAMIVAMSTVLITMGTLIALGFTVHIMSSMIAIFLMPIAVV
FT                   DSVHIMSEFSDRYREKGNAKDTIKDVLRHLFTPMLFTSITSSIGFYSLMLTPIPPVQVF
FT                   GAFVGSGILLAFLITVLFVPAYICALKPSTLESFTQVTHDEHKQGWLQKMGATAASHAK
FT                   LWIAFFLAVLAFAWFGIQQININDNPVRWFKPDHEVRIADEVLNDHFAGTYNAYVVFEN
FT                   TLDTTEKARSAVRDALNNDALSEESRDAISALLEQEQVNFNQWIIAIDDLLFSVGSDQL
FT                   EPLERLMTELEQLNSASKAFQSPELLAYISEMQAYLQTTGLVGKSNSLSDVVKTVNREL
FT                   RSGEEKDYELPDNANGVAQTLLQYQSSHRPQDLWHFVTPDYKRSLMWLQLTSGDNQHVT
FT                   QVVKAVDSYIQDNPLPANTEMDWAGKAYLNVVWQEAMVEGMLDSLISAFVVVFIMMVLL
FT                   FRSVVFGVLAMLPLSLTIAFIYGLIGWVGKDYDMPIAVLSSLTLGLSVDFAIHFIERTR
FT                   ATFKQTGNWKDTLVVMFDEPARAISRNAIVIAIGFTPLLFAPLVPYITVGVFLASIMAI
FT                   SAIVTLIMLPAVMTVFSRLIFRGDQS"
FT   gene            185450..186160
FT                   /gene="deoD"
FT                   /locus_tag="IL0174"
FT   CDS_pept        185450..186160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="IL0174"
FT                   /product="Purine-nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81017"
FT                   /db_xref="GOA:Q5QWJ4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ4"
FT                   /protein_id="AAV81017.1"
FT                   /translation="MTTPHISAKAGDFAELCLFPGDPLRARHIAETHLDSAELISDTRN
FT                   MLAFTGQFRGTPVSVMGSGMGMPSCALYAQELFQHFGVERLVRVGTCGAVSANLNLRDL
FT                   VVAQGACTDSSMNQKLFGGYDFAAIADYKLLSEFVGYCQKKNQRVAVGNVFSTDSFYHP
FT                   DKKLESRLEAMNVLALDMEAAALYAVAAIHKKQALAVMTVSDEIRTGNGLSANERQTAF
FT                   NEMTKMTLESLLVY"
FT   gene            186216..188714
FT                   /locus_tag="IL0175"
FT   CDS_pept        186216..188714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0175"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="contains hemerythrin domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81018"
FT                   /db_xref="GOA:Q5QWJ3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ3"
FT                   /protein_id="AAV81018.1"
FT                   /translation="MSMNEQNKPFVVVDSACSGVVMKWLDWLTRPVQKLFNLLSFRRKF
FT                   SLIGFLLFIPVIVLSSLMVNDSLEKSHQVEQKHEAAQYWPELRGLLEHIAMHRGMTGSE
FT                   AQKREFSSEINRSVQAINRHFSALDDLQSKPGQSHLLPESLLLELRRKWQGLSGSTDTF
FT                   HQHTELLEKVQSALKLLGKNSQQLLENDLPSLFLARLSVEELPQLVEQGGRLRGLGAQW
FT                   LSGKESPELQQDVTILSYVLENQVSDFVDVVESLSEEVNDQGLLMQAKAAEQQLRLFSE
FT                   TASSKLMERNMSASDFFREGTAATGALFAFYDSVIPAYHSRLEQRLTKLDTVIWTNAAL
FT                   IVGVLLLQLLLFTSLYLGIYRAVSANIKMAKQLANGDLNSLSSTEGHDELSKITHYLNS
FT                   VAIETSYSVDAIRKSSDGMDRLGNGNYQAIKELAERARAQASQMQSAAAAVEQMTSAIS
FT                   EVSESTQKAATEADNTLISAKNGQQVVHTMVTAIQRLEQEVSESQRVIKTLSEDSQSIS
FT                   KILLTINDIADQTNLLALNAAIEAARAGESGRGFAVVADEVRQLAQRVQASTGEIQSVI
FT                   GRLETNTNNAVQTMERNKTLAGENVEQANRAASSLSDIVENVGVINDLNIQIASTTEEQ
FT                   SAVTINIQENINSLSESARIVDERSQEALESSAQLTTLGGEIKSLGDRYYIEKDVIERR
FT                   LSEQDVLIEWSPKLDVGIEEINRQHQRLIYIANELYRLKLRDGDQHALQRLVDSLINYT
FT                   ATHFNYEELLMERNGYPDLENHKLKHRDLVQDVMRFKHRVDSHEDVIDELLEFVKAWLM
FT                   NHIMKSDMAYKGHLNSKGIH"
FT   gene            complement(188720..189721)
FT                   /locus_tag="IL0176"
FT   CDS_pept        complement(188720..189721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0176"
FT                   /product="Malonyl-CoA-[acyl-carrier-protein] transacylase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:IL0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81019"
FT                   /db_xref="GOA:Q5QWJ2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ2"
FT                   /protein_id="AAV81019.1"
FT                   /translation="MKQTAVIVCPGRGGYNKPELGSITERHLPKQSDLINQLDKVRENE
FT                   GFISVSELDQKSKFDHRLHLKPENSAALIFAAGYADFKAVDPEQYDIVAVTGNSMGWYT
FT                   ALACAGVWQPENAMSIVTDMAKRTAAADGAQLIYPIMNEQWQPDKTREKAVSQMLEQHA
FT                   GELFLSIRYGGYVLLAGTQNAVTTASKALEPVDNRFPMILPGHAAFHSPLMKEASDQAL
FT                   SVWDSSHFRQPELPLIDGRGVIWEPPGCHLDALQRYTFGHQVTEYYDYTKAITVALREF
FT                   APDKLLLLGPGNSLGGATGQSLVAANWRNLSSKDDFTQRQESEEAPVISLGL"
FT   gene            complement(189718..191904)
FT                   /gene="acoA"
FT                   /gene_synonym="acoB"
FT                   /locus_tag="IL0177"
FT   CDS_pept        complement(189718..191904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoA"
FT                   /gene_synonym="acoB"
FT                   /locus_tag="IL0177"
FT                   /product="Probable oxoisovalerate dehydrogenase alpha and
FT                   beta subunits"
FT                   /db_xref="EnsemblGenomes-Gn:IL0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81020"
FT                   /db_xref="GOA:Q5QWJ1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ1"
FT                   /protein_id="AAV81020.1"
FT                   /translation="MRCDIEGWQQDFIERLAQEDLPAPQSQHSNLNDSDLFALFHSQVL
FT                   SRFIDIESRRLQRQGKSFYTIGSAGHEGNAAVAAALRVTDPAFLHYRSGAFFLQRAKQL
FT                   EGSNSLYDLMLSFCASSEDPISGGRHKVLGSLALNIPPQTSTIASHLPKAMGTAYAIGL
FT                   SKRLKQAGQWPDDAIVLCNFGDASANHSTAVGALNATGWSAYQGMPMPILYVCEDNGIG
FT                   ISTSTPRGWTAHQLQNYPAIRYYYADGANVSETYAVARQAAEYIRRTRKPAILHLKTQR
FT                   FFGHAGADAEVAYRSNESIEQSFETDVLLQSAAQVIERELCTGIQLSEKAQCWLQRIRR
FT                   VGTEASARPRLECAESVMASIVPKTLADDTQPLTSTQQQAVFAFDKRNFKKPQPLGKMI
FT                   NWALHEILARYQNTVVFGEDVGKKGGVYHVTHHLFDHFGANRVVNTLLDEQSILGLAMG
FT                   MAQQGFLPIPEIQFLAYVHNAEDQIRGEAATLPFFSNGQYHNGMVIRIAGLAYQKGFGG
FT                   HFHNDNSFAVFRDIPGVIVMCPSNGHDAVLMMRQAVQLAHCQKRLVIFLEPIALYMTRD
FT                   LLAEGDKGWLHEFPSATAPLPALGEPSRYGEGDELVIITYGNGYYLSRQACSELALEKR
FT                   IRILDLRYLVPLDIEKIVAAVGSAKHILVVDECRNRGSLSEELVTALYEHRRDWQRVDR
FT                   ITAKDSFIPLGSAAYKVLPGKEDIIHYLQEHLGQ"
FT   gene            complement(191919..193091)
FT                   /locus_tag="IL0178"
FT   CDS_pept        complement(191919..193091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0178"
FT                   /product="Glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81021"
FT                   /db_xref="GOA:Q5QWK5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK5"
FT                   /protein_id="AAV81021.1"
FT                   /translation="MSSAGFNWSDPLNWQNTLSDEEKMIQESAHQYAQEKLMPRVLEAN
FT                   RNENFDRQIMNELGEMGLLGATLPEEYGGSGVNHVSYGLIAREIERVDSGYRSAMSVQS
FT                   SLVMHPIYTFGTEAQRKKYLPKLASGEWVGCFGLTEPDSGSDPASMRTTAKRTDKGYVL
FT                   SGSKMWITNSPIADVFVVWAKLDGEIRGFVLEKGMKGLSAPKIDGKFSLRASITGEIVM
FT                   DGVEVSEDHIFPEVKGLKGPFSCLNKARYGIAWGSLGAAEFCWHAARQYTLERSQFGRP
FT                   LAANQLIQKKLADMQTEISLGLLGCLQAGRELDKGTLNPIAISLIKRNSCGKALDIARQ
FT                   ARDMHGGNGIADEYHVIRHVMNLEAVNTYEGTHDIHALILGRSQTDIPAF"
FT   gene            complement(193112..193807)
FT                   /gene="fnr"
FT                   /locus_tag="IL0179"
FT   CDS_pept        complement(193112..193807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fnr"
FT                   /locus_tag="IL0179"
FT                   /product="Anaerobic regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81022"
FT                   /db_xref="GOA:Q5QWK4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK4"
FT                   /protein_id="AAV81022.1"
FT                   /translation="MTMRTPIQCSQCSMQSICVPAGLVPTDVEILDKCSREPHLFNKRN
FT                   VVFSEGQKLNSVFAIKSGSVKCYTIDSNGKQQITSFHMVGDIVGLESLASGSAATYCET
FT                   METSMLCEIRLSKLFAQELPKVESNLLQLMSRRLANCSKHYLNVVNTSAEQKVVAFLLS
FT                   ISTHMHQHGLSRSEYRLPMTRTDIANYLGLAVETVSRIFTALKEQQLINTEQSILTIND
FT                   FTALESRVA"
FT   gene            complement(193887..194084)
FT                   /locus_tag="IL0180"
FT   CDS_pept        complement(193887..194084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0180"
FT                   /product="Ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:IL0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81023"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK3"
FT                   /protein_id="AAV81023.1"
FT                   /translation="MIVINDGCINCDVCEPECPTEAISMGDSIYEINQDKCVECEGYYD
FT                   TPNCYAVCPVEAVDILQDKG"
FT   gene            complement(194081..195379)
FT                   /locus_tag="IL0181"
FT   CDS_pept        complement(194081..195379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0181"
FT                   /product="Collagenase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81024"
FT                   /db_xref="GOA:Q5QWK2"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK2"
FT                   /protein_id="AAV81024.1"
FT                   /translation="MSAADFRPELLCPAGSPEAMRMAFAYGADAVYAGEPRYSLRVRNN
FT                   SFTLENLGECINEAHQQGKRFYVVVNIAPHNAKLARFVEHICTIVDMKPDALIVSDPGV
FT                   VMLLQQYFPDQPLHLSVQANTVNWAALQFWQQQGIERVILSRELGLKEIAEMRKQVPDM
FT                   EVEVFVHGALCMAYSGRCLLSGYMNKRDPNQGACTNACRWGYEVHEAKENAVGQYEPVL
FT                   LGDPKRPQDLMLLDEDIHGSYIMNSKDLRAVEYVKDLVEMGVHSLKIEGRTKSDYYIAR
FT                   TAQVYRRAIDDAVAGKPFNNELLSELEGMANRGFTAGFLQRHTPQDLQNYERSHSEGEH
FT                   ILVGQLAAATADNTLYEVEVKNGFSIGDELLLMTPKGNYPFQLARMESLKNEAMIRAPG
FT                   SGYQVKLQTPVSIEKNDILFCFLIKEATVRKVA"
FT   gene            complement(195517..196176)
FT                   /gene="narL"
FT                   /locus_tag="IL0182"
FT   CDS_pept        complement(195517..196176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narL"
FT                   /locus_tag="IL0182"
FT                   /product="Nitrate/nitrite response regulator (CheY, HTH
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81025"
FT                   /db_xref="GOA:Q5QWK1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK1"
FT                   /protein_id="AAV81025.1"
FT                   /translation="MTTEAASIMLVDDHPLLRKGLKQLIAMEDDMTVVAEASNGPDALL
FT                   LAVEHDPDLIVLDLNMQGMDGIETLKRLRDSGVTSRIIMLTVSDADDDVVAAITNGADG
FT                   YLLKDMEPELLLEQIHRAVTGKMVLSEAITEILATALRQPTQSTTSQLSNLTNREHEIL
FT                   SLIAKGMSNKVIARELDISDGTVKVHVKHLLKKLGLRSRVEAAVWMVNLQGNKAPQ"
FT   gene            196398..197729
FT                   /gene="narK"
FT                   /locus_tag="IL0183"
FT   CDS_pept        196398..197729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="IL0183"
FT                   /product="Nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81026"
FT                   /db_xref="GOA:Q5QWK0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK0"
FT                   /protein_id="AAV81026.1"
FT                   /translation="MGKVSQANTMSDVRDYLGSRALSRGLTLSVLLLGVTFWASWSVIV
FT                   VLLAKSNLNLSPVQLLSLVAIAGASGAVSKLLGTLLVNILGRWMPTVIATLMLLMSIIS
FT                   YVQFSAVQLSYPILVALAAGSGMGCMMFAPAFDLTRQSKVMIPLPLSMSLVIGMMIFSL
FT                   FLAQLVVPLLATWQLAAVDSALILERSSGHFFARIEAGQTILLNNFSFVWAILFGLTAI
FT                   LSAAAALLSNHKQSLPKVTLRKLLAHNGHVWYCSILYNMTFGSFIGFTMALPLMLEFVF
FT                   GYSTLILVWMGPFIALLARPFGRWLATIFGGALITQVSLLLMMIFGALAGRYMYFAQHG
FT                   ATELYFEPFFISMLGLIFTSALGNGSVVVSMTKVFPRTYTHRVLIWAGTIAMLGAVYLP
FT                   LRFAWALQSQNMDTVYIDFIVFYVIGLLLNGFVYLRRRGQFYNP"
FT   gene            complement(197751..199547)
FT                   /gene="narX"
FT                   /locus_tag="IL0184"
FT   CDS_pept        complement(197751..199547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narX"
FT                   /locus_tag="IL0184"
FT                   /product="Nitrate/nitrite sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81027"
FT                   /db_xref="GOA:Q5QWJ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ9"
FT                   /protein_id="AAV81027.1"
FT                   /translation="MIRNASIINVFRVSLALIVIVASASSLSAFWLLEKSEQDAELINV
FT                   AGSHRMKAYKFALQLSSGKKVQASETAQEIDTLWEQPLLHRHFVKAGGSIQQLAKDART
FT                   EWQRVHSEIAEQDFARFSQQQSNAIDNYVNQLDTLVGQLQEHSERRMETVRSSLALASF
FT                   FIVAIFFFLLTVLKRKINQPLRHLLAVSKRLGQGDFTAKSKIDNEDEIGQLSRTMNKMS
FT                   ETVSYFYGGLERRVEQQTQELSRKNKVLSFLYDTARSIIVHSYDYNNYQQVIEKLYEIG
FT                   EVNDIELCLLTEEGNRPFLQLQPRPSSHEPCEAGDCATCLKAGPGASVIEDKLVYRFVL
FT                   KREDQNYGVLIVRCEQGQPLATWQQQLMSSTADQLALSQSLKSEEEQVRRLALMHERTV
FT                   IARELHDSLAQALSYLKIQVTRLHKGIEKNDRATIDDVSNELREGLNSAYRQLRELLTT
FT                   FRLKVDGSGLYSALQTTVKQLTEQSNMVVHLDYRLNNIPLVPHEEIHLLQIIREASQNA
FT                   VNHSQGSEVHISLSQPSGQDVELKITDDGIGLPENAEKVNHYGLAIMQERSRNLGGEIK
FT                   ISRLESGGTEVCFTFTPDYLLQ"
FT   gene            complement(199622..199897)
FT                   /locus_tag="IL0185"
FT   CDS_pept        complement(199622..199897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0185"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWJ8"
FT                   /protein_id="AAV81028.1"
FT                   /translation="MSRKPDTKTAMYQLLDVIRKHIPFGLKEADMCQGICRGCSKKMME
FT                   MLDAEVSQWQADLDNELAEPTLADLVFMEKLARRTEKVLHRNKLMN"
FT   gene            complement(199972..202212)
FT                   /locus_tag="IL0186"
FT   CDS_pept        complement(199972..202212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0186"
FT                   /product="Nitric oxide reductase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81029"
FT                   /db_xref="GOA:Q5QWK6"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK6"
FT                   /protein_id="AAV81029.1"
FT                   /translation="MAGYRKLWWTLIAVLAITFGLLGYFGTEVYREAPPIPDKFMSTNG
FT                   KVIATEESVLDGQTAWQSVGGMQLGSIWGHGAYQAPDWTADWLHRELLAWLDIRANEVF
FT                   GKPYEQLAGSQQNQLEYELKEEYRTNTYDKASDTVILSERRIQAIEQTGEYYSKLFSDD
FT                   PELRPTRVNYAMKENTLPSEARRAVMNDFFFWTAWAASTERFDSDITYTNNWPHETLID
FT                   NVPSAENIIWSIVSVILLIAGVGFLIWAWAFLRQHDEEDPVAPEHDPIAKIKLTPSQKA
FT                   LGKYLFIVVALFSLQVLLGGLTAHYTVEGQEFYGINISEWFPYSLTRTWHIQAAMFWIA
FT                   TGFLAAGLFLAPIINGGKDPKYQKLGVDILFWALVLVVAGTFIGNWLAIAQIMPEHLNF
FT                   WLGHQGYEYVDLGRLWQIGKFLGIVFWLVLMMRCVVGAFKVKGDKNLLALFTASVVAIG
FT                   LFYGAGFFYGERTHISIMEYWRWWIVHLWVEGFFEVFATASLAFIFHSMGLVSRRMATV
FT                   AALASASLFMLGGVPGTFHHLYFAGTTTPVMAVGATFSALEVVPLIVLGYEAWENYSLQ
FT                   KRATWMQRIKWPLLCFVAVAFWNMLGAGVLGFMINPPISLYYVQGLNTTPTHAHAALFG
FT                   VYGFLALGFVLLILRYIRPNLQFDEKLMKMAFWTMNIGLALMLFTSLLPVGFIQFYAAA
FT                   SEGLWYARSEAFMQQPLLQNLRWFRTLGDMVFIVGALGISWQVVKGLKHKSD"
FT   gene            202584..203057
FT                   /locus_tag="IL0187"
FT   CDS_pept        202584..203057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0187"
FT                   /product="Radical enzyme activating protein"
FT                   /note="probably involved in ribonucleoside-triphosphate
FT                   reductase activation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81030"
FT                   /db_xref="GOA:Q5QWL4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014191"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWL4"
FT                   /protein_id="AAV81030.1"
FT                   /translation="MPVSPTSLHYSAEQVVWQEVPGEVALAYTITGCPVGCKGCHSVDS
FT                   WPVGSGSPLTQEHLAQQLQKYRGLITCVLFLGGEWQPTALLKLLKQVRNEGLETCLYTG
FT                   YESVSISLREQLTYLKTGPWIAARGGLESPTTNQRFYDLRTRQLLNCKFQTGE"
FT   gene            203060..204898
FT                   /locus_tag="IL0188"
FT   CDS_pept        203060..204898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0188"
FT                   /product="Oxygen-sensitive ribonucleoside-triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81031"
FT                   /db_xref="GOA:Q5QWL3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWL3"
FT                   /protein_id="AAV81031.1"
FT                   /translation="MLRLNEEQVTGKVDFIHEYLHAQNAADGSKMDANANVTQKNIATL
FT                   EAELMKDFFVQVNRKQVSNKISELFGNELAKEYVRQIEDHEIYVHDETSLKPYCVSVTM
FT                   YPFLRDGLTKLGGESQAPKHLESFCGTFVNFVFAVSSQFAGAVATVEFLTYFDYFARKD
FT                   YGDDYLNTHRHQIENHLQHVVYALNQPAAARGYQSVFWNISIYDQHYFDSMFGEFVFPA
FT                   DFTKPEWNSVSALQDFFLDWFNKEREKTILTFPVVTVAMLTNEGECKDQLFAEKIAGEM
FT                   ANGNSFFVYLSDNADSLASCCRLRSEISDNTFSYTLGAGGVATGSINVITMNMNRLVQD
FT                   GRDLEEEVSKIHKYQVAYRKLMEEYKKAGLLTVYDAGFITLDKQFLTIGINGMVEAAES
FT                   QGITAGNNEAYKDFVQSHLKVIYDANKAAKKEYGYMFNTEFVPAENLGVKNAKWDRSDG
FT                   YKVSRDCYNSYFYAVEDEDANALDKLVLHGKELIEYLDGGSALHLNLDEKLNTSGYLSL
FT                   LNIAAKTGCNYFCINVKITICNACEQIDKRTLSECSSCGSEDIDYGTRVIGYLKRVSAF
FT                   SAGRRKEHHLRHYHRKQPAEVAVGAAQSNRVFRRAS"
FT   gene            205090..206523
FT                   /locus_tag="IL0189"
FT   CDS_pept        205090..206523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0189"
FT                   /product="Na+/H+ antiporter NhaD"
FT                   /db_xref="EnsemblGenomes-Gn:IL0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81032"
FT                   /db_xref="GOA:Q5QWL2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWL2"
FT                   /protein_id="AAV81032.1"
FT                   /translation="MKRLLFTVISLLFSVSVLAAESSADRIDLTSSTVGYAAIVIFILA
FT                   YILVMGEEKLHMRKSKPVLVAAGVIWILIGFVYTGDNAVLAEEAFRENLLKFAELMLFL
FT                   LVAMTYINALEERRLFDALSAWLMKKGFTYRKLFWITGFLAFFISPIADNLTTALLMSA
FT                   VVMKVAEGNKKFVALCCSSIVIAVNAAGAFSPFGDITTLMVWQSGKVEFTEFLQLFVPA
FT                   LVNYLIPAVIMSFFIENKSPTTLHTEVELKRGALRITFLFLLTVATAVACHIWLHLPPV
FT                   LGMMMGLGYLQFFGYFLRMTLPGSLARKRAMAAREGDQKRLQQLGGVVPFDVFSRVSRA
FT                   EWDTLLFFYGIVLCVGGLGFMGYLGLLSESLYGGLDPTIANSILGVVSALVDNIPVMFA
FT                   VLSMDPEMSTGHWLLITLACCTGGSLLSIGSASGVALMGQARGYYTFMSHLKWTPVIAI
FT                   GYAASILLHLWLNQATFLS"
FT   gene            complement(206921..208282)
FT                   /gene="hemN"
FT                   /locus_tag="IL0190"
FT   CDS_pept        complement(206921..208282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="IL0190"
FT                   /product="Coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81033"
FT                   /db_xref="GOA:Q5QWL1"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWL1"
FT                   /protein_id="AAV81033.1"
FT                   /translation="MSTVTWDKELIEKYNINGPRYTSYPTALMLSEQFSESRIETALKN
FT                   ANDGLCLYLHLPFCHKLCYYCGCNKVITRHQHKADKYLDYLAGEMAMYQPMVRDKKIRQ
FT                   IHLGGGTPTFLTEQQLTRLMELVHQHFTFAENPEVSIEIDPRSCSDEKLRHLRKLGFNR
FT                   VSYGVQDFDKKVQIAINRVQDIELIAHQLKLSKELGFESINLDLIYGLPYQRPETFKKS
FT                   IEQVIEMDPDRISVFSYAHLPQRFAGQKKIPEESIPQPSVKLSLLEQAITQLNDAGYQF
FT                   IGMDHFAKKDDGLAIAQREGRLQRNFQGYTTDGQDALLGLGVSSISQVNGVLWQHEKEL
FT                   PAYYKMIDNGQKPIIKSMALNDEDKLRAALISQVICHFELDIEAFKAEWDLDDFWAHFA
FT                   EAIPLLKPFIEDGLVDVSDKKLRVTDLGRLWVRSICACFDEYLDHGQNRYSKVV"
FT   gene            complement(208317..208814)
FT                   /locus_tag="IL0191"
FT   CDS_pept        complement(208317..208814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0191"
FT                   /product="Predicted lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81034"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWL0"
FT                   /protein_id="AAV81034.1"
FT                   /translation="MNTTNWVSYIPNIIRPINKLIPSKFINFGSEKLLNLLFKEEISSG
FT                   ELNFISGNIIEIKVKDIDLSLFLTLKVNQLKSLKSPVEPDVKLSADGDALLLLIYGKVD
FT                   PDTLFFNRKLMVKGNTELGLHLKNFLDTIEVNQKLPRTLYLIGDRFSDFIYKEKGETIQ
FT                   TS"
FT   gene            208908..209900
FT                   /locus_tag="IL0192"
FT   CDS_pept        208908..209900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0192"
FT                   /product="Collagenase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81035"
FT                   /db_xref="GOA:Q5QWK9"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK9"
FT                   /protein_id="AAV81035.1"
FT                   /translation="MELLCPAGSIPALKAAIENGADAVYVGLKDETNARHFAGLNLNQM
FT                   KLAEAADYVHKHGRKLHVAINTFAHADCWEKWRRAVDDAVLAGADVLIIADLAVLAYAA
FT                   ERYPKVERHLSVQASATNAGAIRFYQQFGVSRVVLPRVLSMQQVRALARTTDVELEVFA
FT                   FGSLCIMAEGRCYLSSYLTGESPNTAGACSPAAFVEWDEQDNKLESRLNGVLIDRFDEN
FT                   EKAGYPTLCKGRFSVDDEIYNVLEEPTSLNTLSLLPQLYKEGIASLKIEGRQRSPAYVS
FT                   QITRVWRQAIDAVMTDPDAFEVEDNWNSVLASLSEGSQTTLGAYHRKWK"
FT   gene            209906..210778
FT                   /locus_tag="IL0193"
FT   CDS_pept        209906..210778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0193"
FT                   /product="Collagenase family protease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81036"
FT                   /db_xref="GOA:Q5QWK8"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK8"
FT                   /protein_id="AAV81036.1"
FT                   /translation="MKFSLGPILYFWPKQQVFDFYQQAAESDVEHVYLGETVCSKRREL
FT                   KLDDYLAIAHMLREAGKKVTLSTMTLLEAPAELRELGKYCDNGEFDVEANDVSAIGVLQ
FT                   EQGLNFTAGPGINIYNHQSLRRLIDMGMTRWVVPFELSRDWLQDVLQHNLIDTVRDCFD
FT                   VEVFSFGHIPLAWSGRCFTARSENRPKDQCELCCIKYPEGREVKSQEGQQVFVLNGIQT
FT                   QSGTRYNLINQLPGMNGLVDIVRISPQPEGTFDWLQRFRSNINGEHPVTLTSKENNGYW
FT                   LQLAGLATG"
FT   gene            210884..212086
FT                   /locus_tag="IL0194"
FT   CDS_pept        210884..212086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0194"
FT                   /product="Heme/copper membrane protein"
FT                   /note="involved in nitrate/nitrite taxis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81037"
FT                   /db_xref="GOA:Q5QWK7"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWK7"
FT                   /protein_id="AAV81037.1"
FT                   /translation="MQITDRQKEEQLTPILRQAFRPLFLLGAGFSAVAMLLWGLALGGK
FT                   LSLPVYGNIMFWHSHEMLFGFVVAIVLGFLLTAVQNWTGLRAPHGNTLLILTVLWAAAR
FT                   LMLLLGGDLPWWLVAAVDVSLLPVAAFLFGRMVLKVNQTRNLFFVPILLLLTVCNLLMH
FT                   YGLHFGHYHIQVLGAYNAVFLVTLLMAIIGGRVLPMFTANGTQTPKVTPIVWLDRIALG
FT                   SLWLIFAVHFLNLHTLLPNQMMVVLFGVSAAATGIRVARWKIWITWRVPLLWSLHLAYW
FT                   FIPIGLALFALRYAGFDLTQSLALHALTAGAMGNMILSMIARVSLGHSGRPLQPKLIMT
FT                   GAFLLVLIAALTRVFLIWLAPDLASHWLMCSALAWTLAYGIYVVVYFKVLTTPRADGNP
FT                   G"
FT   gene            complement(212083..212475)
FT                   /locus_tag="IL0195"
FT   CDS_pept        complement(212083..212475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0195"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81038"
FT                   /db_xref="GOA:Q5QU01"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QU01"
FT                   /protein_id="AAV81038.1"
FT                   /translation="MTRELLIRLLWRALALFFVLLGLIGIALPVMPTVPFLIAALWAAS
FT                   KGWPRLEAWLLNHPKYGPDIKAWRDHRVIKRRSKIIALVMMATGYLVLWLFVPQVPVWL
FT                   KAIVGVVLVVVGCWLATRPDHSPEET"
FT   gene            complement(212472..214016)
FT                   /gene="norR"
FT                   /locus_tag="IL0196"
FT   CDS_pept        complement(212472..214016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norR"
FT                   /locus_tag="IL0196"
FT                   /product="Nitric oxide reductase regulator"
FT                   /note="contains GAF, AAA-type ATPase, and DNA binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81039"
FT                   /db_xref="GOA:Q5QU00"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QU00"
FT                   /protein_id="AAV81039.1"
FT                   /translation="MLQESLLADLLTEQPAAVRLQNLVNTLRSHFNCGAVVLLKLDNEV
FT                   LQPVAIQGLVREALGRRFVVAQHPRLAALLASRNPVRFEHDSSLPDPYDGLLAEQPGNA
FT                   LPVHDCMGISLYLENKCWGVLTLDALQPGTFTDNSMIELQKFSLFVETAVRIGQLEQNV
FT                   RALRQGQQRTMPKSGTTERNESEIIGHSKAIESVLKELRVVASADLPVLLLGETGVGKE
FT                   LFARELHILSQRSDKPLIYVNCAALPESLAESELFGHVKGAFSGATSDRSGRFEVAHGG
FT                   TLFLDEVGELPLSIQAKLLRVLQNGEIQRLGSDKYRKVDVRLIAATNRNLRQQVSNETF
FT                   RADLYHRLSVYPLPIPPLRERGDDVSILAGHFLELNRARLGLRALRLSPEAELAIQQYQ
FT                   WPGNVRELEHVISRAAIKLLSHGVEKTDIATIEPDMLDLDVQLPFSATTDSGKNSVGAS
FT                   LPPANVSMKEAVNYTQRKMIESALGRHNNSWSQAAKDLQLDASNLHKMASRLGMKS"
FT   gene            214175..214714
FT                   /locus_tag="IL0197"
FT   CDS_pept        214175..214714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0197"
FT                   /product="Probable regulator of cell morphogenesis and NO
FT                   signaling"
FT                   /db_xref="EnsemblGenomes-Gn:IL0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81040"
FT                   /db_xref="GOA:Q5QTZ9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTZ9"
FT                   /protein_id="AAV81040.1"
FT                   /translation="MSTFDDRLQTAEQQWQDASPKHLIEHIYLRFHQRHREQLPELKQL
FT                   AMRVEAVHGDHPEAPVGLTEHLDNLMQELESHMTKEEQILFPLLSRGVYPGGPISVMES
FT                   EHVQHEGELNRIGELTNNLTLPEGACGTWTALYKGLKELQDDLHEHIHLENNLLFVEKK
FT                   ASAPEHGKDFCCGSCQ"
FT   gene            complement(214708..215898)
FT                   /gene="mltC"
FT                   /locus_tag="IL0198"
FT   CDS_pept        complement(214708..215898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltC"
FT                   /locus_tag="IL0198"
FT                   /product="Membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:IL0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81041"
FT                   /db_xref="GOA:Q5QTZ8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTZ8"
FT                   /protein_id="AAV81041.1"
FT                   /translation="MNKKTQLTTLLAAIATTLILAGCQITPNNVKRVVNSGVLSGSDPS
FT                   AVVESMARERLHSYRSNPQLLISDIEDLREALRDLRAVAEAIWGDEENTVPSSKKYVKY
FT                   SDNFHAKAVVDFEQGLLTVATLHDSNDPAKTREQLKAAIVRTLLTPTDLTAVDIFTDKE
FT                   PERTGKPFLRGQVVDQDNVVVEYEWRANRFAEYLVKNQLRTRRAKNNKVYEVQIALVDE
FT                   HQELRKHQYADYVIAAARRYNLEPELIYAIIETESSFNPYAVSHANAYGLMQVVASTAG
FT                   RDVFERVRKIPGQPTSQQLFDPAQNIDIGSAYLHILNTQYLKGVQHPRSREYAIVSAYN
FT                   GGAGNVLKTFSSNRSNAVQIINRSQPGIVYRDLTSKHPLAESRRYLEKVMYFKQGY"
FT   gene            216006..218669
FT                   /locus_tag="IL0199"
FT   CDS_pept        216006..218669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0199"
FT                   /product="Conserved secreted Zn-dependent enzyme from
FT                   deacylase/carboxypeptidase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81042"
FT                   /db_xref="GOA:Q5QTZ7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTZ7"
FT                   /protein_id="AAV81042.1"
FT                   /translation="MRSLKFAALIAASWLVMPTQAQQLSGESSLLPEANYSNSEVTVEQ
FT                   VLGYPLGTKITSPADMSRYFEALQQAYPKQVKLLEYGKSWERRTLYYAVISSEDNMADF
FT                   DGFMKGMQALADPRKTDSDKAEQLIDELPGSIWLSYGVHGNEISSPEAAMVTAYHLLHD
FT                   QREQTQRWLDNTMVFIDPLQNPDGRARFVDRYYMSVGLEHSGDRRSAEHNEPWPNGRTN
FT                   HYLFDMNRDWIALTQPEISGQIDALLKYYPLVFVDLHEMGGDSTYYFTPEARPYNPLIT
FT                   ESQRETLNWIGKNNGQWFDEKGFDYFTREIFDAFYPGYGASWPLYQGSVAMTYEMASAR
FT                   GHLFDRTDGDVLTYADGVQQHFIASISTIQTVSERREALLQKFWEYRKSAVEAGEDGDV
FT                   RSIILPAKDDPAAARKLASLLVEQGAEVKQAEKAFDVCGTDYEAGAYIIDMAQPAHRMI
FT                   RTLMDKQVDMADDFLAEQEQRRNNNLPDQIYDVTGWSLPLMFNVDSHTCDDLPDVATAF
FT                   VEEGRIEPGKVINPDAKVTFLVRWGDMNAGRFLTAALREGLEVRQSELAFTHESAGEFP
FT                   SGSLILTRADNSDDLQTKLQKLAEASGATVEGVDTSWMTEGPNFGSHNVSKLEAPNIAI
FT                   AWDEPVSPYSAGHTRFVIERQMGYPVTAIRTMQLLQNDLDGLDVLILPEGAYSGVFNDK
FT                   SVEKIQRWVSDGGVLLTLGSASAWAVETGLLNTQLERKVPEEGVTEPDEEIKVDGKVIE
FT                   SREQLLTEIKPHGADPDWVPGALLNAKVDTKHWLSAGVKPQVVSIYNGNDVFTPIDIDH
FT                   GRNIAWFAGADSLLASGFLWDDIAQQLPYKPLLMWQPSGKGMIISFTQEPTYRAYMDGL
FT                   NTLLMNALFLAPAKAQ"
FT   gene            218679..219341
FT                   /locus_tag="IL0200"
FT   CDS_pept        218679..219341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0200"
FT                   /product="K+ uptake system component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81043"
FT                   /db_xref="GOA:Q5QTZ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTZ6"
FT                   /protein_id="AAV81043.1"
FT                   /translation="MAEFGVIGLGRFGARTSKELLDLGHRVIGVDSDEKAVEAMADVLT
FT                   HSAIADVTDEKALEELDLTNCEVVLVAIGEDLQASLLCVLHLKTIGVKEIWAKATSKSH
FT                   HQILSKLGVKRIIHPEEEMGIRVAQSLNYPMVNEYMSLGHNWFCVEISIGEYLKGKTLD
FT                   DIMPDDSEFFHVLLIKRRDEVTVTPSLSMTLEGNETLVMAGSLKALKSVAPKLKEPS"
FT   gene            219338..220708
FT                   /locus_tag="IL0201"
FT   CDS_pept        219338..220708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0201"
FT                   /product="K+ uptake system component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81044"
FT                   /db_xref="GOA:Q5QZ85"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ85"
FT                   /protein_id="AAV81044.1"
FT                   /translation="MKQWAPSIAWLYRRPGRKRRRAFKASPPVILSGGFACLILLGTLL
FT                   LKLPFSTEQPITWLESLFTATSAVTVTGLVVVDTGATYTPFGMSVLALLIQAGGLGFMT
FT                   FAVLAAISIGGHVGIQHQVLAKEAMQQTSLASIGRTAKAVVSLALIVEAIAVVGLTITW
FT                   WQEKGFVDAFAESIFYAISAFNSAGFVLSPNGIVDYADSIPVNLIISILFVIGGLGFSV
FT                   ITNIYEKRRWYKFSVYTRAILWATLIINVLSVAIIWLLEMNNPATFANLSFGDQAMAAW
FT                   FQATTPRSAGFNTVDTGAMTEASAVYTMLLMLIGGGSMSTAGGIKLGTFIVLLVATYAF
FT                   LRRREYVTLLNRTVPQELVMKALAVTLVTLTLMFLGIFILMILNPLPFIDITFEVLSAS
FT                   ATVGLSRGITAEVTGASQLVLVFLMFAGRVGPLTLAYFLATPRKRHIRFPETDIQVG"
FT   gene            220762..222654
FT                   /locus_tag="IL0202"
FT   CDS_pept        220762..222654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0202"
FT                   /product="Methyl-accepting chemotaxis protein (HAMP, Cache
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81045"
FT                   /db_xref="GOA:Q5QZ84"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ84"
FT                   /protein_id="AAV81045.1"
FT                   /translation="MLKKLKFTQKVIIVASLILVLVLGVFTLTNFLQMSNQTRSNLQHQ
FT                   MQALSDSVSNNISQWFDDRMSIVQATADAYRVDDSTDRALERVQQSKAAGKFKNVYYGL
FT                   LDGTFLLDDPSIDLPDDYDARSRPWYQLAVDEGQPTYTAPYIDVTTNELTITAVVPMRR
FT                   DGRLVGVAGGDMMLDEISNIVNDIDFMGLGYAFLVSGDRNILAHPNKDWIEKSVNDYAG
FT                   QSVAFSSEFSEYRIDGADRLVSFHKIKGIQGVEWYLGVVIDREKAYSNVSSFAWTAIIY
FT                   LVIGIVAVVVSLTWLLRLLLKPLRRLNEAVTDMARGEGDLTQRLPVESDDEFGLVSRRM
FT                   NEFIEKIQQALLEVNAAAQQVEGNIRSMVKASDDSMDIGSEQAGKASSVATAVNELGAS
FT                   AHEIAENAAKASEQASSGTEKASSARDSLQHNRQQIQHLSERMDASSQAIHTLDEDTQN
FT                   IGKIIEVIKGITEQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLAQRTSSSAGEIET
FT                   MIERVRAGTRSVVQVIQESQEISSACVLSAEESAEHMSEINAIIVTIDDVNHSVASATE
FT                   QQTSVIQTLDRDIMDISSMNDQSVDNLNNTKRACRELNTAFERLEQLVTQFKLN"
FT   gene            222681..223109
FT                   /locus_tag="IL0203"
FT   CDS_pept        222681..223109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0203"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81046"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ83"
FT                   /protein_id="AAV81046.1"
FT                   /translation="MNKAWMIGAIALLGGPVLATTAQAVERTESSEQAQAYIISPQNGE
FT                   VVGKTFKVKFGLSGMGVAPAGVDVKNTGHHHLLVDKDELPAMDKPMGGDVTHFGGGQTE
FT                   TTVTLEPGEHTLQIILGDKNHVPHNPAVVSEKITITVK"
FT   gene            complement(223112..224182)
FT                   /gene="dinP"
FT                   /locus_tag="IL0204"
FT   CDS_pept        complement(223112..224182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="IL0204"
FT                   /product="DinP"
FT                   /note="DNA polymerase involved in DNA repair; SOS response"
FT                   /db_xref="EnsemblGenomes-Gn:IL0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81047"
FT                   /db_xref="GOA:Q5QZ82"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ82"
FT                   /protein_id="AAV81047.1"
FT                   /translation="MAEIARKIALLDLDAFFASAEELRDPSLKTRPFAVGGGGERGVVA
FT                   TANYLARQFGVKSAMPGSHARRLCPQLTFIRPDGNYYRELSDKVLDILRELTPRIEPAS
FT                   IDEFYLDLTHLEGFKGSATLAMDFVREQIKTLGITGSAGISNQKMVAKIASEERKPDGQ
FT                   FVVRPAEVMDYIAALNLKQIPGVGPKSQQVLTNYGLTTGKDIQNIELQQLQAILGDKAG
FT                   YVLFERCHGRDRREVVTERIRKSVGVEQTLATDMRLESTAQAYVQDNLLPKLRQRMKIT
FT                   HWREQPIRSQTLKLKFSDFTQTTVSRSAQFISPSLFYQLLDEAWQRGKGKGVRLLGISA
FT                   TLPDPNEQLQLELELD"
FT   gene            224267..224692
FT                   /locus_tag="IL0205"
FT   CDS_pept        224267..224692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0205"
FT                   /product="Cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:IL0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81048"
FT                   /db_xref="GOA:Q5QZ81"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ81"
FT                   /protein_id="AAV81048.1"
FT                   /translation="MKAMNSFFVKSVLGTISMLFALSISAASVQDDMSREAIAERIKPL
FT                   GKHYVAGESSAAEESSGPRSGQQVYDKYCTACHTSGVMGAPKRNNAADWQPRLDQGMET
FT                   VLKHAVEGFNAMPPKGTCSDCSEEEIQAAINYMTEEI"
FT   gene            224914..227514
FT                   /locus_tag="IL0206"
FT   CDS_pept        224914..227514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0206"
FT                   /product="Intracellular signaling protein (GAF,GGDEF,EAL
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81049"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ80"
FT                   /protein_id="AAV81049.1"
FT                   /translation="MTDRTHSEEQLQNIKTENERLHKVIARLKGLTQKYRSAEVVQKAL
FT                   FRISELAASAREMDNFYQSLHEIIGELMYARNFYICLYEPQEELVDFVYFVDEIDQDTL
FT                   FERIPIEQLKKGLTGYVLRKGQSLLCPPEVYQRLIDNAEIEGLGAEHQDWLGVPLKRGD
FT                   VTIGVMVVQSYSADVRYDASDEDLLTFVSQHVVNALERLKQRDLMQSEIEHQTAELRHA
FT                   NESLMSEITIRERAEQQTSVLFAISELTNTSDDMNAFYRQLHRQIGKLIHADNFFVALL
FT                   SDDKKFIHFPYHVDETGAKAECRRAGKGLTEYVIKMREPAFIDAPVRQKLLKKNEIELG
FT                   YGGMKLAKQWLGSPLMMNGQVFGVIAVQTYDGDFLYHSDDLELLNFVSQHVAVAIDRKR
FT                   SAEEIQRVNQFLEKKVAERTEELVSEIERRKKTESSLFHAAHHDNLTGLPNRILFNERL
FT                   QQAVAHKRRHPEHHFAVLFVDLDRFKNINDTLGHSAGDEFLLEVSKRIGDCVRDNDMVA
FT                   RLGGDEFVILLDTITSIDDAKDVAKRMIQQMSEPFHLNGQEHYSGASIGIAECLEETDS
FT                   AERLLRDADAAMYQAKGMGRGRYVLFDDSMHENLVDSVRKETALRHAKVEKDFAVSFQP
FT                   IVNLTTGEVKAVEAKLVWEDPRYSFKSEELLPLAERTGLIVKLDRFALRAASQWLVENS
FT                   VSAETMLHLNLSVRHLLKTSHLNELVNIVTESGVKPENIALEFDETDLVRDGRRVLASL
FT                   RRLSEFGFKLVIDNFGSGSGPLQFLYNFPFTILKLDHHYIARLSSNNRAQAMLKHIVTL
FT                   CHELDIAVYADGLETETQKNDVEKQGVMMGQGSFIDENYEGTVAKDDDTSFVSA"
FT   gene            complement(227522..229531)
FT                   /gene="rep"
FT                   /locus_tag="IL0207"
FT   CDS_pept        complement(227522..229531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="IL0207"
FT                   /product="Rep helicase, a single-stranded DNA dependent
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81050"
FT                   /db_xref="GOA:Q5QZ79"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ79"
FT                   /protein_id="AAV81050.1"
FT                   /translation="MLNDRQNQAVHYIQGPLLVLAGAGSGKTRVITEKIAYLIRQQIYT
FT                   ARQIGAVTFTNKAAKEMKERIAQTLPKAQLRGLTVCTFHTLGLNIIRRELSTLGFKPGF
FT                   SLFDDQDTYALLNALTEEVFEGDKALIQACQHQIGHWKNAMLSPELALQKASNDQEKAF
FT                   AQVYQQYQNNLSACNAVDFDDLIRLPTQLLATNENARARWQKKFQYLLVDEYQDTNTSQ
FT                   YQLVKLLVGERARFTVVGDDDQSIYSWRGAQPKNLALLKQDFPQLDVVKLEQNYRSHGR
FT                   ILKAANILIENNPHVFEKKLFSEMQYGEPISVIFGRNEEHEAERVVAEIVKQRFLRKTP
FT                   YHHFAILYRGNHQSRLFEKALMNNRIPYKITGGQSFFARAEVKDIMAYLRLLVNPTDDT
FT                   AFLRIINTPRRGIGPQTVERIGRLSQELGCSLFEACQSPHLKTQLSTGVFQHVDVFRNM
FT                   IDTLARRADHQEDASDAVKQLLSEIGYEDWLFEQSPSAKAAEMRIKNVYELHRWVSDML
FT                   KGDAEHEPMELNQVVSRLSLRDMMSRNEDDEQFEQVQLMTLHASKGLEFPQVFLVGMEE
FT                   GLLPHQSSIDENNIEEERRLAYVGITRAQHKLVFTMAKERRQFGEKTEPQPSRFLLELP
FT                   QDDLEWEHRKQKSDEEREEQRSQGLEMLKNALKK"
FT   gene            229642..229887
FT                   /locus_tag="IL0208"
FT   CDS_pept        229642..229887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0208"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81051"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ78"
FT                   /protein_id="AAV81051.1"
FT                   /translation="MDNKTIENIARQINDSMPAGVKELAGNMEQRVKQTLQSQLSKLDL
FT                   VTREELDVQQQMLLRLRERVELLEKELEATKNQNKD"
FT   gene            229897..230637
FT                   /gene="fpr"
FT                   /locus_tag="IL0209"
FT   CDS_pept        229897..230637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="IL0209"
FT                   /product="Ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81052"
FT                   /db_xref="GOA:Q5QZ94"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ94"
FT                   /protein_id="AAV81052.1"
FT                   /translation="MIQWISGKVVENYRWSSGVFSLRVVAEPFDFKAGQFVRLGLNIGG
FT                   EQLLRAYSLASAPDEAILDFVIAEVEDGEVSTKLAQLQPGDSVYITQPAGGFFTLDEVP
FT                   DGDSLWMLSTGTGIGPFISMLRTEKPWERFKRINLVHGVRVAEDLVYQGQIEQWQQEYP
FT                   GQLGYQPVITRENIPGALSARIPELINSGQLSNALETPLDTSAQVMLCGNPDMIKESRA
FT                   ALAELGLAKNTRRKPGNVTSENYW"
FT   gene            230705..231271
FT                   /locus_tag="IL0210"
FT   CDS_pept        230705..231271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0210"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ93"
FT                   /protein_id="AAV81053.1"
FT                   /translation="MKPLTISDFSFTIKKPSSTVVAEPTEKPKVNETKPPEPAIDTSKL
FT                   TDEQAEKFKGLLSVDPENAKDITVEEYIALAESVMTFKEETIEGYSRVDDPLSLSAGVL
FT                   KVRLLFPEKGDISDRKVANVFENSQEWANRQYAEHSSYSDAVRIADKNLDTMTEFLMGE
FT                   NIRNLQAQALELLPEEGGFIIDEHA"
FT   gene            complement(231622..232353)
FT                   /locus_tag="IL0211"
FT   CDS_pept        complement(231622..232353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0211"
FT                   /product="Protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81054"
FT                   /db_xref="GOA:Q5QZ92"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ92"
FT                   /protein_id="AAV81054.1"
FT                   /translation="MNFIYKTFFVVAFIFSSNVFSQDLNPQQEEDLEKVEQLLRENPEL
FT                   IPNIHRGLQRFLEQQSEQKNAFANHQEWLYQSAAHPILGDQDAPHKIIVFTDYNCPFCK
FT                   KLEPGLHKLIEEYPSIQVVNIFVPLRQQQVDGLKTNSALYGLNLWRNDPKAFFEAHNLM
FT                   MKKSGMHTADSLQSVAQVTSTEAFLSPSGESEAVIRKNMSAFRDLGFRGTPTIIIGQQV
FT                   MPGYIPYDKLEEIATTQFNLN"
FT   gene            complement(232383..232907)
FT                   /locus_tag="IL0212"
FT   CDS_pept        complement(232383..232907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0212"
FT                   /product="Thioredoxin related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81055"
FT                   /db_xref="GOA:Q5QZ91"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ91"
FT                   /protein_id="AAV81055.1"
FT                   /translation="MSNSKVKPSWAKRLRTAALYIVLFSVVAFVVDAFRNSDVPESVPP
FT                   ELSSLTDINGEQYNLREMSKVSPVVLYFWATWCPVCPAVSPTVDYVGNHYPTISVALRS
FT                   GDNHKLTRYAQAKGYEFPIVNDNLNRVSNGWQVSATPTIIIIENGDIVSATTGVTTPPG
FT                   LFIRLWFHQFF"
FT   gene            complement(232897..234981)
FT                   /locus_tag="IL0213"
FT   CDS_pept        complement(232897..234981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0213"
FT                   /product="Thiol:disulfide interchange protein"
FT                   /note="membrane-associated protein disulphide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81056"
FT                   /db_xref="GOA:Q5QZ90"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ90"
FT                   /protein_id="AAV81056.1"
FT                   /translation="MNKILPLWLVSLIAALLIYSAQSLAETPSTGWLSHEDHPPVSVKL
FT                   ELTGHYEAERNLLPALLHVELDEGWKTYWRSPGEGGIPPTFDWAKSANINDIEWHWPVP
FT                   SRYSIQGIDTVGYQGSLTFPLMVQLSPDARQANISGTLTMSSCTTVCVLTDYPIDLHVD
FT                   LDTLTVDSDRAFAFNQATGKVPREYDSNNVKQAIWSDANQRVQLTIERDSGWQNPQLFI
FT                   HSNDETLADAEFSSPDIQVESNSLTANVDVSHWLDLPDLNGAELIATVSDEKFAAEYKI
FT                   QLTAGTIANNAPPLWAILLMALAGGLILNIMPCVLPVLGLKVQSLMLSGVQEPKVVRKQ
FT                   FFASSLGIISSFLVIALGLMALRWSGGSVGWGIQFQNPYFIAALVAITWLFALNLMGAF
FT                   EFKLPSSLSTSAATAGDDSYKGHFLQGMLATVLATPCTAPFLGTAVAFALAAESSVILL
FT                   IFAALGVGMALPWLLIAVFPRTAKLLPKPGRWMQWVKPVFAIMMLATTVWLTTLLKNFI
FT                   GNELFLALTVGLSVLTLVIIGKVHGRKALFLSIGGFLVLAAVVGTTLILTADRWVNKLP
FT                   QDHQWQPLTQQRIDEAVANGQTVFVDVTADWCVTCQANKVGVLLQDPVFTALGKEHVTR
FT                   LRGDWTKANESITQYLKANNTFGVPFNKVYGPGAPDGITLPVVLSKDKVMDALEDAREQ
FT                   "
FT   gene            complement(235031..235411)
FT                   /locus_tag="IL0214"
FT   CDS_pept        complement(235031..235411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0214"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /note="possible suppressor for copper-sensitivity A"
FT                   /db_xref="EnsemblGenomes-Gn:IL0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81057"
FT                   /db_xref="GOA:Q5QZ89"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ89"
FT                   /protein_id="AAV81057.1"
FT                   /translation="MFHQLNQQCRKGRYIAPLLFLVFMLCWGQNFGWLEGCPKHQAAPA
FT                   AEQLVGSHADLEAKHEGAEADCDKTTHLLQQFKSDITYAALSFFVLLTLALKATVNKQL
FT                   APPLFFFSCKRRPHAVFCCFLE"
FT   gene            235592..237139
FT                   /gene="comM"
FT                   /locus_tag="IL0215"
FT   CDS_pept        235592..237139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="IL0215"
FT                   /product="Competence related ATPase with chaperone
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:IL0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81058"
FT                   /db_xref="GOA:Q5QZ88"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ88"
FT                   /protein_id="AAV81058.1"
FT                   /translation="MALARVYTRALIGIHAPEIRVEVDLARGMPGFTMVGMPATTVKEA
FT                   RDRVKTALMNAGFEYPPATRITVNLAPADIPKTGARYDLAIAVGILAASGQIPDSILEQ
FT                   AEFYGELALTGELRAVNGLIPALLACRNKKRQAFVPIANEQEAGLVREQKSWLSADLVS
FT                   VYEHLHDHQPLRESKPINWAKESSNHDGDLADVVGQEQAKRALLLSAAGKHHLLFVGPP
FT                   GTGKTMLAQRLNGILPPLTEQEAMEIAAVKSVSFDYHHAEALTRRELRNPHHTCTAAAL
FT                   VGGGAGNSVRPGEISLANNGLLFLDEMPEFSRHVLDCLREPLGSGEITISRAGYNVKFP
FT                   ANFQLVCALNPSPCGQFDGSLANCRSTPDQILKYLSKLSGPLLDRIDIQVMVPRESESM
FT                   SLKGATKHKTQPMTSLQAKSLVEKARHRQLMRQGCLNSELKPKVLKQICFLSEQSEAFL
FT                   AKAAEKMKLSHRAYHRTLRLARTIADLADSKKIEQQHLAEALNYRALDRLIEQVQSL"
FT   gene            237536..237874
FT                   /locus_tag="IL0216"
FT   CDS_pept        237536..237874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0216"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ87"
FT                   /protein_id="AAV81059.1"
FT                   /translation="MKKEDIREAVEQDEKWDSGELGQEEAYVERVGFDQAIEDAINQSV
FT                   RLRPISIRMEEELIDDLKTIAEHYNLGYQPLIRQLLKRFVASEKKVLKQRAQVMEIKGP
FT                   EDKEAEEG"
FT   gene            complement(237991..239013)
FT                   /locus_tag="IL0217"
FT   CDS_pept        complement(237991..239013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0217"
FT                   /product="L-allo-threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81060"
FT                   /db_xref="GOA:Q5QZ86"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ86"
FT                   /protein_id="AAV81060.1"
FT                   /translation="MLDLRSDTVTLPSAAMRTAIAEATVGDDVYGEDPSINALEKRVAE
FT                   LLGKEDALLCSSGTQSNLLGLMSHCRNGEEYIVGQEYHTYRYEAGGAAVLGSIVPQTVE
FT                   VEADGTLSLETIEKRIKPNDPHFPITRLLAFENTHGGQLIDQAYFDKARILADQNGLSM
FT                   HLDGARLPNAVVASGRSMAELAAPFDSVSLCCSKGLGAPIGSLLAGSKELIAHARRWRK
FT                   MVGGGMRQAGFVAVAIDYALTHQFERIQQDHDNAKWLFEQLSELLAGTEAKVRYSGTNM
FT                   TFVELSDSLPADSLRELMTENDIKLPSGQKLRLVCHLDVSREQLERFVELFKQWLIREH
FT                   "
FT   gene            239142..240107
FT                   /gene="cysM"
FT                   /locus_tag="IL0218"
FT   CDS_pept        239142..240107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="IL0218"
FT                   /product="Cysteine synthase B"
FT                   /note="O-acetylserine sulfhydrolase B"
FT                   /db_xref="EnsemblGenomes-Gn:IL0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81061"
FT                   /db_xref="GOA:Q5QZA0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA0"
FT                   /protein_id="AAV81061.1"
FT                   /translation="MKVFNNVMEMVGNTPMVRVTNMDTGPCELYLKLELQNPGGSIKDR
FT                   IAVEMVEQAEKQGKLKPGDTIIEATAGNTGLGLALVAASKGYPLKIVMPDKMSQEKVNN
FT                   LRAMGAEVVQTRSDVQKGHPEYYQDMAARMAEENGYYYVNQFENPANVDAHYKTTGPEI
FT                   WEQMEGKLDAFVCGVGSGGTLTGVGRYLREQKSDIDLVLADPAGSILEPLVNRNEEVEA
FT                   GSWLAEGIGEDFIPTICDIKLANTAFAISDKEGMQTARKVLEKEGVMVGSSSGTLIAAA
FT                   LRYCQQQTEPKRVVTLACDTGNRYLSKLFNDDWMREQNLL"
FT   gene            240136..241308
FT                   /gene="metB"
FT                   /locus_tag="IL0219"
FT   CDS_pept        240136..241308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="IL0219"
FT                   /product="Cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81062"
FT                   /db_xref="GOA:Q5QZ99"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ99"
FT                   /protein_id="AAV81062.1"
FT                   /translation="MANEKTMKFATRAIHGGQSPEPVTGAVMPPIFTSSTYAQESPGQH
FT                   KGFEYSRSHNPTRFAWERSVASLEGGKQGLAFASGMAATSTILELLDSGDHIVAMDDLY
FT                   GGSFRLFDKVRGRSAGLKFSYVDLADLSAVEASIQDNTRMIWVETPSNPMLKLVDIEAI
FT                   VKLAKKKNPDIIVVVDNTFATPFNQRPLEMGADMVMHSATKYLNGHSDMVGGIAVVGDN
FT                   DDLVERMLFLQNSAGAIAGPFDSYLALRGVKTLALRMRHHNEAAMELAKWLEQHPKVEK
FT                   VIYPGLESHPQHELAKKQMQGFGGMISILLKGDLEAARKFLESVEVFALAESLGGVESL
FT                   IEHPAIMTHASVPKENREKLGILDNFVRVSVGIEDLDDLKADLDNALNAF"
FT   gene            241609..241761
FT                   /locus_tag="IL0220"
FT   CDS_pept        241609..241761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0220"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ98"
FT                   /protein_id="AAV81063.1"
FT                   /translation="MEFVSGINRRFHSTGKLGASCVRYWCQNVASFAANQYTTKHNGKA
FT                   QPLSG"
FT   gene            241783..242214
FT                   /locus_tag="IL0221"
FT   CDS_pept        241783..242214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0221"
FT                   /product="Predicted dioxygenase of extradiol dioxygenase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81064"
FT                   /db_xref="GOA:Q5QZ97"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ97"
FT                   /protein_id="AAV81064.1"
FT                   /translation="MSDTTNVRPFHLAIPVSSLDNARAFYGDVLGLSQGRSSDEWIDWN
FT                   FFGHQFVTHVAPNVAGLKNHSGVDGHSVPVPHFGVVLLRDDWEALAERVKAADIEFVIE
FT                   PYIRFKGKPGEQGTMFFYDYCGNALEFKTFNDDSQIFAT"
FT   gene            complement(242233..243192)
FT                   /gene="tdcB"
FT                   /locus_tag="IL0222"
FT   CDS_pept        complement(242233..243192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="IL0222"
FT                   /product="Threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81065"
FT                   /db_xref="GOA:Q5QZ96"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ96"
FT                   /protein_id="AAV81065.1"
FT                   /translation="MPKLSLPCHADVVQAQQRINSYTVKTPVLTNPALNQQLGCELFFK
FT                   CENLQRTGAFKFRGATNALLKLSPEQRQQGVITVSSGNHGAALAHAGKALGVKVKVGVP
FT                   INAPAIKRQNIEAGGAETTDIEPGMAAREAIVAKWQKEGKSHFIPPYDHADIIAGQGTA
FT                   TLELLEQTDALDAVITPLGGGGLLSGACLACDGTEIQVFGAEPELANDAFLSLKAGERQ
FT                   PALPAKSLCDGLLTQIGELPFAIIQQRICGILVLKDEDTLSAMKLIWHHLKIIVEPSSA
FT                   IALAAVIQNKSLFEGKRVGLVLSGGNVAAQPEDIKLRQ"
FT   gene            243255..243863
FT                   /locus_tag="IL0223"
FT   CDS_pept        243255..243863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0223"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81066"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZ95"
FT                   /protein_id="AAV81066.1"
FT                   /translation="MSQLDTFQRIRELPREQQIVIALYLCERMVPNYDFFHQLTGFGDS
FT                   KPLHGTLNACWDWVANPKKTKINFARWQEKVDEQTPSEYGHDMLGVYPAMDACTALSTL
FT                   LQGLLDDNGSNFLDVAKISQASVAKFIELNDAEEVGTEQLKEHVQNHELMEYEVAIQQA
FT                   MINFLEQQPAVNRALVSQLKMMLNDEGVSNLGLALDAEE"
FT   gene            complement(243811..244113)
FT                   /locus_tag="IL0224"
FT   CDS_pept        complement(243811..244113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0224"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81067"
FT                   /db_xref="GOA:Q5QZA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA1"
FT                   /protein_id="AAV81067.1"
FT                   /translation="MKVIIIAGKVVFAVIWLGLFALLAGANGELSTQSIGLLSLLLAIM
FT                   VITHLLLLGIFVATMKEAFPWRKGDSWQILAFGIFAWLSILQRPKPDQGSTPPRR"
FT   gene            complement(244110..244691)
FT                   /locus_tag="IL0225"
FT   CDS_pept        complement(244110..244691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0225"
FT                   /product="N6-adenine-specific methylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81068"
FT                   /db_xref="GOA:Q5QZA6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA6"
FT                   /protein_id="AAV81068.1"
FT                   /translation="MRQKRQTSASGDYRIIGGKWRGRRLPVADSPGLRPTTDRVRETLF
FT                   NWLQWDITDARVLDLFAGSGSLGFEAASRGAAQVTLIEAVKTVSLQLQNNVTLLSSENI
FT                   DVITHNALDWLQTESAEAYDMVFIDPPFREGLADKTLKLLDESNWLAADNQVYLETEKE
FT                   WPLKLPANWRVFKEKTHGQVCFRLLTKDIA"
FT   gene            244795..246144
FT                   /gene="ftsY"
FT                   /locus_tag="IL0226"
FT   CDS_pept        244795..246144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="IL0226"
FT                   /product="Signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81069"
FT                   /db_xref="GOA:Q5QZA5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA5"
FT                   /protein_id="AAV81069.1"
FT                   /translation="MSMFSLFKKKRNKKAPEAEEKKEDAVVEEQEQQEPEPEAEPESKP
FT                   QDEPKPERTETREELPSAVDDCAQVTAESHAAKTAPEAKEAAQPEVVNEPEPTAEPEPE
FT                   SETKSEAKPEHKPEHKPEPTEVAPKEKGEKKGFWARLTQGLRRTSGSIGSGLIGVFRGK
FT                   KIDDDLFEELETQLLMADLGVATTTKIIDNLTKQADRKQLKDAEALYELLQEQLAEILK
FT                   PVDKRLEIPESDSPYVILMTGVNGVGKTTTIGKLAKQFKAEGKSVMLAAGDTFRAAAVE
FT                   QLQVWGERNDIPVIAQHTGADSASVLYDALQAAKARDVDVLIADTAGRLQNKANLMEEL
FT                   KKLVRVMKKLDPEAPHEVMLTLDAGTGQNAISQAKLFTEAVGVSGIVMTKLDGTAKGGV
FT                   IFAVADQFAIPIRYIGVGESLEDLRPFVAKDFIAALFDRNVDESEQTTAS"
FT   gene            246147..246824
FT                   /gene="ftsE"
FT                   /locus_tag="IL0227"
FT   CDS_pept        246147..246824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="IL0227"
FT                   /product="FtsE"
FT                   /function="ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:IL0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81070"
FT                   /db_xref="GOA:Q5QZA4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA4"
FT                   /protein_id="AAV81070.1"
FT                   /translation="MIRFEQVSKTYRGGHQALSHVDFHVEPGEMAFLTGHSGAGKSTLL
FT                   KLISLMERPTAGRVLINGHDLRKIKPSQVPYVRRDIGMIFQDHRLLMDKTVFDNVALPL
FT                   IIEGYSVQEARKRVVAALEKVGIADKVKHYPKMLSGGEQQRVGIARAIVTKPPLLLADE
FT                   PTGNLDPKLSMEIIRLFEEFNKVGVAVLIATHDLGLIARLRYRTLTLKDGRMINDGLED
FT                   SEL"
FT   gene            246821..247810
FT                   /gene="ftsX"
FT                   /locus_tag="IL0228"
FT   CDS_pept        246821..247810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="IL0228"
FT                   /product="Cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:IL0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81071"
FT                   /db_xref="GOA:Q5QZA3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA3"
FT                   /protein_id="AAV81071.1"
FT                   /translation="MSLLFRNRSIEKGASNRGRLPWWRRLVMVPVHHAQQAIASLGELW
FT                   RNPFASLMTMAVLGLSLTLPSSLYVLVKNTTSIADNWQEASEVTLFLRKDLQQSEVDTL
FT                   KTQTELSEGVESVRLIPKEQGLEEFKKESGFGETLDYLSSNPLPDVLVVIPAESHRSPQ
FT                   RAEELLNRLEKQREVAYAKMDLEWLNRLQGILNLIEDILGALAVVLCLSVVLIVGNTIR
FT                   LNILSKRDEIMVMKLVGATNAFIQRPFLYTGVWYGIIGGLVAWLATALLIWWVESAVVD
FT                   LTELYETPFQLNGLTLGELLIIWLVAVGLGLAGSYLAVRRHIQSIEPE"
FT   gene            247956..248816
FT                   /gene="rpoH"
FT                   /locus_tag="IL0229"
FT   CDS_pept        247956..248816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="IL0229"
FT                   /product="DNA-directed RNA polymerase sigma 32 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81072"
FT                   /db_xref="GOA:Q5QZA2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA2"
FT                   /protein_id="AAV81072.1"
FT                   /translation="MSTELNTMALSVPQGAGLDGYIQSVNRIPMLTAEKEKALATRLYE
FT                   NSDLDAAKELIMSHLRFVVHVARSYSGYGLPQADLIQEGNIGLMKAVKRFDPSVGVRLV
FT                   SFAVHWIKAEIHEYVLRNWRVVKVATTKAQRKLFFNLRKMKKRLGWFSQKEVETVANEL
FT                   GVSTKEVLEMETRMSAHDQAFELSSDDDDSKEGSAYSPAMYLEDKRSDLAAEIEAKDYE
FT                   NHTQQKLLGAMSHLDERSQDIVQSRWLSEDKTTLHDLAEKYEVSAERVRQLEQNAMKKL
FT                   RLAMS"
FT   gene            248817..249074
FT                   /locus_tag="IL0230"
FT   CDS_pept        248817..249074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0230"
FT                   /product="Fe-S-cluster domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81073"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZB2"
FT                   /protein_id="AAV81073.1"
FT                   /translation="MKCRIGCGACCIAPSISSPIPGMPNGKPAGVRCVQLDDDNLCRLF
FT                   GKPERPKVCGEFSADDYVCGETRDEALILLTSLEEDTHCG"
FT   gene            complement(249031..249786)
FT                   /locus_tag="IL0231"
FT   CDS_pept        complement(249031..249786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0231"
FT                   /product="Conserved protein"
FT                   /note="similar to polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81074"
FT                   /db_xref="GOA:Q5QZB1"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZB1"
FT                   /protein_id="AAV81074.1"
FT                   /translation="MLKLVLSLGLLVCLMTPAYASKIAIVIDDIGNNKNDLKAALLPGN
FT                   ISFAVLPYTPYARAFALRGHHQKKQILLHMPMEAVENNRPGPGVVTADMNNAQIKLQLV
FT                   DALDSIPYVTGVNNHMGSKLTQLHMPMQAVMETLASRKLFFIDSRTSEFSVAEQMAGEF
FT                   GVRTSHRHVFLDNQVDEPYLQQQFEQLLSIAKRQGQAIGIGHPYPETLSFLQKQLPQLQ
FT                   EQGIELVFVSELTTVANRNGYLLPVTSAK"
FT   gene            complement(249786..250931)
FT                   /locus_tag="IL0232"
FT   CDS_pept        complement(249786..250931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0232"
FT                   /product="Membrane-associated metallopeptidase, NlpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81075"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZB0"
FT                   /protein_id="AAV81075.1"
FT                   /translation="MPIRLFWAVALGLVVISPGLAQDYSEDDKASTQAEIAAVKEELAK
FT                   RLQAIEERSSALNSTERQLRDLEIKTSEIAGSLRQTETELKEITAEIADSEQRREELKQ
FT                   KQKQQMTQLEDQLVSAYMNGKHDFLKMLLNQQDPGQFERMLSYYQYMNAARVEEIEVIR
FT                   RTQEEIATLTEQLKQQQNQLASLQAEQQEQRAQLEQQQHRQEEKLAELQQLQRKDRSRV
FT                   NQLEQSREQLEQVLSAIETALAQQKDVRLVGLQAVKNQLRWPSDGDVKRLFGQRREGPL
FT                   EWKGVLIEGQNGQPVRSIANGRVVYADWLRGFGLVIVIDHGESYMSLYGHNQTLTKAVG
FT                   DKVRKDEEIALMGQSGSRNSAALYFEIRHQGRPQNPSNWIR"
FT   gene            complement(250935..252470)
FT                   /locus_tag="IL0233"
FT   CDS_pept        complement(250935..252470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0233"
FT                   /product="Phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81076"
FT                   /db_xref="GOA:Q5QZA9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZA9"
FT                   /protein_id="AAV81076.1"
FT                   /translation="MTPTIKPLVLLILDGWGYREDAPDNAIAKANTPVMDRLWEKYPHC
FT                   LVDGSGGAVGLPDGQMGNSEVGHVNLGAGRIVYQDFTRISKAISDRSFFSNTILCDALK
FT                   KAKAAKGAVHIMGLLSAGGVHSHEDHLVAMIEMAVEQGAEDVYLHAFLDGRDTPPKSAL
FT                   PSIERFEALFARLGKGRFATLSGRFFAMDRDKRWERIEQSYKAVYHGLSGVTSANATDA
FT                   VENAYERGETDEFVTPVVIGQPAPIANGDSVFFMNFRADRAREMTQAFVDKDFDGFDRG
FT                   SRADISEFVMLTQYADTLEAPSAFPPEPLNNVLGEWLAKHDKTQLRISETEKYAHVTFF
FT                   FSGGREQEFEGEKRVLIPSPKVKTYDLQPEMSSEQLTDELVAAIESQAFDVVICNYPNG
FT                   DMVGHTGNFDAAVKACEAVDHSVGRVVSALEAVGGECLITADHGNAEQMSDATTGQAHT
FT                   AHTNELVPFIYVGRPAKARNGRLSDVAPTILHLIGMEQPDEMTGTSLMTLEQD"
FT   gene            252636..253067
FT                   /locus_tag="IL0234"
FT   CDS_pept        252636..253067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0234"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81077"
FT                   /db_xref="GOA:Q5QZA8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZA8"
FT                   /protein_id="AAV81077.1"
FT                   /translation="MQEIMEFVKSNPMMSGIWVVLLVALIVTTIRSAMSPTKNLEPQEA
FT                   TVWVNRGDGVFVDIRSPDEFKKGHIHGSVSLPMEKIKQKELSSIEKFKEAPIVIVCATG
FT                   MTAKSAVSQLTAEGFTQVAVLQGGMNTWRSAKLPVSQKK"
FT   gene            253110..253613
FT                   /gene="secB"
FT                   /locus_tag="IL0235"
FT   CDS_pept        253110..253613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="IL0235"
FT                   /product="Preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:IL0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81078"
FT                   /db_xref="GOA:Q5QZA7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZA7"
FT                   /protein_id="AAV81078.1"
FT                   /translation="MAEEQQANGAAAENQQQQVQFAIQRIYAKDISFETPSSPAIFRKE
FT                   WKPDLKLDLNVKHEKIEDGVYEVVLTLTATNKVEDDVAFLCEVHQAGIFTIGEEVQDGQ
FT                   LAHMLGSFCPNILFPYARECVSNLVNRATFPQLNLAPVNFDAIFQRHMQQQAEQAQGQQ
FT                   TADA"
FT   gene            253626..254627
FT                   /gene="gpsA"
FT                   /locus_tag="IL0236"
FT   CDS_pept        253626..254627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="IL0236"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81079"
FT                   /db_xref="GOA:Q5QZB8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZB8"
FT                   /protein_id="AAV81079.1"
FT                   /translation="MQTPQVTVLGAGSYGTALAICFARKGIPTTLWGRDADKVAVMQTA
FT                   HENEEYLPACPFPESLKVTADLGEALKDVKNVVVVVPSHSFSSMLKQAKPLLAEHARVA
FT                   WATKGLEPDSGRLLYEVAEETLGDEHPLAVLSGPTFAIEMAKGLPTAISMSSTDQAFVE
FT                   ELSGLLHCDRSFRVYTNNDFIGVQLGGVVKNVIAIGAGMADGIGFGANARTALITRGLA
FT                   ELTRLGLKLGAKSETFTGMAGLGDLILTCTDNQSRNRRFGMALGQGKGVEEALKSIGQS
FT                   VEGYRNTREVVALAARNEVEMPICEQIYAVLYEGKEPQQAAIDLLSRERKTE"
FT   gene            complement(254646..255236)
FT                   /gene="ttk"
FT                   /locus_tag="IL0237"
FT   CDS_pept        complement(254646..255236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="IL0237"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81080"
FT                   /db_xref="GOA:Q5QZB7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZB7"
FT                   /protein_id="AAV81080.1"
FT                   /translation="MAEQKRNRREEILQALAAMLETSPGQRITTAKLAANLGVSEAALY
FT                   RHFPSKARMFEGLIEFVEDTLLTRINMIMDEEKNTLSRCHAILQLLLTFAERNPGITRV
FT                   MTGDALMGEHDRLRGRMEDLFNRIESSIKQILREKAMREQQRFIVDEAVLANLLLSYAD
FT                   GKISQFVRSNFKRLPTEHFSAQWQVMEQQLISA"
FT   gene            complement(255285..255740)
FT                   /gene="dut"
FT                   /locus_tag="IL0238"
FT   CDS_pept        complement(255285..255740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="IL0238"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81081"
FT                   /db_xref="GOA:Q5QZB6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZB6"
FT                   /protein_id="AAV81081.1"
FT                   /translation="MTQVEVKILDDRIGQSIPLPEYATQGSAGMDLRACLDQPLTIEPG
FT                   QTQLIGTGIAMYIGDPNYAATILPRSGLGHKHGLVLGNLVGLIDSDYQGELKVSCWNRS
FT                   NQAYTIEPGDRIAQLVILPVVQAQMSIVEEFHETDRGEGGFGHSGRS"
FT   gene            complement(255759..256979)
FT                   /gene="dfp"
FT                   /locus_tag="IL0239"
FT   CDS_pept        complement(255759..256979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="IL0239"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81082"
FT                   /db_xref="GOA:Q5QZB5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZB5"
FT                   /protein_id="AAV81082.1"
FT                   /translation="MAQLQNKHILLGITGGIAAYKAPDLVRRLREQGAEVRVVLTAGAK
FT                   AFVTPLSLQAVSGFTVSDDLLDPTAEAAMSHIELARWADLILIAPATANTIARIAHGFA
FT                   DDLLSTLVLASKAPLAIAPAMNQQMWAATAVQENIETLLSRGVQMIGPESGEQACGDVG
FT                   YGRMSDPTEIVQALIKKAPEAKQDWQGKTFIITAGPTREAIDPVRYISNHSSGKMGYAL
FT                   AEAAAHAGAKVILVSGPTQLPTPTGVQRVDVETTEQMLNAVQQQLPNCDVFIGCAAVSD
FT                   YRVAEVASQKIKKEQNNQPPQLKLVQNPDILQQVASSEKPPFTVGFAAETENLKANALR
FT                   KLERKQLQMIVANDVSQVGLGFNSDSNNAIILSKDSEQSLPTMSKHDMAIAIIDAIAKR
FT                   YFNTTAN"
FT   gene            257090..257764
FT                   /gene="radC"
FT                   /locus_tag="IL0240"
FT   CDS_pept        257090..257764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="IL0240"
FT                   /product="RadC"
FT                   /note="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81083"
FT                   /db_xref="GOA:Q5QZB4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZB4"
FT                   /protein_id="AAV81083.1"
FT                   /translation="MSVKEWPVSERPREKLQTQGAEYLSDAELLAILLGSGSGGQDVVS
FT                   FARRLLSDFGGVGALLTATPEQLLACNGIGPARVNQLRVVLELSRRYLKWQLERSDGFT
FT                   EPTMVKDYLTSQLRHQGREVFAILLLDSQHRLLRYEELFQGTINAAPVYPREVIKLVMQ
FT                   YNAAAVILAHNHPSGVAEPSQADQRVTERVKKALTLIDVALLDHFVVGAGDPISFAERG
FT                   LL"
FT   gene            257947..258183
FT                   /gene="rpmB"
FT                   /locus_tag="IL0241"
FT   CDS_pept        257947..258183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="IL0241"
FT                   /product="Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:IL0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81084"
FT                   /db_xref="GOA:Q5QZB3"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZB3"
FT                   /protein_id="AAV81084.1"
FT                   /translation="MSQVCQVTGKRPVVGNNRSHARNATRRRFLPNLQSHRFWVESEKR
FT                   WVKLRISTKGMRIIDKNGIDTVLADLRGRGVKV"
FT   gene            258195..258350
FT                   /gene="rpmG"
FT                   /locus_tag="IL0242"
FT   CDS_pept        258195..258350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="IL0242"
FT                   /product="Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:IL0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81085"
FT                   /db_xref="GOA:Q5QZC4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZC4"
FT                   /protein_id="AAV81085.1"
FT                   /translation="MRDKIRLVSSAGTGYFYTTDKNKRTMPEKMEIKKFDPVVRKHVIF
FT                   KEAKIK"
FT   gene            complement(258414..259031)
FT                   /locus_tag="IL0243"
FT   CDS_pept        complement(258414..259031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0243"
FT                   /product="Prolyl 4-hydroxylase alpha subunit homolog,
FT                   2OG-Fe(II) oxygenase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81086"
FT                   /db_xref="GOA:Q5QZC3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZC3"
FT                   /protein_id="AAV81086.1"
FT                   /translation="MVLSDIIDKVADHGYCIIDDFLQPRRSQALYQYAQQLPAQYWNLA
FT                   GIGRQQNQTINTMVRNDRIYWLTSEEPRHKDYLSIMDELRHEFNRELFLGLFDYECHLA
FT                   HYPKGAFYKKHLDAFKGRSNRVLTTVFYLNPEWQETDGGQLVIYGDKGQVLETVLPKQG
FT                   RLVVFLSDRFVHEVQRSERDRFSITGWFRINASISGIIDPPR"
FT   gene            259150..259656
FT                   /locus_tag="IL0244"
FT   CDS_pept        259150..259656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0244"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81087"
FT                   /db_xref="GOA:Q5QZC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZC2"
FT                   /protein_id="AAV81087.1"
FT                   /translation="MKVNEKRKIFGLTMTRKAWNNVLVYVILIIMVVFWYVAPPVKEEA
FT                   DDSIVQEAESGEVIGLIPNDGNLRAMQIDQLKLALNDGQWQCQAPCRLSEKAAASVAEN
FT                   WLALTMTPTEQPAENLITEIYFGFVGGEEARVELYADPELMIRLPNQQQNYRVIEFTAS
FT                   QLLGH"
FT   gene            259672..260484
FT                   /gene="mutM"
FT                   /locus_tag="IL0245"
FT   CDS_pept        259672..260484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="IL0245"
FT                   /product="Formamidopyrimidine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81088"
FT                   /db_xref="GOA:Q5QZC1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZC1"
FT                   /protein_id="AAV81088.1"
FT                   /translation="MPELPEVEVSRLGISPHIEGRTIKSVKVHDKRLRWPVPETVHKVE
FT                   GHVLRSVSRRSKYLLLQTDNGCLILHLGMSGKLRVVPAETTHYKHDHIDIEFDNGQTLR
FT                   LNDPRRFGALLYSESDVSGHELLSQLGPEPLTDAFNIDYLFERSRGRSQSVKTFLMDNK
FT                   VVVGVGNIYANEALFKAGINPKRAAGKISKVRYQKLVPIIKETLASAIELGGTTLKDFT
FT                   QVDGNPGYFAQKLQVYGRGGKLCMVCSNRLKEVRLGQRSTVYCTQCQR"
FT   gene            complement(260500..261267)
FT                   /gene="bioH"
FT                   /locus_tag="IL0246"
FT   CDS_pept        complement(260500..261267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="IL0246"
FT                   /product="Alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81089"
FT                   /db_xref="GOA:Q5QZC0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZC0"
FT                   /protein_id="AAV81089.1"
FT                   /translation="MSISVTCCGTGTPIVVLHGWGMNSNIWQPVVPALSEHFQLYCVDL
FT                   PGFGDSVWSSENDVSLESFIEQIMPALPPRFHLLGWSLGGLIATQIALTHSDRVMSLTT
FT                   VASSPHFVESNDWAGIKPDILEQFQQQLDSNFKKTIERFLAIQAMGSEDAREQVKQVKQ
FT                   LIFTKPMPDQGVLKQSLTILQTADLRQQLPNIEVPFNRFYGRLDSLVPERAIDDISALA
FT                   PESKAVVFTKSAHAPFISEPERFISELLKVVEN"
FT   gene            261304..261993
FT                   /gene="comFC"
FT                   /locus_tag="IL0247"
FT   CDS_pept        261304..261993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="IL0247"
FT                   /product="Competence protein"
FT                   /note="Zn-ribbon domain fused to predicted
FT                   amidophosphoribosyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81090"
FT                   /db_xref="GOA:Q5QZB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZB9"
FT                   /protein_id="AAV81090.1"
FT                   /translation="MLAFLQRFANAFELGTCWSCGYSKVAAASLCPYCEEALPRWYPRC
FT                   CQHLSDIEQHLVAEQKPCRYWYGALRWEPQVQQLITQFKFRYKAELAPLLANQLAAHLR
FT                   LCYREEPLPDCVVAVPMTQQAWRKRGFHQTALLARHVSVALELPYIAGGLRKIRAVPMQ
FT                   HMASKALRWENSRGSQLALQDFSGCTVAVVDDVLSTGATMMAAADALYKKGARAVDAWA
FT                   VVYNQHD"
FT   gene            262065..262643
FT                   /locus_tag="IL0248"
FT   CDS_pept        262065..262643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0248"
FT                   /product="hypothetical protein"
FT                   /note="HesB-family domain (N-terminal) fused to thioredoxin
FT                   domain (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81091"
FT                   /db_xref="GOA:Q5QZC8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QZC8"
FT                   /protein_id="AAV81091.1"
FT                   /translation="MIRISEAAQSHFKKLLADQPDGTCIRVFVVNPGMANAECGVSYCP
FT                   PDSVEPDDERLPFNGFDAVVDSGSAPFLEDAAIDFEEQEMGSQLTLKAPNAKARKVADD
FT                   APLIERVEYVIQAEINPQLASHGGQVMISEITDDGVAILQFGGGCNGCSMIDVTLKNGI
FT                   EKELLERFPEEVKGVRDITDHEPGEHSYY"
FT   gene            262758..264143
FT                   /locus_tag="IL0249"
FT   CDS_pept        262758..264143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0249"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /note="contains internal repeats"
FT                   /db_xref="EnsemblGenomes-Gn:IL0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81092"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZC7"
FT                   /protein_id="AAV81092.1"
FT                   /translation="MQGIKKLGVIATSLFLITGCDWFDSDNDDTNTPPPEAESSFVRVH
FT                   HTSADSPNVNVLAGETALLENVPYHTSSGVLEVDAGDYDITVQGILPDESTVDAIGPAS
FT                   LTFAADTRYEVFAAGQLGDESLEPLVLSNPVSDVAAGESRIQVVHVAYGAPTVDVYLTT
FT                   PDAELSSASATLTLAYGEDSGQVDVETGDYRIRLTGAGDDAVIYDSGTVSLADGGDYII
FT                   AATNNVAANSANSPVTLQVSDGETTTLINDADAGADVRVVHAVADAPNVDVTLNDAADP
FT                   QIADLAFLSATDYLNLEAAEYSVDVAAAGGSPVVLEDLPLEVENAMSYSVYAVGELSTI
FT                   GLQVLTEERRSVATAAKIQLVHAAPSAGNVDIYVTETDDISGADAAFTDIAFDAEGLVS
FT                   TGNVSLTPGDYVVTVTATGTQDIAIQTPVLTLEGGGIYTAVAVDATSGGLPPQLILMDD
FT                   LAN"
FT   gene            complement(264115..265437)
FT                   /gene="dinF"
FT                   /locus_tag="IL0250"
FT   CDS_pept        complement(264115..265437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="IL0250"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:IL0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81093"
FT                   /db_xref="GOA:Q5QZC6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZC6"
FT                   /protein_id="AAV81093.1"
FT                   /translation="MHKLFGFSLSDHSRVFAIALPMIISNIAAPLLGLVDTAIIGHLPD
FT                   AIYLSAVAVGAMVVSFIYLLAVFLRMATTGYIAQSYGADDIRAQRQHFNNGIIIALGLG
FT                   VLIAVASPLINDLAMWVIAPSAELEGYARDYIEIRLWSAPASLITLVALGVLLGRQNSR
FT                   KAMLLVIITNAVNVVMDVILILGFGLNVKGAAWASLSAEWVTAIVGFYWTARALGWHLR
FT                   HWQLKFQQLRQFLGVNGNIFIRSLILQLCMATMTGYATRYGSTMVAVNAVLMQFLMLIS
FT                   LGLDGIAYSVEALAGEAKGQKRYDKIRYWCKITLLWSSLFAVVYTLVFALAGSAIIRLI
FT                   TDIPEIIRVAENYLPWIVVLPLIAHWSYWFDGVFIGLSFSRGMRNTMILSALIGFLPLW
FT                   WAGLPLENHGLWLALSGFLFMRGITQAIWLKYFSSPGHPSG"
FT   gene            265495..266580
FT                   /locus_tag="IL0251"
FT   CDS_pept        265495..266580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0251"
FT                   /product="Polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81094"
FT                   /db_xref="GOA:Q5QZC5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QZC5"
FT                   /protein_id="AAV81094.1"
FT                   /translation="MKMLNKMTLSAASGLLLGCSPLAQAGSADSVVVLQYHHVSDSTPA
FT                   VTSIDPETFREHLQYLQEHNFNVIDITDARDAIEKGEELPEKAVVITFDDGYQNVYENA
FT                   VKVLEEFEMPYTVFVNPELLRKHSGHYMGWEELKEIQQNGATIANHGQTHAHLIRKQEG
FT                   ESDEEWQERMRYDVITAQEAIDENLGEQQKYFAYPYGEYNNELRALLDEWGFLAFAQHS
FT                   GPWSKWSEDTVITRFPASGIYANLNTLKAKLNSKAMPVSAYQPEEPLVAHENKRPTISV
FT                   TLEAGDTLNDMRTDALQCFAGGSVLKPEWESDTQFRVTLEKDINIGRSRVNCTAPSASE
FT                   SRYYWYSVALIRPNESGSWPD"
FT   gene            complement(266577..267191)
FT                   /locus_tag="IL0252"
FT   CDS_pept        complement(266577..267191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0252"
FT                   /product="Uncharacterized secreted protein of
FT                   SCO1/SenC/PrrC family"
FT                   /note="involved in biogenesis of respiratory system"
FT                   /db_xref="EnsemblGenomes-Gn:IL0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81095"
FT                   /db_xref="GOA:Q5R0Y7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y7"
FT                   /protein_id="AAV81095.1"
FT                   /translation="MSRIVTLLAALIALAAGFAVYNFWPEEKPEALIYEPPRALKSFKL
FT                   NSTADGTIENDALKGQWTLLFTGYTFCPDICPTTMSDLKGVLPSLQEEVSKPVKVWMIS
FT                   VDPQRDDIERLTQYVNYFGDDFVGVRAEHKELFPFVRDLGLMYSIPDEGEENYLVNHSA
FT                   AIILVNPNGHRKAIFNADHQRGEIPVVDMEQLAKDFAIIAN"
FT   gene            complement(267204..268100)
FT                   /gene="cyoE"
FT                   /locus_tag="IL0253"
FT   CDS_pept        complement(267204..268100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="IL0253"
FT                   /product="Polyprenyltransferase"
FT                   /note="cytochrome oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:IL0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81096"
FT                   /db_xref="GOA:Q5R0Y6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0Y6"
FT                   /protein_id="AAV81096.1"
FT                   /translation="MQSVATNNITKTRNAHWRDYLELTKPRVVALLLLTAVVGMCLATE
FT                   ELVSLKVLVPALTGIGLMSAAAAAINHLVDRHIDAKMARTLRRPLPQGNLSPAKVTTFA
FT                   ASIGVIGFVTLYAWVNPLTAWLTFASMVGYAVVYTMFLKRATPQNIVIGGLAGAAPPLL
FT                   GWTSVTNEINAPAVLLVMIIFTWTPPHFWALAVHRAKDYARAKVPMLPVTHGIEFTKTC
FT                   IFLYTVLLTVVCLMPFLIGMTGMIYLVGVSVLNAIFLAYAWKLKYSPSKKTAFNMFAFS
FT                   IWHLMLLFVILLVDHYV"
FT   gene            complement(268114..269103)
FT                   /gene="ctaA"
FT                   /locus_tag="IL0254"
FT   CDS_pept        complement(268114..269103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="IL0254"
FT                   /product="Uncharacterized protein required for cytochrome
FT                   oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:IL0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81097"
FT                   /db_xref="GOA:Q5R0Y5"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y5"
FT                   /protein_id="AAV81097.1"
FT                   /translation="MRLLVKISVFFAFIVIVLGAFTRLTEAGLGCPDWPGCYGFLKVPS
FT                   QEEHIQQAELRFPDAPVEHAKAWNEMVHRYFAGTLGLLILTIAIISWVKSRRYSHYPTP
FT                   VKLPTLLLGLVIFQAALGMWTVTMNLQPLIVMGHLLGGFSVISLLYLLSLRLSSFRLAG
FT                   GDPELRRYRGLAFFTLLVVIGQIALGGWVAANYAAVACTELPFCEGNWTAQLDFAGAFS
FT                   IPEADTYQYGAHDYNDRMTMHVMHRVGAIITFLVICTLLFKCWRKAKSHFFRRSLIVIG
FT                   LLLSLQILLGISNVVFQLPLWNAVAHNAVGALFLLSLVALNYNLSRKA"
FT   gene            complement(269113..269658)
FT                   /locus_tag="IL0255"
FT   CDS_pept        complement(269113..269658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0255"
FT                   /product="Uncharacterized conserved secreted or membrane
FT                   protein"
FT                   /note="likely involved in cytochrome oxidase complex
FT                   assembly"
FT                   /db_xref="EnsemblGenomes-Gn:IL0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y4"
FT                   /protein_id="AAV81098.1"
FT                   /translation="MSSLNRSRRSMIIVFLAFIVPVLAAWLFLSQNWYEAGTNKGILLQ
FT                   PTITLEQQAEQLPEGWQVGYIAPQNCAITCENALYVMNQIDVAIGKDTDRLTPVVLHQS
FT                   ESLQAGFNHSAPHITQLVTPELIEQLSALPENTLFIIDPMHNVMLYYPTHEDKEQMITE
FT                   GKNVLADLRKLLKLSRIG"
FT   gene            complement(269655..270410)
FT                   /locus_tag="IL0256"
FT   CDS_pept        complement(269655..270410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0256"
FT                   /product="Cytochrome oxidase complex biogenesis factor,
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81099"
FT                   /db_xref="GOA:Q5R0Y3"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y3"
FT                   /protein_id="AAV81099.1"
FT                   /translation="MILKKTNIRFPLIATLVTLLAIAVLVKLGFWQLERAEEKRKLFSD
FT                   YEQQQSKGDATALSQLGTISSESDRFLFAKMEGEFVKQPVFFLDNKMTDGIVGYQVIAL
FT                   FRPDAKPNNYIPVNMGWVPAPASRQELPKINVPESRQNLTGYLYFPSNNKFVSNTYETE
FT                   LADDRIRVQEFQPNAISKELDIPLTDYTFLLKSPDTLGWQRNWKPQVMSPQKHQGYAVQ
FT                   WFSLAIACLVIFVFAVIKLNKQPKKEETR"
FT   gene            complement(270617..271492)
FT                   /gene="cyoC"
FT                   /locus_tag="IL0257"
FT   CDS_pept        complement(270617..271492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="IL0257"
FT                   /product="Cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:IL0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81100"
FT                   /db_xref="GOA:Q5R0Y2"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y2"
FT                   /protein_id="AAV81100.1"
FT                   /translation="MAEQQSYYVPASSPWPIVGAVGLGLIAWGAGHTVIDMSKEQDGYG
FT                   STVLTIGLVVIAVMLFGWFRDQINESMSGKYSNQLGDSYKQGMSWFIFSEVMFFAAFFG
FT                   ALFYARVIAVQWLGGDSNNAMTNEVLWPEFVAQWPLVKTPGGTETQAMGWYGLPAINTL
FT                   ILLASSVTCHFAHTGLEQNKRKQLTAMLGVTIILGCIFLYLQGAEYVHAYQDLNLTLDS
FT                   GVYGNTFYMLTGFHGMHVTLGTVMLIIMFLRVLKGHFTPDNHFAFQATSWYWHFVDVVW
FT                   LCLFVVVYIL"
FT   gene            complement(271505..272074)
FT                   /gene="coxG"
FT                   /locus_tag="IL0258"
FT   CDS_pept        complement(271505..272074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="IL0258"
FT                   /product="Cytochrome c oxidase assembly protein"
FT                   /note="CoxG"
FT                   /db_xref="EnsemblGenomes-Gn:IL0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81101"
FT                   /db_xref="GOA:Q5R0Y1"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y1"
FT                   /protein_id="AAV81101.1"
FT                   /translation="MSEQRPDNSILVKRLLLTVAGMFAFGFALVPLYDVFCEVTGFNGR
FT                   TSNEAAVYQQVEVDESRTVTVQFLTRNAKGIPWKFEPSIKQVKIHPGEVKVVNFLAGNP
FT                   TSSNMIAQAIPSVAPAEASLYLNKVECFCFNQQPLAAGAETEMPMQFYLDPDIPDHITT
FT                   FTLSYTLYDMTANTSAEAIAQLLKTE"
FT   gene            complement(272081..273667)
FT                   /gene="cyoB"
FT                   /locus_tag="IL0259"
FT   CDS_pept        complement(272081..273667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="IL0259"
FT                   /product="Cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:IL0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81102"
FT                   /db_xref="GOA:Q5R0Y0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0Y0"
FT                   /protein_id="AAV81102.1"
FT                   /translation="MSTVVEETHHDTHHDHKPSGIGRWLFTTNHKDIGSMYLWLSFTMF
FT                   LVGGAMAMVIRAELFQPGLQLVEPQFFNQMTTVHGLVMIFGAVMPAFTGLANWMIPMMI
FT                   GAPDMALPRMNNWSFWILPFAFMILLGSLFMEGGGPAFGWTAYAPLSTTYSSDSTALFV
FT                   FSVHIMGISSIMSAINVIVTIMNMRAPGMNYMKMPLFVWTWFITAFLLIAVMPVLAGAV
FT                   TMLLTDKYFGTSFFDAAGGGDPVMYQHIFWFFGHPEVYIMILPSFGIISAIIPAFARKR
FT                   LFGYSSMVYATAAIALLSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVKIFNWVA
FT                   TMWRGSMTFETPMLFALAFVILFTIGGFSGLMLAITPADFQYHDTYFVVAHFHYVLVTG
FT                   AIFSIMAAAYYWLPKWTGHMYDSTLAKTHFWTSLISVNVLFFPMHFAGLAGMPRRIPDY
FT                   ATQFADINQIASIGGFAFGLSQLIFLWVAIKCVKGGEKAAAKPWEGAEGLEWTVPSPAP
FT                   YHTFEKPPKVE"
FT   gene            complement(273678..274799)
FT                   /gene="cyoA"
FT                   /locus_tag="IL0260"
FT   CDS_pept        complement(273678..274799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="IL0260"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:IL0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81103"
FT                   /db_xref="GOA:Q5R0X9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0X9"
FT                   /protein_id="AAV81103.1"
FT                   /translation="MKPLWALLALTSLPAVAQSRLNMTQGVTEVSNQVYDLHMIIFYIC
FT                   CVIGAIVFGLMFISIIRHRKSKNPKPANFHENVKVEIAWTIVPLLILAGMAVPATTTLI
FT                   AMEDTADADVTVQITGSQWKWHYKYFENDVEYFSRLATQQEQINNQFEKGENYLLEVDR
FT                   PLVIPTDRKVRFLVTSDDVIHSWWVPDFAVKKDANPGFINETWTRVDEPGIYRGQCAEL
FT                   CGKDHGFMPVVVIAKEPAEYEKWITEKEEEQRKAREREQELLAMEMSEDELMDLGEKIY
FT                   NSTCSACHQANGQGVDGTFPALAGSGIAVDPEAKDKHIDTVVNGVTGTAMQAFGSQLSM
FT                   RELAAVITYERNAWGNDTGDLIQAADINEVMNQ"
FT   gene            complement(275105..275542)
FT                   /gene="sulA"
FT                   /locus_tag="IL0261"
FT   CDS_pept        complement(275105..275542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sulA"
FT                   /locus_tag="IL0261"
FT                   /product="SOS-response cell division inhibitor"
FT                   /note="blocks FtsZ ring formation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81104"
FT                   /db_xref="GOA:Q5QUP6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUP6"
FT                   /protein_id="AAV81104.1"
FT                   /translation="MKTQYQQKLHHPGLWTAEAPVSPFPVDAKRSQDSFDVDSLSPVVQ
FT                   RALQQKPSQWITVIGGDKNVIQQLIACGVAESQIRWLRSHSVERCEWALEQALLAGTSS
FT                   MVIGYLDSVSSRTWQRAKMASKLSETQYFLFDKNTLTSHLH"
FT   gene            complement(275539..276156)
FT                   /gene="lexA"
FT                   /locus_tag="IL0262"
FT   CDS_pept        complement(275539..276156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="IL0262"
FT                   /product="SOS-response transcriptional repressor"
FT                   /note="LexA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81105"
FT                   /db_xref="GOA:Q5QUP5"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUP5"
FT                   /protein_id="AAV81105.1"
FT                   /translation="MRPLTPRQSEILELIKDNLHATGMPPTRAEIAHKLGFRSANSAEE
FT                   HLKALARKGVIEILPGMSRGIRLVGDDYDIADGLPLIGQVAAGEPLLAEQHVEGHYKID
FT                   ESLFHPAASFLLKVNGMSMRDIGILDGDLLAVHKTEQARNGQIVVARVEDEVTVKRFEQ
FT                   RGKTILLHPENEDFSTITVNLAEQVFAIEGLAVGVIRNGATL"
FT   gene            276288..278810
FT                   /gene="plsB"
FT                   /locus_tag="IL0263"
FT   CDS_pept        276288..278810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="IL0263"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81106"
FT                   /db_xref="GOA:Q5QUP4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUP4"
FT                   /protein_id="AAV81106.1"
FT                   /translation="MKGISRFFPIFKYPLRWLTRFQEIWDGTEEEHSATVGKPIVYVMR
FT                   STSKADLSILQRAAHKRGLPDPVDPLVVNGKTYNRIMYLEELANEVSDQTVSEFHQLLT
FT                   LHKDQPELDVQLIPAGVFWGRQAGEEAHAGNTMTGDLDNPGHWRKFWLVIFSGRQVLLR
FT                   FSRSVSLGTMARDHGTDMRIAHKLARVARVHFVRMRHAVAGPKLSQRKELMSALINTPA
FT                   LKKAVSDEARGKKISEEAARKRALSYIDEIAANYNSTLIRVLDRFMTWMWNRIYNGIHV
FT                   KGGDTIRRLAQQGHEVIYVPCHRSHMDYLLLSYVIYKEGLVPPHIAAGVNLNFFPVGGI
FT                   FRRGGAFFIRRSFRGNKLYSAVFREYLCWLFQKGYPVEYFSEGGRSRTGRLLPPKTGML
FT                   AMTVQGMLRDQQRPVSLVPVYLGYEHIMEVATYLKELKGKDKEKESVFQILKTVAKLRN
FT                   FGQGFVTFGQPINLKHHLDKVAPNWHESVTRGAQEPERPGWLNPVVGGLAEQVMQGIND
FT                   SAAANSVNLTALALLSSEHHALMKEELLAQLEVYLGVLREVPYSNMMSVPEETPEELWQ
FT                   QALRTDKFTVDSDTMGEVVSLERMTAIAMTYYRNNILHLMVVPGIVASIIMAKKKVSVA
FT                   EIGARTQAIYPSLKAELYLSHNVEDLPLWTEALAEELARQKLITLEDGVCTIAQRESAQ
FT                   WYRLRLLANSASETLQRYCIVLELLQQAQPIMRADLEKQSITLAERLSSIHGIDAPEFY
FT                   DKKVMSTLIASLKQQGLVEINDDGQQIAAEPVGELSDQVDELIDGPVLQTIRQSVEQFV
FT                   QQLKEQAEHEQKEAPKEEQKPTESNQNQ"
FT   gene            complement(278798..279649)
FT                   /gene="ubiA"
FT                   /locus_tag="IL0264"
FT   CDS_pept        complement(278798..279649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="IL0264"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81107"
FT                   /db_xref="GOA:Q5QUP3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUP3"
FT                   /protein_id="AAV81107.1"
FT                   /translation="MQKLVAFWQLMRADRPIGTYLLAWPTIWALMIAGAGEPPLRIVVI
FT                   FLLGTFVMRSAGCVINDFADRNYDGHVRRTRQRPIPAGRISATEAMIGFIALLAIAFGL
FT                   VMQLNTETVMLSFFAAGVAALYPFCKRWTHLPQIVLGIAFSFGIPMAFTALESDQWFIA
FT                   GLLFLANILWTVAYDTEYAMADREDDLKIGLQSTAILFGRFDRLAIGLLQLATLALLGW
FT                   ILHLITVELWVWLALAAIFLLFAYQHWLIRHREPGKCFQAFLHNHYIGMVFAIGLAVHY
FT                   WF"
FT   gene            complement(279651..280232)
FT                   /gene="ubiC"
FT                   /locus_tag="IL0265"
FT   CDS_pept        complement(279651..280232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiC"
FT                   /locus_tag="IL0265"
FT                   /product="4-hydroxybenzoate synthetase"
FT                   /note="chorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81108"
FT                   /db_xref="GOA:Q5QUP2"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUP2"
FT                   /protein_id="AAV81108.1"
FT                   /translation="MTTEFYATPAFPVSKALQWTPPEQLELTPTQADWLLYEGSLTERL
FT                   KQIGQQFSVKLLGQQLLAPNTEEKQRLKGKDQAVIREVLLYCNEKPWVFARSLFSPSAE
FT                   NANTLNLQQLGNQSLGESLFARSDLYCGDIEVAKVALEHPVARLNQQWFGINQRLLSRR
FT                   RIFSTGGEQLLVSEVFLQPSPLYSSPNNRS"
FT   gene            280311..280709
FT                   /gene="fliL_1"
FT                   /locus_tag="IL0266"
FT   CDS_pept        280311..280709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL_1"
FT                   /locus_tag="IL0266"
FT                   /product="Flagellar basal body-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81109"
FT                   /db_xref="GOA:Q5QUP1"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUP1"
FT                   /protein_id="AAV81109.1"
FT                   /translation="MKLLITVFASIFLWFSSVTVASADDVSYYGFEPDITTNYLKEGND
FT                   YRLGFIRVAIEVMVPDPSYVSVVEHHAPLLRNAFVTILSTATERQVRTMTGRDQLRLKC
FT                   IERAKELMQQETGNPVIRDVLFTKYIYQ"
FT   gene            complement(280703..281527)
FT                   /gene="glpG"
FT                   /locus_tag="IL0267"
FT   CDS_pept        complement(280703..281527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="IL0267"
FT                   /product="Membrane serine peptidase"
FT                   /note="similar to rhomboid"
FT                   /db_xref="EnsemblGenomes-Gn:IL0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81110"
FT                   /db_xref="GOA:Q5QUP0"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUP0"
FT                   /protein_id="AAV81110.1"
FT                   /translation="MRRLLSSRDSDWMHKLYQYLRQQGMPVSVTERGEQLELWLHQSSY
FT                   EAAAKTLIQQFKDNPELAAEPVKEQRTSERGSSSLSFSLLQQSGWLTRIVAAMALLVFG
FT                   MVQMYPEAVLETLRISQYFSALPYDQPWRFITPVLMHFTLLHLVFNIFWWWYLGGRIER
FT                   SLGISWLLALLLFCGITANVIQYLFNGPNFGGLSGVVYGLLGFCWIYSFNRPTPLYLPP
FT                   GLIIFMLLWLVIGYTDMLWVNVANEAHLAGLLSGCFAGLVVRWLNPKMRQLH"
FT   gene            complement(281531..281836)
FT                   /gene="glpE"
FT                   /locus_tag="IL0268"
FT   CDS_pept        complement(281531..281836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="IL0268"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81111"
FT                   /db_xref="GOA:Q5QUN9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN9"
FT                   /protein_id="AAV81111.1"
FT                   /translation="MELPIAVEHWQNGDAIFVDIRDPQSFAAGHISGSQHLDNSNLPQF
FT                   LSSVDKNQKVIVVCYHGISSQGAADYIAGNGFTDVHSMDGGYTAWSMSFPEHTERN"
FT   gene            complement(281862..282887)
FT                   /gene="tdh"
FT                   /locus_tag="IL0269"
FT   CDS_pept        complement(281862..282887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="IL0269"
FT                   /product="Threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81112"
FT                   /db_xref="GOA:Q5QUN8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUN8"
FT                   /protein_id="AAV81112.1"
FT                   /translation="MKALSKLHAKPGIWMTDVEKPECGYNDLLIKIKKTAICGTDVHIY
FT                   KWDDWSQKTIPVPMVVGHEYVGEVAAMGDGVRGFEIGDRVSGEGHITCGHCRNCRAGRR
FT                   HLCRNTYGVGVNRPGAFAEYLALPAENAFKLPDDVTDEMAAVFDPFGNAVHTALAFDLV
FT                   GEDVLITGAGPIGIMAAAVARHVGARHVVITDVNEYRLDLARKMGVTRAVDVSKEKLSD
FT                   VMTELGMKEGFDVGLEMSGVPSAFSQMLETMNHGGKIAMLGIPPENIAIDWNQVIFKGL
FT                   VIKGIYGREMFETWYKMASLLQSGLDISPILTHEMPIDDFEKGFETMISGQSGKVILNW
FT                   D"
FT   gene            complement(282898..284088)
FT                   /gene="kbl"
FT                   /locus_tag="IL0270"
FT   CDS_pept        complement(282898..284088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="IL0270"
FT                   /product="2-amino-3-ketobutyrate CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81113"
FT                   /db_xref="GOA:Q5QUN7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN7"
FT                   /protein_id="AAV81113.1"
FT                   /translation="MSSAFYQQLADQLAETKAEGLYKKERIISSDQSSEITVNNRKVLN
FT                   FCANNYLGLANHPDLIKAAKQGLDEHGFGTASVRFICGTQDIHKTLEQKLSEFLGTEDT
FT                   ILYSSCFDANGGLFETLMGPEDAIISDELNHASIIDGIRLSKAKRFRYKNNNLEDLEAQ
FT                   LKQADADGARHKLIATDGVFSMDGVIANLKGICDLADKYDALVMMDDCHATGFLGENGK
FT                   GTHEYCDVIGRVDIITGTLGKALGGASGGYTSGKKEVIDWLRQRSRPYLFSNSVAPAIV
FT                   QASIRVLDMLAEGGKLRSQLWENASYFREQMTNAGFTLSGADHAIIPVMVGDAKLASEM
FT                   SDRLLEEDIYVIGFSFPVVPKGKARIRTQMSAAHTREQLDRTIEAFTRIGKELGVI"
FT   gene            284266..284766
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="IL0271"
FT   CDS_pept        284266..284766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="IL0271"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81114"
FT                   /db_xref="GOA:Q5QUN6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUN6"
FT                   /protein_id="AAV81114.1"
FT                   /translation="MHRRAIYPGTFDPITNGHADLIERAANLFSEIVVGIAESPSKKPL
FT                   FSLEERVLLAQQVTENLDNVTVVGFSGLLVNFAKEYEATVLIRGLRAVSDFEYEFQLAN
FT                   MNRRLAPNLESVFLTPAEENSFISSSLVKEVALHGGDVSGFTDARVASALEQKFSGKRP
FT                   GKS"
FT   gene            complement(284773..286092)
FT                   /locus_tag="IL0272"
FT   CDS_pept        complement(284773..286092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0272"
FT                   /product="Na+-dependent transporter of the SNF family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81115"
FT                   /db_xref="GOA:Q5QUN5"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN5"
FT                   /protein_id="AAV81115.1"
FT                   /translation="MRDSFHSRIGFILAAAGSAVGLGNIWGFPTQVANHGGGAFLLVYL
FT                   CVIFILAIPALYSEMLIGHSAQANPVRSLTQLSEGRARPIGRLMGYLNVLGSCLMLSFY
FT                   HVVAGWMLVHALGFLARGFGIEVAAEFLLNSSLTRDLIFTAVFLLATAYVVFQGVEKGI
FT                   ERWSKRLMPTLVVLLVALIAYMLTLPGADEGLKKYLVPDFSLMTDTSILVAAMGQAFFS
FT                   LSIGLGGMMIYGSYLKPGANLGRLSLSVAALDTFIAFLAGLLIIPALYAGIHLGVNVGE
FT                   GSKLIGEGQLIFAVLPELFNSMGIAGPFVAFAFFMLLSIAALTSTIAQAEVPVSYCIEE
FT                   RKLKRPVATALSLSVIAMFSLLLILFFEPLFGWVVTAVTQFQLPLSGLFYLLVVGWLWH
FT                   RSNHLKAIAAGSVGLTLLRWHIRYLCPVLMSIVFYHVAFG"
FT   gene            286300..287901
FT                   /gene="pckA"
FT                   /locus_tag="IL0273"
FT   CDS_pept        286300..287901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckA"
FT                   /locus_tag="IL0273"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81116"
FT                   /db_xref="GOA:Q5QUN4"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QUN4"
FT                   /protein_id="AAV81116.1"
FT                   /translation="MPNLDLSRYGITDVEEIVHNPSYDLLFEEETRDDLQGYEKGTVTD
FT                   LGAVAVDTGIFTGRSPKDKYIVRDDTTRDTVWWADQGKNDNKPLSTETWNELKGLVTEQ
FT                   LSHKRLFVVDTYCGANEDTRLAVRFITEVAWQAHFVKNMFIRPSEEELENFEPDFVVMN
FT                   GAKCINPKWQEQELNSENFVAFNLTEKIQLIGGTWYGGEMKKGMFSMMNYFLPLKGIAS
FT                   MHCSANVGQEGDVAVFFGLSGTGKTTLSTDPKRALIGDDEHGWDDDGVFNFEGGCYAKT
FT                   INLSKEAEPDIYNAIRRDALLENVAVDDNGVVDFDDNSKTENTRVSYPIYHIDNIVKPV
FT                   SKAGHAKKVIFLTADAFGVLPPVSKLTKEQAQYHFLSGFTAKLAGTERGVTEPTPTFSS
FT                   CFGAAFLSLHPTQYAEVLVKRMEAAGAEAYLVNTGWNGTGKRISIKATRAIIDAILDGS
FT                   IEDAEFVQLPHFNLAMPTELAGVEDSSILDPRKTYEDDGEWDVRAKDLAERFVANFEKF
FT                   TDTDNGKALVAAGPQL"
FT   gene            288001..288945
FT                   /gene="natA_1"
FT                   /locus_tag="IL0274"
FT   CDS_pept        288001..288945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA_1"
FT                   /locus_tag="IL0274"
FT                   /product="ABC-type Na+ efflux pump, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81117"
FT                   /db_xref="GOA:Q5QUN3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN3"
FT                   /protein_id="AAV81117.1"
FT                   /translation="MRLSVNNVTKRYRTVTAVDAISLDIQPGKIQALLGPNGAGKSSLV
FT                   RMLVGLTQPDEGEILVENSGESIELTYHDFAYLPEDRGLYQDRTILDNLNYIASLRGLK
FT                   LSDIRSDIDSWLERFELTDRKDEPLRQMSKGNQQKVQLIATLLHDPQLVILDEPFSGLD
FT                   PVNQEHVLTVLNELRERGKTVVLSAHQMELVERLADTMLLMNKGRAVAQGSLQEIRDTL
FT                   LPKPVYRVTTNAQLALDSWQGVEQIESMRKVNDEQVEITFDADAGIDQLWPQLAQQVPI
FT                   KAFAPIQPGLHDLYLNTIRRQASDEKSSEEAQS"
FT   gene            288942..290147
FT                   /gene="natB_1"
FT                   /locus_tag="IL0275"
FT   CDS_pept        288942..290147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB_1"
FT                   /locus_tag="IL0275"
FT                   /product="ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81118"
FT                   /db_xref="GOA:Q5QUN2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN2"
FT                   /protein_id="AAV81118.1"
FT                   /translation="MKQTSPGYFKQLKAISWWEFKRFFKWKQELLSIVILVAIFVVSTG
FT                   WGAIAQLLSDEYHGAIFYEEGKPQSWEFEAPKDLNLRSAGTMEVKKWKAQLPEELDTLI
FT                   VITPELTAKVWVKKSQTWQQELRSELQDQLQDLRIQQLPLAPEEKAVIDEKPDIAFSIE
FT                   ESEEASIDDATDSSASMLLVVIMVGVFTGFGLMMMSITAEKQQRVTEQLLTIVTPTQWM
FT                   DGKIIGITLHSLKSMLFIGLMILGVSLVVAALSDKSGSGLDWGIGTGLLSLIFVLLGTV
FT                   LINALLAGFSATIDDPNHSSRSTVMLVPMLPIFLSFSVVSAPDSTLATVMSILPISSFA
FT                   MMPARLLQTDVAVWEWLLSLVLLAAFVYWMRNVAGRLFAMGIQYYGKEPGWKEIWRAVS
FT                   GK"
FT   gene            complement(290217..292235)
FT                   /locus_tag="IL0276"
FT   CDS_pept        complement(290217..292235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0276"
FT                   /product="Acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81119"
FT                   /db_xref="GOA:Q5QUN1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN1"
FT                   /protein_id="AAV81119.1"
FT                   /translation="MLLRAVGGMALAVWAADIDAREMTLMETVTTKAIRSAQLSPDGQF
FT                   TAVIRSTPRTPYEDDDGSSYSELVLINAEGEETSYLSKDKKFGRVSFGPQSEYLYFTAK
FT                   EEGDEYQELYRMPVHGGGIQSVFEFDGNIGSYALSDDSEQLVFLSSGAKDSDEEKLEKK
FT                   GFKAEVYEEDLTYTQVYHVSLGEEDAEAKAVTADDQHALSVSFHPNNEQLLVRTAPTSL
FT                   IDDNYMSSQYQLISLDGEVVTSFESESKLGRAEFSPDGRYLAMIRAADYNDPSAGSLFV
FT                   YDTREQEHRNVLPDYKGAVKDFSWRTDEEIIWLGHRGTETEVQALTLKFLESRSLLELG
FT                   EAIFTSLDGEAGKSEFVLTGHRPSHPSEAFKYSNGRLERLTDSNPWLAEIDMPRQETMT
FT                   YKARDGLKLEGIVVYPTNYEEGKTYPTMMVIHGGPESHYSNGWLDRYASPVKHAAAKGY
FT                   ALLFPNYRGSTGRGVEFSKLGQNDYAGKEFDDIVDAKKHLVEIGLADESSVGITGGSYG
FT                   GYASAWGATAQTEHFAASVMFVGISDNLSKFGTTDIAKEMHAVHARSYPWDKWEWYLER
FT                   SPIYHAEKARTPILIMHGKEDTRVHPSQSMELYRYLKTHGKVPVRLVLYPGEGHGNRKV
FT                   AAQLDYSMRFMRWMDTFLVEKAEEKPSFELPHAEQLK"
FT   gene            complement(292275..292895)
FT                   /locus_tag="IL0277"
FT   CDS_pept        complement(292275..292895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0277"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81120"
FT                   /db_xref="GOA:Q5QUN0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUN0"
FT                   /protein_id="AAV81120.1"
FT                   /translation="MAGIRAKQKEKTRQALINAAMNQLSAENGFSSLSLREVAREAGIA
FT                   PTSFYRHFRDMDELGLTLVDECGLALRQLLRQARQRIESGGSIIRVSIETFMQFVANNT
FT                   ATFRLLLQERSGRSRSFRLAVVREIDHFKAELEDYLVNEQSFSRELAELQSDTIAKIVF
FT                   SAGADCFDVDEEEREIITEKTILQVRLVARGAEATRRLLKRES"
FT   gene            293049..294188
FT                   /locus_tag="IL0278"
FT   CDS_pept        293049..294188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0278"
FT                   /product="Fatty-acid desaturase"
FT                   /note="probably stearoyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81121"
FT                   /db_xref="GOA:Q5QUM9"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR009160"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM9"
FT                   /protein_id="AAV81121.1"
FT                   /translation="MQKISEKPPIIWLNTLVFSITFIVAIVGVPLYAYSVGIGAAFWWV
FT                   MLGTACFAGLSITAGYHRLWAHRTYDANPVIRFIFAIGGAVALQNSALHWSSDHREHHK
FT                   HVDDNDKDPYSAKRGFWYSHIGWMIREYQASRYTDYDNVKDLQKDPIVMWQHKYYLPLT
FT                   LFVNFGWPIAAGFMLGDVWAGLLVIGVLRLVLNHHTTFFINSLAHIWGKQPYTDKNTAR
FT                   DNGVLAFLTFGEGYHNYHHIFAADYRNGIRWWQFDPTKWLIVASKWLGLAKNLKRSSPY
FT                   QVERAKLQMQLKRAQLKAQAAPESLFERAQEHYDQMGQQLKAYYQARKKLLDTKAKALK
FT                   EHVHHDIDALKRQVDEMKASLEMQKRSWKALLNQIQQHA"
FT   gene            294303..294620
FT                   /locus_tag="IL0279"
FT   CDS_pept        294303..294620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0279"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM8"
FT                   /protein_id="AAV81122.1"
FT                   /translation="MEIGAAMNSGLQGMQRANQQVSQASQEIASASTSGRNDVQQQSNA
FT                   VANGAQAATETASETSQSVTAANTTDSLVSLNQGQTNFESNTRTVETADEMLGTMIDTS
FT                   A"
FT   gene            294690..295469
FT                   /locus_tag="IL0280"
FT   CDS_pept        294690..295469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0280"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81123"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM7"
FT                   /protein_id="AAV81123.1"
FT                   /translation="MNRDNLQRPLVNEPAKSDQSSNKADTQADRKPDAKADGKPDSKKA
FT                   TDKASKEVTDNAEKNQQKLSEEEVEKVDELKSRDQEVRVHEQAHAAVGGQHAGSPSYEY
FT                   ERGPDGKSYAVGGEVQIDVSPVNGDPQATIQKMQLVRRAALAPAQPSAADRSIAAEAAN
FT                   KATQARAELAQMQVEASESGEEGEKQNPDISINAPFNKSLEGENKGGSSSQSASSGAVT
FT                   PAEEGRKTLSSSERGEMISSFYDKRVRPSVDSFSATA"
FT   gene            complement(295480..297810)
FT                   /gene="tex"
FT                   /locus_tag="IL0281"
FT   CDS_pept        complement(295480..297810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="IL0281"
FT                   /product="Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81124"
FT                   /db_xref="GOA:Q5QUM6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM6"
FT                   /protein_id="AAV81124.1"
FT                   /translation="MSQIPQLLANELKVDERQISSVIQLLDEGSTVPFIARYRKEVTGG
FT                   LDDTQLRQLHQRLNYLRELDDRRQVILKSIDEQGKLTDELTQSIKTADSKTELEDLYLP
FT                   YKPKRRTKGQIAIEAGLEPLADLLWKDPTKNPEQAAAEYIDADKGFADAKAVLDGARAI
FT                   LMERFAEQAELLKRLRSHLWQNAHLTSTVAAGKEKEGAKFRDYFEFSELFKTIPSHRTL
FT                   ALLRGRNEGFLQLSMDADPGSEDTTSGSHCEVIIADFLNFEHKGRAADDWLRQVIQWTW
FT                   RVKLSLHMETELMARVRERAEEAAIQVFASNLKDLLMAAPAGAKTTMGLDPGVRTGVKV
FT                   AVVDETGKAVATNTVFPFQPQNQMDKAMRTLATLCKQYKVELISIGNGTHSRETDKMVG
FT                   DMLKQHSDIKATKVIVNEAGASVYSASELAAQEFPNMDVSLRGAVSIARRLQDPLAELV
FT                   KIEPKSIGVGQYQHDVSQSQLAQSLDAVVEDCVNAVGVDANMASAALLQRVSGLSKTLA
FT                   KNLVEHRDAHGAFRNRKQLLDVARMGPKAFEQAAGFLRISNGEQPLDASSVHPEAYTVV
FT                   ERIAKTNSIPVQELIGNQQLIKTLNAKDYTDERFGLPTVTDILSELEKPGRDPRPEFKM
FT                   AEFKEGVEKVSDLKPGMLLEGVVTNVANFGAFIDVGVHQDGLVHISALADKFVSDPREV
FT                   VKAGDIVKVKVLEVDIERKRIGLTMRLSDEAPANTAGSDKPKAKTGSGPKKKPSGNGGR
FT                   APQPQNSAMGSALADAFAKAKKD"
FT   gene            complement(297874..298353)
FT                   /gene="greB"
FT                   /locus_tag="IL0282"
FT   CDS_pept        complement(297874..298353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="IL0282"
FT                   /product="GreB"
FT                   /note="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:IL0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81125"
FT                   /db_xref="GOA:Q5QUM5"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM5"
FT                   /protein_id="AAV81125.1"
FT                   /translation="MKTNLITLGGYEKLQQELEHLWRVERRETVEKVSWAASLGDRSEN
FT                   ADYKYNKQKLRKIDGRIRYLTKRLEQVKVVYYSPQQDGKVFFGAWVEIEDEEENVRAFQ
FT                   IVGPDEIYDRKDAVSIDSPMARALLKKQVDDEAEVTTQQGTRTWFINKISYQQPA"
FT   gene            298535..298750
FT                   /locus_tag="IL0283"
FT   CDS_pept        298535..298750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0283"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81126"
FT                   /db_xref="InterPro:IPR012663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM4"
FT                   /protein_id="AAV81126.1"
FT                   /translation="MNEINPAKLRNSKWTAVEPLNREKHFLVSEVEYDEDGSVISCKIE
FT                   SVLSRNEYSIDWLELKSEEKWVQGWK"
FT   gene            complement(298909..300537)
FT                   /locus_tag="IL0284"
FT   CDS_pept        complement(298909..300537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0284"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81127"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM3"
FT                   /protein_id="AAV81127.1"
FT                   /translation="MQFLSRKIVLALVGIIIVSISIAALLPEKTKFLRFETDIGKEEQY
FT                   RLDMRTRILEINNRAWQIADTASLHSILDYRVDKMNPDINVRAVPQALTFSFNESVQFS
FT                   NSNPKRNLEKPVRELISSGFDQTMNRKTGKTTVSAKQESRNLQEASKQRVEQLQQVILS
FT                   PVVNWALPMVEGKSVTLNSFQGIPSLVLKVDSIDENSITVDITRETKAPADAVPMMGHN
FT                   PNLKVRWSEVNGRMRISRDDGWIENLVLITTQKTVTDTPAKEIDTTLVLRRKSELVIGS
FT                   TDDFLAPFEMATFLAENNGSYELSMSSTGESPDFDFVSDPVAHTETAFAINPKDNSLEL
FT                   KLEFVGPEGKVMGGLTSINSLTLMDNEGNKLNIPMMLRSIEPNYSGASEMNIYLVPLGW
FT                   EKTDLSKISSITAVMDYMPAVEPIPVTLPLAKDVTSIQQGNARASATPTDDGWIIATRA
FT                   SDRSYYILDQYADYPGLSGRWSDKAFHDLKPSVELQLSRVDAPEAWYQQFVIKGNSDKF
FT                   PLTYYLEPPEAEVRQVKLHFAKKPF"
FT   gene            300812..301066
FT                   /locus_tag="IL0285"
FT   CDS_pept        300812..301066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0285"
FT                   /product="Antitoxin of toxin-antitoxin stability system,
FT                   StbD family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81128"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUM2"
FT                   /protein_id="AAV81128.1"
FT                   /translation="MRIVSFTEARNGLKAVLDSVINDADTTVITRRDSEDAVVMSLDYY
FT                   NSLMETVHLLRSPANAEHLNKSIAQYKEGKAKKRELLDE"
FT   gene            301059..301322
FT                   /locus_tag="IL0286"
FT   CDS_pept        301059..301322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0286"
FT                   /product="RelE-like protein"
FT                   /note="probable translational repressor of toxin-antitoxin
FT                   stability system"
FT                   /db_xref="EnsemblGenomes-Gn:IL0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81129"
FT                   /db_xref="GOA:Q5R151"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R151"
FT                   /protein_id="AAV81129.1"
FT                   /translation="MSKRLLSWTDEAWKDYLYWQTQDKKTLKRINRLVADVKRSPFEGI
FT                   GKPEPLKENLAGFWSRRIDDTNRLVYAADDSAITIISCRYHY"
FT   gene            301518..302009
FT                   /locus_tag="IL0287"
FT   CDS_pept        301518..302009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0287"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81130"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R150"
FT                   /protein_id="AAV81130.1"
FT                   /translation="MQLENLAEWLEGLRKEDDLLVGELHVPFLQQKESIEVCFVGQKRA
FT                   VTESQQKTLLGYLEQLDTIHQQAVERIFTDYQTNVDIYRRAFQEWGEDPDEHAPLVNSA
FT                   EDLAPVMLYQSLFIPSWKDVGTFGMGFWAKWEVEHGVGIKFESWRLLEAGENSVHFCFE
FT                   "
FT   gene            302120..302674
FT                   /locus_tag="IL0288"
FT   CDS_pept        302120..302674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0288"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81131"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R149"
FT                   /protein_id="AAV81131.1"
FT                   /translation="MKKTIVMCFLIFSGLLQADEKVTNFEAVGNLESKHDVGCIKYIEA
FT                   KNIYTPADLFKSSAACANQNNVKDAARLFLLARIYGSYDIKRVSDSSAHQGIMVLVQNT
FT                   FADMGKNANSVEQEINENLIGKDKEFSEFCRVVKSIGKPSYHPQYMISHGMGAFTDSKG
FT                   NGLVENFNEDQAWLETLSHCG"
FT   gene            302730..303110
FT                   /locus_tag="IL0289"
FT   CDS_pept        302730..303110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0289"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81132"
FT                   /db_xref="GOA:Q5R148"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R148"
FT                   /protein_id="AAV81132.1"
FT                   /translation="MIELYFLVSVFVGIAVIVDGVVLYKAKGVCWTNKIQSFTTTIEFL
FT                   WVIVSIITFFTLELSHFQILIPSLYVVHNIFGWAYGSYLVSKSPEVKNGTKALVVPYWY
FT                   LIFGMTVGIVFSISSLCALILL"
FT   gene            303161..303715
FT                   /locus_tag="IL0290"
FT   CDS_pept        303161..303715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0290"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81133"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R147"
FT                   /protein_id="AAV81133.1"
FT                   /translation="MALQATPYKISLDISDTDRGVYESVKFTVARHPSETELRLASRVL
FT                   AYAMFYHPHLAFGRGLSDTDEAALWEIDLTGEIQHWIDVGLPDAARVIKASRRAPKMSV
FT                   VVYGNARLWREKVLPKFAHLNNVNVFVLPQNELAEIAEKLHRSTHWGVMISDGQLYISD
FT                   GDEQVIVALECWHGEMPEASL"
FT   gene            complement(303799..304623)
FT                   /locus_tag="IL0291"
FT   CDS_pept        complement(303799..304623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0291"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S0"
FT                   /protein_id="AAV81134.1"
FT                   /translation="MPTKLFGLILMSTVLIGCNDSDSETEVKETQVQSNESPTEQASAE
FT                   PETRTIKVSGKVIFEEGVSNVEVCADLKKTFRCNSKDPKTTTNPDGSYELSWESEAPHL
FT                   GYNLVASWPRKNPLPKITVTLAPYWETVTIGARDIYDGVINPLTTAELSVEHAMSMRDY
FT                   TDQEQQEGLDELREIYADIYDLPADEVYTKVAESGRYADTMAIQNRLSSHTIGIVTDPL
FT                   APAHVARKLKDEMLDKVDAENTSVQRYFIRNSKYIKKRVRETLIELGYLTKS"
FT   gene            304741..305853
FT                   /locus_tag="IL0292"
FT   CDS_pept        304741..305853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0292"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81135"
FT                   /db_xref="InterPro:IPR025335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0R9"
FT                   /protein_id="AAV81135.1"
FT                   /translation="MQNSNNVVGKQSSYDEPMNLPEERVKSFISHWYEQWLQAEAKSET
FT                   EKNNDQGFDFGYWRDLMSAVDKAHFVAGSGSGSDNSFGPADYDPNNEKIIECDIQGDLA
FT                   QLLTELHQDEGRPSNYHAYELKLDAEKDWKITRIHTLFHPPKSPVIAPEQHADILAMSS
FT                   SAAPLMNKQENLNLNEQTLFQKNRRVTIPHLDEGETKLEEVGKLQISSGILGILDFGYD
FT                   IYRFEPLQRRVTPGEYLVETVTTHDRVAGIRVKLSESEQAVKWYAANTPSGNGVYGVDA
FT                   GNLAIFDVANLVELSHFRKEKLFNEWSLEGKTELLSMTGQDDCVICTSGFGDGAYPAFW
FT                   GVNEQDEVVSLYIDFMILVQETENGSYESI"
FT   gene            305932..306831
FT                   /locus_tag="IL0293"
FT   CDS_pept        305932..306831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0293"
FT                   /product="Enzyme related to eukaryotic diacylglycerol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81136"
FT                   /db_xref="GOA:Q5R0R8"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0R8"
FT                   /protein_id="AAV81136.1"
FT                   /translation="MQHALLVVNPKSRNGHSEVLTEAIDLLRNSGIEVEVCVTESASHM
FT                   ASCIENYREQDGVVIVAGGDGTISSALESIYKSNQTLAILPMGTANDFARSLGLPQDVV
FT                   PAAQAIIDDERERINLAKVNGNYFVNVAHVGLGVEVTRELTSEMKKYFGVFAYLGAFTS
FT                   VIKRNKSFKVAIKADDWEDSVIAIHLAVGNGRFYGGGNIVDEDSTLLDGQLNLFCLKPI
FT                   RWWRLLLLGVNFRHGNLEKAERVVCKKARKISVKTSRPKRIQADGEFKTETPAEFEVIP
FT                   KAIEVIVGDMPVPNKNKE"
FT   gene            306833..307273
FT                   /locus_tag="IL0294"
FT   CDS_pept        306833..307273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0294"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81137"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0R7"
FT                   /protein_id="AAV81137.1"
FT                   /translation="MSILRTDNQADSMEILKLVIETKDYYREIAKVVEDDSLANELDSI
FT                   ASKRASFIEPFENIVKDFGELPAKPDPDKELMQIIEGELTQFFSADSKTAILDKCLQED
FT                   EELASVVNSTKLGEKSAESQKLLDALAENLSDTKKSIQALKN"
FT   gene            307418..308422
FT                   /locus_tag="IL0295"
FT   CDS_pept        307418..308422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0295"
FT                   /product="Regulator of cell autolysis (HATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81138"
FT                   /db_xref="GOA:Q5R0R6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0R6"
FT                   /protein_id="AAV81138.1"
FT                   /translation="MTFNKKEKLSITALLIILYLIPAGLEWLEFDSENLHVIAISLPIW
FT                   LAFFYLGPFWLFYWTQQNKHVARLHVVAQGVLYVLMMFAGANIVSRLHSMAFPQYQFPI
FT                   KEQGLSAFLWGVFIFSMTHMYLLYQRFVQEQRLRKEAQLADLTSRLNPHFLFNSLNTIS
FT                   ALIHSSPDKADDVLHKLSDILRYSVDQQNKWVPLEHELAVCETYLTVEKARFTDNLNIS
FT                   WQIASSVDMRQLKVPPLLLQPLIENVMKHVKRRPIELLISVQAEQGKLIFKVKDNGKGF
FT                   SEPSLNEQSKAGQGLNIVKQRVDIAGGELSLFNDTSEQGGAVCEITLPIHACV"
FT   gene            308386..309108
FT                   /locus_tag="IL0296"
FT   CDS_pept        308386..309108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0296"
FT                   /product="Response regulator of the LytR/AlgR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81139"
FT                   /db_xref="GOA:Q5R0R5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0R5"
FT                   /protein_id="AAV81139.1"
FT                   /translation="MRNHLTHSRLRVIIVEDEAPARSKLNTQLAQMEGVEIVAECADAP
FT                   QAIHDINSLKPDLVLLDIELGELSGFDVLEAMKHPCHVIFTTAYSQYAVKAFEKQALDY
FT                   LLKPFDLSRLRHALERVVLAQPQAAEPATVQFTAKVGDKIRILQSSDIRFVRASQGLVV
FT                   AQCLEREHHLDDSLESLLNQLPSSFLRVHRNSIVNTQHIHQIEKWQNGALLLRFEGVND
FT                   TITTSRRGAAVLRKYLNL"
FT   gene            309121..310482
FT                   /locus_tag="IL0297"
FT   CDS_pept        309121..310482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0297"
FT                   /product="Secreted metal-dependent hydrolase,
FT                   amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81140"
FT                   /db_xref="GOA:Q5R0S5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S5"
FT                   /protein_id="AAV81140.1"
FT                   /translation="MKRLWLFAALFITTQALASDFVINNVLLPDFQTRELTPVNIEVAD
FT                   GKFKQIVDSSVLLSHSDVRDGKGQVIMPAFIDMHSHSMGNSSLDRSDYQYIGIRGTANA
FT                   MLYAGVHGWLDLYSDENDIFEYRDQQFPQERDEAYVFAAGPCFTVPTGHCDFGETRLIS
FT                   TPEEAVTELRDLSGSKPNVVKVVFDNAGSKPTLDKATLKAFLNEARRLNIKSVVHIGSW
FT                   SDIRTASELGADAVTHLPWHAMPDDIPELLVKQGTVIIPTVSVINELLYLHDSGSDEIA
FT                   ASVLSVPMTNALVEKDLLSDYPITAENKLYFDWIAGLKADGALENRNDAIKRLDAAGVN
FT                   ILVGSDGGNFAVFQGVGFHREMYFLQQMGMSPWDIVLGSTLKAYEFLGVDWGIEEGRPA
FT                   HFTLHDKHIFEDLSLSTEVEQIYLHGRKVSREPLQDYANPGFFQYMKLFFGFEV"
FT   gene            310576..311778
FT                   /locus_tag="IL0298"
FT   CDS_pept        310576..311778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0298"
FT                   /product="Signaling protein with membrane-bound sensor
FT                   domain and GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81141"
FT                   /db_xref="GOA:Q5R0S4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S4"
FT                   /protein_id="AAV81141.1"
FT                   /translation="MSQQQKQYDIHWLTGQFFDSSKESRYRDSIKARVRFESRLALPLV
FT                   SVVVAMFGITDYNLLGLTREFYWLLTMRIAVVSSCLVLAFAIGRWGGYSRNAWLHSLPL
FT                   WILATGIILIVPLRPESISTQITAVVVAIMAFYLLIPNLLTVAALASLYLTVGFLSAAA
FT                   VYAGIPSENVLRVSLLLIMANIVGYCALLRIEFLQRKQFALLQDERDQNRDLLKEIKHR
FT                   KSLEAQLRMVAERDALTGLDSRSHFMKRAEALLQRAQLEKTPFCLFMIDVDHFKRINDT
FT                   WGHTRGDLILTKIAEVCEQSLRPTDVIGRFGGEEFVVGLPHTSPSEAQTIAERLKENVE
FT                   ALPLTAELSELCLSVTIGIAAAHGEEDDLDVLITRADNMLYEGKREGRNRVVMFGEGMD
FT                   S"
FT   gene            311789..312445
FT                   /locus_tag="IL0299"
FT   CDS_pept        311789..312445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0299"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81142"
FT                   /db_xref="GOA:Q5R0S3"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S3"
FT                   /protein_id="AAV81142.1"
FT                   /translation="MISKLPKWIEYGAFVAGCINAIGLLGFEHQAVSHVSGTATLFGTS
FT                   MLSGSFDEVLHLAGVLFSFFVGAGLSGYLLHGTQLKLSRRYDIALAAESLLIFASFYLL
FT                   SEGSFYGHFTASLACGMQNALATTYSGAIVRTTHLTGIFTDLGIMFGSVMRGKAFDKRK
FT                   AVLFGLIIAGFVTGGTSGAYLFMLLQFQALLVPAVICLALAILYRVHYRRSGQHK"
FT   gene            312523..313572
FT                   /gene="lplA"
FT                   /locus_tag="IL0300"
FT   CDS_pept        312523..313572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="IL0300"
FT                   /product="Lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:IL0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81143"
FT                   /db_xref="GOA:Q5R0S2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S2"
FT                   /protein_id="AAV81143.1"
FT                   /translation="MHGEYKVPGGKLVVADVNLEEGCLSEVSISGDFFLEPDSALNLIN
FT                   EALTGLPETSSHKTLAAAIDEALDEDVMMFGFSAEAVATAVRRALGKASSWLDHQFTLI
FT                   PPVTLPAAEHAALDEVIADSVAKGLRGPTLRFWDWDDSVVVIGSFQSVKNEVDMAAAKE
FT                   ANVQVVRRATGGGAMFMEPGNCITYSLTVPTSLVDGMSIEKSYEFLDAWVLAALAEVGI
FT                   KAYYKPLNDIASAQGKIGGAAQKRFANGVVVHHATLAYDIDANKMLQVLRTGREKLSDK
FT                   GITSANKRVDPMRSQTGLTRTAIIDAFMNQFTQAYQTQVDDYLPQELSAARALVETKYL
FT                   TEEWLYKVT"
FT   gene            313799..314134
FT                   /locus_tag="IL0301"
FT   CDS_pept        313799..314134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0301"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81144"
FT                   /db_xref="GOA:Q5R0S1"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0S1"
FT                   /protein_id="AAV81144.1"
FT                   /translation="MKKEAMSDEDLINACKEMSKGLIDADLGGNVYKKRIAYSNKGKRG
FT                   GYRTIVGAVIGNKYFFLYVFAKNKKTNISSKEKVALKELARMFISFDEKRLCKLVNEGE
FT                   LIEVGDL"
FT   gene            314131..314433
FT                   /locus_tag="IL0302"
FT   CDS_pept        314131..314433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0302"
FT                   /product="Transcriptional regulator, Cro/CI/xre family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0302"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81145"
FT                   /db_xref="GOA:Q5QW69"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW69"
FT                   /protein_id="AAV81145.1"
FT                   /translation="MSDILKSVHKTAKGLKNSGVIDKTTMRKFDALCLTTVHEFSAEQV
FT                   RALRLKYKLSQPVFAQYLNVSDKLVKKWEQGDSKPRGAALKMLSIAEKKGLEVIA"
FT   gene            314454..315080
FT                   /locus_tag="IL0303"
FT   CDS_pept        314454..315080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0303"
FT                   /product="Transcriptional regulator, PaiB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:IL0303"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81146"
FT                   /db_xref="GOA:Q5QW68"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW68"
FT                   /protein_id="AAV81146.1"
FT                   /translation="MYVPKHFEEDDNAKLHQYIRDYGFGILIVADEDGIEANHLPFHLS
FT                   REEGESLGTLQCHVARNNSVWQRLKNGGRVLAVFQGPDGYVSPSWYPSKAESGRVVPTW
FT                   NYLAVHAAGKARIVEDATWLKQHLMKLTDQHESGMKEPWQVNDAPEDFTDRLVKAIVGI
FT                   EIEIETLTGKLKASQNLPERNRAGVKAGLEGSDQPQSCAMSKFVS"
FT   gene            315209..316099
FT                   /locus_tag="IL0304"
FT   CDS_pept        315209..316099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0304"
FT                   /product="Ser/Thr protein phosphatase family protein,
FT                   calcineurin-like superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0304"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81147"
FT                   /db_xref="GOA:Q5QW67"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW67"
FT                   /protein_id="AAV81147.1"
FT                   /translation="MSVTRVLSVISLLVCMTLTSVFANGAEASRSDDSLVLKFAVLGDA
FT                   EPKPKAEFPGVSAAVDDVNKLAEDGTMDFVVGVGDIAHKGTVIQYENVTPVLQRLSLPF
FT                   YPIMGNEEHGSTVERYLKYANLWNDGKISIEKPSYVLERDSVALVFASPDFGRDFGDEG
FT                   IAWMKEQIERLAPKPVLLVVHGAQTGVYPENADKGVTHEGFKDIVAQPNLAAVLSGDLH
FT                   MDMERVNHSKQIDGVHYLHMPALERTKIPDETRHTPMFRVFSIFDDGQVLVETYQVDVE
FT                   KPLARHEYRFELSGK"
FT   gene            316471..316881
FT                   /locus_tag="IL0305"
FT   CDS_pept        316471..316881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0305"
FT                   /product="MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81148"
FT                   /db_xref="GOA:Q5QW66"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW66"
FT                   /protein_id="AAV81148.1"
FT                   /translation="MSSPQVGVGVLIIRNGRVLLGKRKGAHGAGTWSAPGGHLEFGESI
FT                   EDCARREVLEETGLELTTVRNGPFTNNVFQADNKHYVTIFALAEPLNGEAKTLEPDKCE
FT                   GWDWFDWNTLPQPLFPPLKTLIREGYTLTDWL"
FT   gene            complement(317046..317777)
FT                   /gene="fadR_1"
FT                   /locus_tag="IL0306"
FT   CDS_pept        complement(317046..317777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadR_1"
FT                   /locus_tag="IL0306"
FT                   /product="Transcriptional regulator, FadR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81149"
FT                   /db_xref="GOA:Q5QW65"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW65"
FT                   /protein_id="AAV81149.1"
FT                   /translation="MKSATRSRPQSIHSWVAQELGSRIVGGVYLPGQYIPNENDIGAEL
FT                   GVSRTALREAFKLLTAKGLIESRPKLGTRVRPRKNWNMFDAEVLRWCFSSNPDTKFYMS
FT                   LYEMREIIEPNAASLAAMHRTDEQLAALTEAYQAMEEAQIGTDAVYKSDLEFHLALLEA
FT                   TNNEFMASLGVTIETALENSFRLSSAIAEEYVDSLPGHKAVFMAIKEQSPVVAREEMQT
FT                   LLVNARHALEHTLAELHKTPV"
FT   gene            317985..318407
FT                   /locus_tag="IL0307"
FT   CDS_pept        317985..318407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0307"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81150"
FT                   /db_xref="InterPro:IPR022061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW74"
FT                   /protein_id="AAV81150.1"
FT                   /translation="MSRILLSGMLLLACSFSVLANDLKPGLWEVTSSMEGEGIPKQLKR
FT                   EKNSQECLTAEEGDDMVATMRKRWNEIGCQDMDISRDGDNIKVAASCEAGGRTTQVDAL
FT                   ITVHSNEHYSSEVTTTNDSSVTTYREATWVSSECEQ"
FT   gene            318417..318881
FT                   /locus_tag="IL0308"
FT   CDS_pept        318417..318881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0308"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="implicated in RNA metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:IL0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81151"
FT                   /db_xref="GOA:Q5QW73"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW73"
FT                   /protein_id="AAV81151.1"
FT                   /translation="MTPAIDVAKENEISFKVHEYSHDPASESYGGEAAEKLGVPQEQVF
FT                   KTLVVSLDGKELAVGIIPVLSRLSLKLIAKALGAKKAAMATGSDVERTTGYVLGGVSPL
FT                   GQKKQLRTIIDTSATYNPTVFISAGRRGVDMELTPEDLKTLVRGEFVNIT"
FT   gene            318891..319223
FT                   /locus_tag="IL0309"
FT   CDS_pept        318891..319223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0309"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0309"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW72"
FT                   /protein_id="AAV81152.1"
FT                   /translation="MFKRLQRQSHQVGDTQILVSYDRLTSRFQISNGNTVVYSRSLLLL
FT                   PFIRSSIVISNSTYSLKVISFVLWRAKLEQGGKVVISELLRPRRAKSIASIAYGAVMSV
FT                   LRFFVG"
FT   gene            complement(319307..320599)
FT                   /locus_tag="IL0310"
FT   CDS_pept        complement(319307..320599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0310"
FT                   /product="Secreted metal-dependent hydrolase,
FT                   amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81153"
FT                   /db_xref="GOA:Q5QW71"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW71"
FT                   /protein_id="AAV81153.1"
FT                   /translation="MKIKIVAALFVAAIALIILSLPTPRQESAENSNSFILGPVKIFDG
FT                   ETISKAAYVEVLDGYIKDLHMEQPDSQLRKVDGQNRWLVPGLIDAHVHTWGDALEQSLE
FT                   RGVTTVIDMFGHPNFLRQHQPQRATTKFSRKADIFGAGLLITAPNGHGTQYGIEVSTLS
FT                   KPQEAEKLIKQRINAGSDFIKIVYTRNGSAYAHAPSISEQGLQAAIRAAHKQNYLAVVH
FT                   IADHDSALDAVEAGADGLVHSFFDQPVSDELLALLKINGVFVIPTMTVYEGMLRGSIND
FT                   EILLNNETLKISASAKSTLNRNFPNSGRFPEHFYTNLLINTKRMHNTGIPILAGSDAPN
FT                   PNTAHGWSLLVELLLFQEAGMPTEAILKSATSKPADAFSLADRGRIREGMKADFLLLQK
FT                   SPYKDLKTILEPLRVWKNGYLVSSKDSARNH"
FT   gene            complement(320613..321350)
FT                   /locus_tag="IL0311"
FT   CDS_pept        complement(320613..321350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0311"
FT                   /product="ABC-type multidrug transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0311"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81154"
FT                   /db_xref="GOA:Q5QW70"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW70"
FT                   /protein_id="AAV81154.1"
FT                   /translation="MLNSDIYLKESLYDLLSLWRTPAFFLPAMLFPLVFYVFFGIVFNF
FT                   SAAQGEYMLVSYACFGMMGPALFNYATAVASDRAQGWLTLKRISPMPLSAYVVAKFFSS
FT                   LVFAACIALMLFITAALFADVQLLLWQWATLFTVLLIGTLPFALIGLLMGLCLSDKAAP
FT                   AVVNLVYLPMAFLSGLWVPIQFLPDTVRYIAYGLPSYHYSQLAHAVIGTNQGHNLWLHG
FT                   LYLVAFCGVLIAVIYWRYQRLSR"
FT   gene            complement(321343..322068)
FT                   /locus_tag="IL0312"
FT   CDS_pept        complement(321343..322068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0312"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81155"
FT                   /db_xref="GOA:Q5QW81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW81"
FT                   /protein_id="AAV81155.1"
FT                   /translation="MSQINLKVQSLNKHYGEKAALTNVSLNAYAGEVIAVLGKNGAGKT
FT                   TLIHSILGMHDYEAQHLEVLGTQLNSQHRPLTIRQRVGVMMQLGTLNANLTVAEQLDLF
FT                   CSYYPSGATPEVLLREFDLTGIAKQRFGKLSGGQRQQVLFAISVAGNPDLLFLDEPTVG
FT                   MDVEARHLLWEQINKRRQHGCALVLTTHYIEEAERLADRVAVLRDGQIIAQGSVNEVIA
FT                   NHGSLESAYLHLIREPAHA"
FT   gene            322225..323307
FT                   /locus_tag="IL0313"
FT   CDS_pept        322225..323307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0313"
FT                   /product="Signaling protein with membrane-bound sensor
FT                   domain and an ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0313"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81156"
FT                   /db_xref="GOA:Q5QW80"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW80"
FT                   /protein_id="AAV81156.1"
FT                   /translation="MSDKQRVREQKHAWIYLFNLGFYILPMVLFPYQVWEIAVMVAALL
FT                   VFIGLYYCCYSVPRQQMLWPILGMYIIACAVTPLNPGSIALFSYAGFFVGFAYNWRVAL
FT                   AAVAGIILTLATFHFGPGTSWDLFLPYGIVIVGTVSIFGRVERLRQQHAEEQERDAEEI
FT                   ERLATSVERERIARDLHDILGHTLSSIILKSDLAKAQLSKQRYDEASEQLVELSEIARE
FT                   SLSQVRQSVSGYKHGGLQLELRRLEQRLTDGGFSTRITGTPPIIDERRETSLVLAITEL
FT                   VTNIIRHSNGQQCLIHFDETANTYCIKVVDNGRCHDVSVGNGLSGVELRIQELGGSMSI
FT                   STNKGCEVALFLPKLAEQQP"
FT   gene            323304..323900
FT                   /locus_tag="IL0314"
FT   CDS_pept        323304..323900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0314"
FT                   /product="Response regulator, LuxR family (CheY, HTH
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81157"
FT                   /db_xref="GOA:Q5QW79"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW79"
FT                   /protein_id="AAV81157.1"
FT                   /translation="MKILLAEDQTMVRTALASLLRLESDYHVDEAVDGVDAQKKLQESD
FT                   YDVLLSDIEMPNLSGLELVQWAQQQQPNLRSVIITTFNRSGYIKRAIDSGVRGFLLKDA
FT                   PINELIASLQRVCLGEQVISNELLLQALGQHDPLTEKERKALRLASQGLSTQAIAEQLF
FT                   IAPGTARNYLSEAINKLHASNRTEAARIAHQKGWL"
FT   gene            complement(323927..324925)
FT                   /locus_tag="IL0315"
FT   CDS_pept        complement(323927..324925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0315"
FT                   /product="Predicted NADP-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:IL0315"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81158"
FT                   /db_xref="GOA:Q5QW78"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW78"
FT                   /protein_id="AAV81158.1"
FT                   /translation="MTTYKAIKLVKRPEPGPVSANIFEVTEKELPKAGSGEILIKQRQM
FT                   SLDPAMFGWMSPDTESYIPPVELNTVMRSSGVGEVVESNHPEFEVGDRVMGMMGWQEYA
FT                   LSDGKGINKVQADVPDETVLSVFALPGLTATQGLLNVGKPKNGETIVVTGAAGSVGSIV
FT                   GQIAKAEGLKVIGVVGSDEKANWIVNELGFDGAINYKTDDLRDQLTKLTPDGVDLYFEN
FT                   TGGPIQNLVVERMNAHGRVVVCGMIADYDKEVPSPGPSWVPVIKKRLTIQGFTMPDHFD
FT                   QIPSLLQQLTPYVMSGKIKHRSHILEGLESAIEGLNMFFTGDNKGKLIVKL"
FT   gene            325085..325564
FT                   /locus_tag="IL0316"
FT   CDS_pept        325085..325564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0316"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW77"
FT                   /protein_id="AAV81159.1"
FT                   /translation="MKLIKFFISITSILSIVACSSSVVKVGPDGSHWRLQSFLDDGLQE
FT                   TVKVYNYCYKGKQSSFVPARDFEKGSHSVVAHVIKQFHSVDSKPLDAFATLDGRFESGK
FT                   TYVFQNAIEDNKAKVWIANAETGEAVTSKEMVKLTVPDVVDNKQYQNRRCSASTL"
FT   gene            325882..326136
FT                   /locus_tag="IL0317"
FT   CDS_pept        325882..326136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0317"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81160"
FT                   /db_xref="GOA:Q5QW76"
FT                   /db_xref="InterPro:IPR025557"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW76"
FT                   /protein_id="AAV81160.1"
FT                   /translation="MKDVLFFNNMLTPKIITFVYWILLLAAVVGGVSTMFMGYEGFTFG
FT                   NFLKGIFYALAGGVGARIWCELLIVLFKMNEALQDLRKK"
FT   gene            326293..328845
FT                   /locus_tag="IL0318"
FT   CDS_pept        326293..328845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0318"
FT                   /product="Signaling protein with a periplasmic amino
FT                   acid-binding domain, GGDEF and EAL domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81161"
FT                   /db_xref="GOA:Q5QW75"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW75"
FT                   /protein_id="AAV81161.1"
FT                   /translation="MRNLIAIALLLLASGSMAQDVTLKVGVYDNPPKIMFDEYGQLSGI
FT                   HGQLLMNIAQRHNWQLVPVECEWDQCLKLLREGRIDIFPDVVKNDERETWASFHNEPAL
FT                   LSWSQLYAPKEEKITNLLDLNNKRVAVLRDSVQEEYLKQLIENFDLNSELYPVQSLAEG
FT                   FDAVVAGKVNATSADQLFGDKQVTEYAIEMTPIMFLPNEVFFAVPKGSHADILSTLDRE
FT                   LKRLKADENSDYYEIIERWSSGQSHLTISVYVWWLMTALVLLFLTVVGFNLLLRRKVTE
FT                   KTQALAESKYRLNTILDSVEAYIFIKDKELKYQYANQQVLKLFQLKLGDFIGKTDADLF
FT                   DKSTADTLKVFDNKVIKSGKRAAQEEISFLPDKKKPLHFWSVKVPLYDANKKVIGLCGI
FT                   CTDISEYQSMKEEIQSLAYFDPLTGLANRRFMLERLKDEFYRYQNGGDDGVLAMLDIDQ
FT                   FKKVNDSVSHDAGDELLVLFGQRLESELLQTETAGRLGADEFMVLLKSKSGINLLDDKN
FT                   LRQRLQVLVERLSEPYQLGEKTESISVSMGVTLFSDAQNTGDLLQGADLALSQAKETNA
FT                   SKLQFFNTGIQREFNYRQKMITGLRQAITTESLEVYLQPQYQQLTDEASQRCLGFEALL
FT                   RWYDEELGWVSPAEFIPLAESQGLMPDLHRLVLNQVLAAIPKLQHAISDKGGRVAINVS
FT                   ASQFKYPGFVEDIEARLTAAGIPGELLELEVTESLLIDDIENTAANMERLKRLGVTFAL
FT                   DDFGTGYASLGYLKRLPLNSLKIDQSFVRDMKNGNSDEAIVRTVIALGKSLDLAIIAEG
FT                   VETEEHLHKLQEMGCFCFQGYYFARPEPSHFWMSDERV"
FT   gene            328849..329271
FT                   /locus_tag="IL0319"
FT   CDS_pept        328849..329271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0319"
FT                   /product="Membrane protein related to Kef-type K+ transport
FT                   system NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81162"
FT                   /db_xref="GOA:Q5QW87"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW87"
FT                   /protein_id="AAV81162.1"
FT                   /translation="MLISFICNSIIVGLAVIFHYEALNRIGWLITHMRMFSQIRLMFGV
FT                   MLAIIAHTVEVSIFALAYYFMHHEEGFGTLVGNFDGSFLDALYFSFTVFSTVGFGDIEP
FT                   SGALRFLTGVESLTGLVLITWTASFLYVEMQRYWHR"
FT   gene            329364..330089
FT                   /gene="ompR"
FT                   /locus_tag="IL0320"
FT   CDS_pept        329364..330089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="IL0320"
FT                   /product="Response regulator (CheY, wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81163"
FT                   /db_xref="GOA:Q5QW86"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW86"
FT                   /protein_id="AAV81163.1"
FT                   /translation="MMQETLKILVVDDDARLRSLLERYLTEQNFQVRVAQDSEQMDRLL
FT                   TRENFNLLVLDLMLPGEDGLSICKRLRSQGNNLPVIMLTAKGDEVDRIIGLELGADDYL
FT                   AKPFNPRELLARVRAVLRRRGTEAPGAPSQEDQEITFGEFRLNLGTREMFRGDTPMPLT
FT                   SGEFAVLKALVNNARQPLSRDKLMHLARGRDYSALERSIDVQVSRLRRMLEVDPTKPRY
FT                   IQTVWGLGYVFVPDGQLKS"
FT   gene            330089..331399
FT                   /gene="envZ"
FT                   /locus_tag="IL0321"
FT   CDS_pept        330089..331399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="IL0321"
FT                   /product="Signal transduction histidine kinase (contains
FT                   HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81164"
FT                   /db_xref="GOA:Q5QW85"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW85"
FT                   /protein_id="AAV81164.1"
FT                   /translation="MKLFPKSAFARTVALLALVLLINQLVSYVMVSNYVVRPSIEQINE
FT                   LVAKHIRTMFIPRQHLAETERELMTSYTEATGIEVFNDEAAEKQGLGNSTYYGYLSDDM
FT                   SDMLGGEAQVRVAQGNKFYLWVKPPRAPDFWIRVPLDSMQQGRFSPLVMYLVLIGLLSV
FT                   FGGMLFANWLNRPLKALEDSARRVGRGEFPEQLSEKGATEIVAVTRAFNQMSRGIRELE
FT                   NDRNLLMAGVSHDLRTPLTRIRLAAEMMPQGEDCLAQGIIEDIDDMNDIIDQFIDYVRL
FT                   DQQESSSRESLNELIEQTVANVPDNWQKQFELDLGKLPRVWLRPLSMKRVIINLLENAE
FT                   RYGKHQVVVSSGHDKKQKRVWFRVTDDGPGIPEEQQATLFEPFTQGDKARGGVGSGLGL
FT                   AIIKRIVDRHDGSIKLQNRPEGGLCVRIELPLNQQRQ"
FT   gene            complement(331406..332824)
FT                   /gene="udhA"
FT                   /locus_tag="IL0322"
FT   CDS_pept        complement(331406..332824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udhA"
FT                   /locus_tag="IL0322"
FT                   /product="Pyridine nucleotide-disulfide oxidoreductase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:IL0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81165"
FT                   /db_xref="GOA:Q5QW84"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW84"
FT                   /protein_id="AAV81165.1"
FT                   /translation="MTAIKPETETEFDVVVIGTGPGGEGAAMQLAKSGYNVAIVEKHKA
FT                   LGGGCTHWGTIPSKALRHSVSRLIEYNNNPLFSGPGWQSGMTFSHILHYAESVIRKQVK
FT                   LRSSFYDRNDVTVVHGTASFLDKNRIRVTKLDGSVDDLITKHVVIATGSRPYNPKDVDF
FT                   SHPRIYDSDKVLSLSHEPKTILIYGAGVVGSEYASIFRGMGVKVDLINQRERLLSFLDA
FT                   EISDALSYHLRNSGVVIRHNEEYESITGHDDKVVLKTKSGKTMAADCLLFANGRSGNIE
FT                   QLDCQAVGLEPNYRGQLEVNENYQTSVDNIYAVGDIIGYPSLASAAYDQGRICASAIIN
FT                   GNCDKALISDIPTGIYTIPEISSVGKTEEELTEMKVPYEVGRAQFKHLARAQISGADVG
FT                   CLKLLFHRETRELLGLHCFGERASEIIHIGQAIMEQKNGGNTIDYFVNTTFNYPTMAEA
FT                   YRVAALNGINRLLL"
FT   gene            332934..333509
FT                   /locus_tag="IL0323"
FT   CDS_pept        332934..333509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0323"
FT                   /product="NTP pyrophosphohydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81166"
FT                   /db_xref="GOA:Q5QW83"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW83"
FT                   /protein_id="AAV81166.1"
FT                   /translation="MTWNRCMSKEKQVPQILARRVVAQSRLMRIEAVDLKFSNGEQRQF
FT                   ERMKGSGRGAVMIVPCLDEETLLLIREYAAGLHDYQLGFPKGLIDPGETPEEAAQRELK
FT                   EEVGYGSRQLEFLMEVSLAPQFFSAKMSVFVARDLYPESLPGDEPEPLEKVTWPLNDID
FT                   NLLAQPDFSEARSVAALLMLLRNLSEAQ"
FT   gene            333509..334333
FT                   /locus_tag="IL0324"
FT   CDS_pept        333509..334333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0324"
FT                   /product="3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81167"
FT                   /db_xref="GOA:Q5QW82"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW82"
FT                   /protein_id="AAV81167.1"
FT                   /translation="MAETMLEKLKEIAFEAGGVILSMYERRDYKTAEKKDDSPVTTADL
FT                   VASELIEDRLKQSFPDIPVISEESEHQDYNERRQWRAYFIIDPIDGTQEFISRSGDFAV
FT                   NIAYVENNEPVIGVIFWPVGETLYYARKGAGAFKQKENEKQSISVRKFSDPQADPIIIA
FT                   ISRQQAREPVFNRLQTKRDIQPLPTGSCSLKACFIAEGKADCFLRLGPTGEWDTAASQV
FT                   IVGEAGGRIVNENFEPITYNRTVSLLNPNFLVLGDQNVPWEEVFIARQARFR"
FT   gene            complement(334305..334541)
FT                   /locus_tag="IL0325"
FT   CDS_pept        complement(334305..334541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0325"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81168"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QW88"
FT                   /protein_id="AAV81168.1"
FT                   /translation="MIIPWQEIDQETLNNLMESIVLREGTDYGSQELSFETKVEQLKQR
FT                   LKSGEAVIVYSELHESVDVVNKDSVTGNEPDGQ"
FT   gene            complement(334538..336451)
FT                   /locus_tag="IL0326"
FT   CDS_pept        complement(334538..336451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0326"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81169"
FT                   /db_xref="GOA:Q5QW94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW94"
FT                   /protein_id="AAV81169.1"
FT                   /translation="MIRAEAITLLRGGDVLFEDSDLQVFPGHRVGLVGRNGCGKSSLFA
FT                   MLRGELSADSGNIHLPAEWRIASVAQDTPALDKSAIDYVMDGDAEFRQLEAQLAQAESD
FT                   NNGEAIAHCHDKLASIGAYDIQPRTASLMAGLGFTQEQLQQPVKAFSGGWRMRLNLAQV
FT                   LIARADLMLLDEPTNHLDVDAIFWLESWLKQYDGTLLLISHDRDFLDSVTTDITHIEHK
FT                   KLNSYRGNYSLFERQRAEHMAQQQSEYEKAQVMRQHLQAYVDRFRYKASKAKQAQSRLK
FT                   AIEKLPNQAPLRAESGIDFHFLTPEKLPNPLLTLRDAKAGYGDTTILEQIKLNLVPGTR
FT                   LGLLGRNGAGKSTLIKLLAGELEPMAGERLVNPGLSIGYFAQHQLETLDLAASALLHLQ
FT                   RIDKQATEQKLRDFLGNFGFSGDQATRSVEPMSGGEKARLALALIIYQRPNLLLLDEPT
FT                   NHLDLGLRDALVAALQEYEGALIVVSHDRHLLRTTVDEFCLVADGKAETFDGDLDAYHD
FT                   WLQQQAANDKRSEQPATRQRDDRKQQKRKEAEARQKTKPLRQQIEKAEKNIHSLELTLA
FT                   DIHEQLSDSTLYDDANKAKLQKLLDQQAQAQKDLQQQENLWMTAEEELAELTEELQQAE
FT                   DK"
FT   gene            336533..336736
FT                   /locus_tag="IL0327"
FT   CDS_pept        336533..336736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0327"
FT                   /product="Predicted nucleic-acid-binding protein containing
FT                   a Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81170"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW93"
FT                   /protein_id="AAV81170.1"
FT                   /translation="MAREKKRFIAGAVCPKCDAMDTLMLFIENDTEQVECVQCKHRFSE
FT                   PKEQGGGSQRQFDQVIGVFKPD"
FT   gene            336757..338277
FT                   /locus_tag="IL0328"
FT   CDS_pept        336757..338277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0328"
FT                   /product="C-terminal predicted sugar kinase fused to
FT                   N-terminal uncharaterized domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81171"
FT                   /db_xref="GOA:Q5QW92"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW92"
FT                   /protein_id="AAV81171.1"
FT                   /translation="MTDTDGSRFSNCLYRVEQVQQGEQKAAEACSMNMTQLMSAAGKAV
FT                   FHQLQSYFPAPARIAVCCGEGNNGGDGYIVARLAQKAGYQVQVFALKPNVELPEPMESD
FT                   AHKARAAWREQGGSEKPLLDCSPEQFDVLVDALFGVGLNRALEGDPVSWVQRVNGSTTP
FT                   VVSVDVPSGLNADTGHVPGAAVRAHLTVCLVALKRGLLTGKAQEHTGELKLEDLGIGST
FT                   FKQQNEANWFRVNAGRVGGWLAPRSRCTHKGEQGHVLIVGGQPGMSGAVILAMQSALRA
FT                   GAGKVSAACHPQVQAIVAAAQPEAMVHGIKETDSLEPLLREASAVALGPGLGQGSWSQE
FT                   IFSQVMETDVLKVIDADGLNLLASNPVRSPKLLLTPHPGEAARLLQMTTDEIASDRFAA
FT                   ATKLREKYGAQVLLKGAGSLLVTDRGRCLIDRGSPAMASGGMGDLLTGLIAGLLAQRMA
FT                   PAQALIAGSLWHAIAGEEAGKDGERGTLASDLLPHIRQLVNGYGRDDG"
FT   gene            338270..338728
FT                   /locus_tag="IL0329"
FT   CDS_pept        338270..338728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0329"
FT                   /product="Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81172"
FT                   /db_xref="GOA:Q5QW91"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW91"
FT                   /protein_id="AAV81172.1"
FT                   /translation="MAEVHQCELANEEETLALAKKFSQVLQAPLVVYLEGELGAGKTAF
FT                   CRGVIQAMGHSGAVKSPTYTLVEPYQLQGWRIHHFDLYRLADPEELEYMGIRDYFSEDT
FT                   LNFIEWPDKGYGWLPGADIEIRIEYAGTGRKLTFSALTEAGQKIIKTL"
FT   gene            338725..340035
FT                   /gene="amiB"
FT                   /locus_tag="IL0330"
FT   CDS_pept        338725..340035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="IL0330"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81173"
FT                   /db_xref="GOA:Q5QW90"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW90"
FT                   /protein_id="AAV81173.1"
FT                   /translation="MMKRFWVFLFACAPLWAWADNSVDSVRVWPSPDKTRVVFDLSDTP
FT                   DYSYFTLYQQKPYRLVIDFNNTSLKAGLENLGKESLLVDKIRTSSPKNANSTRIVIELD
FT                   SKSDANLFTLPANESYKDRLVVDLPGKSIERSGPAKSVSELKDRRVTVAIDAGHGGDDP
FT                   GSIGPRGTYEKHVVIRIATALAKLINDDPGMQAYLIRTGDYYVGLNERPQKAWDAKADF
FT                   FVSIHADAFRTPQPSGGSVWVLSKRRAESEVGRWLENREQQSELLGGVTDILRKNGHEP
FT                   YLAETLLDMSMDSSIAGAYSAAKHIIDEMSAVTEMHKHAPQAASLAVLKSPDKPSLLVE
FT                   TGFISNPREEQLLTSNAHQQKLARALYNGIRRYFVSNPIDNTYLANQSSFTYTVKSGDS
FT                   LSVLAQKYNTTVKAIKTENNLTTSSLKIGQKLTIPSR"
FT   gene            340035..341768
FT                   /gene="mutL"
FT                   /locus_tag="IL0331"
FT   CDS_pept        340035..341768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="IL0331"
FT                   /product="DNA mismatch repair enzyme, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81174"
FT                   /db_xref="GOA:Q5QW89"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QW89"
FT                   /protein_id="AAV81174.1"
FT                   /translation="MAIQQLPIELANQIAAGEVVERPSSVVKELVENALDAGATQLILD
FT                   IEQGGSKRIRIRDNGGGIVKQELTLALSRHATSKIQSLDDLEHIGSLGFRGEALASISS
FT                   VSRLRLISKPPEQEEAWQAWAEGRDMQVTVEPAAHPDGTTVDIQDLFFNTPARRKFLRT
FT                   EKTEFSHIDEVIKRIALSRFEVGFQLNHNGKSVRAFPSAQTEKQQLQRLAKICGGGFAE
FT                   QASAIDAVDGDFHLSGWLVPPEHCRHQGDIQHFFVNGRMMRDKLLSHAVRQAYEKYLPN
FT                   ERVPTFVLYFELPAEEVDVNVHPAKHEVRFHRQRQVHDFILTRIEQALNQLVAIENEQP
FT                   AMSHQHSYSSQERSSGATSDPYRGASGASFLGERKASGSLLPNAARVPHGNAGAQLSTE
FT                   PEAKLKAEQNWRVLSVFNDVYALIRNEYSLAWLNLAKVHTECVSKKLTQQLQDGLNGQP
FT                   LLVPVAVSLANLPGPASQWPQQQLNQCGVVYKIQREQAIIEQMPEMLRQGNVVSGFTDL
FT                   LTLLTEDAETDQLARWLAQFAGLESYSLTQAEHWLIQWRSQLAESADALQKLPLPGENN
FT                   A"
FT   gene            341761..342711
FT                   /gene="miaA"
FT                   /locus_tag="IL0332"
FT   CDS_pept        341761..342711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="IL0332"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81175"
FT                   /db_xref="GOA:Q5QWA0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA0"
FT                   /protein_id="AAV81175.1"
FT                   /translation="MHSKDAVIAIYGPTASGKTALSLALCEQLDCEIISVDSALIYRGM
FT                   DIGTAKPSAEEQNLVPHHLLDIRDPAETYSAADFQKDALALIDDIQQRGKVPLLVGGTM
FT                   LYFKALLEGLSHLPESDTSVREKLTAELHEKGLAELHSRLQKVDPTSAKRIHPNDPQRI
FT                   LRALEVYEIAGKPLTELTRERHGQLTKPIYQFAVAPVERKVLHQRIEQRFDHMLAQPFK
FT                   EEVATLFARPDLHPDLPSIRSVGYRQMWQHLAGELSYDEMRERGIIATRQLAKRQMTWL
FT                   RGWPGVHWLETGDLNMQAKVMTAMQQPAKIFNSKD"
FT   gene            342889..343146
FT                   /gene="hfq"
FT                   /locus_tag="IL0333"
FT   CDS_pept        342889..343146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="IL0333"
FT                   /product="Host factor I-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81176"
FT                   /db_xref="GOA:Q5QW99"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QW99"
FT                   /protein_id="AAV81176.1"
FT                   /translation="MAKGQTLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVVL
FT                   LKNTVSQMVYKHAISTVVPARIPQNYLPQQAGEDMAEIED"
FT   gene            343171..344457
FT                   /gene="hflX"
FT                   /locus_tag="IL0334"
FT   CDS_pept        343171..344457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="IL0334"
FT                   /product="GTPase, HflX"
FT                   /db_xref="EnsemblGenomes-Gn:IL0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81177"
FT                   /db_xref="GOA:Q5QW98"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW98"
FT                   /protein_id="AAV81177.1"
FT                   /translation="MFDRYEGGDYAILVHVDLPAEVDREDLSELQLLADSSGVKTMGVM
FT                   TTSRNSPTPRYFVGSGKAEEIAEQVKLLDANIVIFNHALSPTQERNLEAICKCRVLDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHISTRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLIRGRIKNILKRLEKVQKQREQGRRARKKADIPTVSLVGYTNAGKSTLFNRLTEAGV
FT                   YAADQLFATLDPTLRKLAVEDIGEVILADTVGFIRHLPHDLVAAFKATLQETQEADLLL
FT                   HVVDVSDEQQQNNIDQVAEVLEEIDAGDVPQLIICNKIDQVEGAEPRIDYDDNQKPIRV
FT                   WVSAQQGLGIEEVLEALRQILGPQMVELTLKIPHSMGKLRGTLYRWNSVTSEDVNENGE
FT                   LALQVRMSSVDWQRLHKAYGNQLDDLVVQ"
FT   gene            344504..345658
FT                   /gene="hflK"
FT                   /locus_tag="IL0335"
FT   CDS_pept        344504..345658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="IL0335"
FT                   /product="Membrane protease, stomatin/prohibitin family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81178"
FT                   /db_xref="GOA:Q5QW97"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW97"
FT                   /protein_id="AAV81178.1"
FT                   /translation="MAWNQPGNGNNNDRDPWKNQGGKDQGPPDLDEAVRKLFSKFGFGG
FT                   KKGGGSGGSSGIPAKGVGIIAIIAVIVWFIAGFYTVKEADRGVVLRFGQFHTLVESGLH
FT                   WRPVFIDSVEHVDVNNIRSDKTDGYMLTQDENVVRVELDVQYRVVDPRAYLFNVENADG
FT                   VLSRATDSALRFVVGHTTMDEVLTRGREEVRANTLDMLEKTMNPYTVGLQVVDINLLPA
FT                   RPPEAVKDAFDDAISAQEDEERFIREAEAYAREVEPLARGQVRRMLQEAQAYREQIILE
FT                   AQGEVARFEELLPQYQNAPEVTRQRIYLDTLQELYAKTPKVLVDVEGGNNMMYLPLEKL
FT                   LEKQGRNTNSFSPTRIPEDVSGGSSSTGTETQNTRSSNRSGGRN"
FT   gene            345658..346551
FT                   /gene="hflC"
FT                   /locus_tag="IL0336"
FT   CDS_pept        345658..346551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="IL0336"
FT                   /product="Membrane protease, stomatin/prohibitin family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81179"
FT                   /db_xref="GOA:Q5QW96"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QW96"
FT                   /protein_id="AAV81179.1"
FT                   /translation="MKNLIAIIVVVLVVLGLSSVYVVKEGERAILIQFGKVERNAETGE
FT                   AMVFEPGLHFKIPFIEQVKRLDARLQTLDGDPDRFVTSEKKDLIVDTYVMWRINDFSTF
FT                   YLSTNGGNYLQAEALLTRRINSGLRSEFGNRTISDIVSGERDELMREALIQGSESASDL
FT                   GVEVLDVRVMQINLPDEVSQSIYQRMRAERQAVATEHRSEGREQAEFIRADVDARVTVM
FT                   LADAKRQSRELRGEGDAQAAKIYADAYQKDAEFFAFIRSMEAYGESFGSGNDMLVLDAN
FT                   SDFFRYLQNMMGKTEE"
FT   gene            346654..347952
FT                   /gene="purA"
FT                   /locus_tag="IL0337"
FT   CDS_pept        346654..347952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="IL0337"
FT                   /product="Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81180"
FT                   /db_xref="GOA:Q5QW95"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QW95"
FT                   /protein_id="AAV81180.1"
FT                   /translation="MSQNVVILGTQWGDEGKGKIVDLLTDKATMVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGILRKNVQCVIGNGVVLSPEALMEEMAMLEARHVPVADRLRISKAC
FT                   PLILPFHVALDQARERARGKEAIGTTGRGIGPAYEDKVARRGLRVGDLFDMKRFGEKLK
FT                   ELVDYHNFSLVEYYKADAIDFDTVLKQCEEFAEVLKPMVIDVPALLDKARKNGESIMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGAGFGPRYIDYVLGIVKAYTTRVGSGPFPT
FT                   ELDCEVGQHLGEKGHEFGATTGRKRRTGWIDAVAMRRAVQINSISGFCLTKLDVLDGLE
FT                   ELKICIGYQLSDGSVTEHPPLSAEDYEVVEPIYETMPGWQQSTVGITEHKELPPEALAY
FT                   IARIEALTGVPVDIISTGPDRKETIVLRHPFGQ"
FT   gene            348104..348176
FT                   /locus_tag="tRNA_Thr_1"
FT   tRNA            348104..348176
FT                   /locus_tag="tRNA_Thr_1"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: TGT"
FT   gene            348199..348280
FT                   /locus_tag="tRNA_Tyr_1"
FT   tRNA            348199..348280
FT                   /locus_tag="tRNA_Tyr_1"
FT                   /product="tRNA-Tyr"
FT                   /note="anticodon: GTA"
FT   gene            348329..348400
FT                   /locus_tag="tRNA_Gly_1"
FT   tRNA            348329..348400
FT                   /locus_tag="tRNA_Gly_1"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: TCC"
FT   gene            348416..348488
FT                   /locus_tag="tRNA_Thr_2"
FT   tRNA            348416..348488
FT                   /locus_tag="tRNA_Thr_2"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon: GGT"
FT   gene            348574..349758
FT                   /gene="tufB_1"
FT                   /locus_tag="IL0338"
FT   CDS_pept        348574..349758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB_1"
FT                   /locus_tag="IL0338"
FT                   /product="Translation elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:IL0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81181"
FT                   /db_xref="GOA:Q5QWA3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA3"
FT                   /protein_id="AAV81181.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKVYGGAAK
FT                   DFAAIDNAPEEKERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPFIVVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGDEEWSKKIVELADALDNYIPEPERDIDKPFIMPIEDVFSIS
FT                   GRGTVVTGRVERGIVRTGDECEIVGMKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKRDDVERGQVLAKPGTITPHTKFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   AVELPEGVEMVMPGDNLKFVVDLIAPIAMDEGLRFAIREGGRTVGAGVVSKIMD"
FT   gene            349907..349980
FT                   /locus_tag="tRNA_Trp_1"
FT   tRNA            349907..349980
FT                   /locus_tag="tRNA_Trp_1"
FT                   /product="tRNA-Trp"
FT                   /note="anticodon: CCA"
FT   gene            350031..350411
FT                   /gene="secE"
FT                   /locus_tag="IL0339"
FT   CDS_pept        350031..350411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="IL0339"
FT                   /product="Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:IL0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81182"
FT                   /db_xref="GOA:Q5QWA2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWA2"
FT                   /protein_id="AAV81182.1"
FT                   /translation="MSANNETQSSSLNSLKWIITIALLVVAIGGNHYYTEEVSVLYRAI
FT                   AVVVLVALAGFFASTTTKGKTFLSFAKESRTEVRKVVWPSRQEATQTTLIVVVATVVVA
FT                   LILWGLDGILVRVVGFLTGLEI"
FT   gene            350414..350953
FT                   /gene="nusG"
FT                   /locus_tag="IL0340"
FT   CDS_pept        350414..350953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="IL0340"
FT                   /product="Transcription antiterminator NusG"
FT                   /db_xref="EnsemblGenomes-Gn:IL0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81183"
FT                   /db_xref="GOA:Q5QWA1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWA1"
FT                   /protein_id="AAV81183.1"
FT                   /translation="MSDKKRWYVVQAFSGYEARVSESLKEHIKMHGMEDKFGEILVPKE
FT                   EVVEMRGGVRRKSERKFFPGYVLVEMDMDEDAWHLIKSVPRVLGFIGGSSDRPTPISKK
FT                   EADAILDRLQDSADKPKPKTLFEPGEVVRVNDGPFADFNGTVEEVDYEKSRVTVSVSIF
FT                   GRATPVELEFGQIEKA"
FT   gene            351092..351520
FT                   /gene="rplK"
FT                   /locus_tag="IL0341"
FT   CDS_pept        351092..351520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="IL0341"
FT                   /product="Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:IL0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81184"
FT                   /db_xref="GOA:Q5QWA9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA9"
FT                   /protein_id="AAV81184.1"
FT                   /translation="MAKKVSAIIKLQVAAGSANPSPPVGPALGQHGVNIMEFCKAFNAQ
FT                   TDSLEKGAPVPVEITVFEDRSFTFITKTPPASFLLKKAAGIKSGSGEPNTKKVGTVTRA
FT                   QLEEIAKTKEPDLTAADMDAAVRTIAGSARAMGLNVEG"
FT   gene            351524..352219
FT                   /gene="rplA"
FT                   /locus_tag="IL0342"
FT   CDS_pept        351524..352219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="IL0342"
FT                   /product="Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:IL0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81185"
FT                   /db_xref="GOA:Q5QWA8"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA8"
FT                   /protein_id="AAV81185.1"
FT                   /translation="MAKLTKRARMIAEKVEARDYDVNEAITLLKELATAKFTESVDVAV
FT                   NLGIDARKSDQNVRGATVLPNGTGRDVRVAVFTSGDNAEKAKAAGADIVGMEDLAAQVK
FT                   KGEMNFDVVVASPDAMRVVGQLGQILGPRGLMPNPKTGTVTPDVATAVKNAKAGQVRYR
FT                   NDKNGIVHATIGRVDFDNDKLKENLEALLAALKKAKPSSAKGVFVKRISLSTTMGAGVS
FT                   IDQATVAAV"
FT   gene            352487..353005
FT                   /gene="rplJ"
FT                   /locus_tag="IL0343"
FT   CDS_pept        352487..353005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="IL0343"
FT                   /product="Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:IL0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81186"
FT                   /db_xref="GOA:Q5QWA7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA7"
FT                   /protein_id="AAV81186.1"
FT                   /translation="MAIGLAGKKAIVKEVNDVASNALAVTVAEYRGIEVADMTALRKKA
FT                   REQGIFVKVVRNTLAKRAFEGTQFDDMGDALKGPLVYGFSMDAPGASARLFKDFSKENK
FT                   NLQVTALSIGNGIMGPEKLDAVASLPTRDEALAKLLATFKEPVSKFVKTVNEVPSKFVR
FT                   TLAAIKDAK"
FT   gene            353060..353434
FT                   /gene="rplL"
FT                   /locus_tag="IL0344"
FT   CDS_pept        353060..353434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="IL0344"
FT                   /product="Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:IL0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81187"
FT                   /db_xref="GOA:Q5QWA6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA6"
FT                   /protein_id="AAV81187.1"
FT                   /translation="MALTKDDILNAIAEMPVMELVELIEAAEEKFGVDASAAVAVAAPA
FT                   AGGEAAAEEKTEFDVVLKAAGANKVSAIKAVRGATGLGLKEAKAMVESAPVAVKEGVSK
FT                   DEAEELKKQLEEAGAEVEVK"
FT   gene            353652..357680
FT                   /gene="rpoB"
FT                   /locus_tag="IL0345"
FT   CDS_pept        353652..357680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="IL0345"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81188"
FT                   /db_xref="GOA:Q5QWA5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA5"
FT                   /protein_id="AAV81188.1"
FT                   /translation="MAYSYSEKKRIRKDFGKRPQVLEVPYLLSMQLDSFKKFIEVDPEA
FT                   NNGLEAAFRSVFPIASYSGTAELQYVSYHMGEPAFDVEECQIRGITYSAPLRVKLRLVL
FT                   FDKEAAAGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHDKGK
FT                   SHSSGKVLYNARVIPYRGSWLDFEFDPKDNVFVRIDRRRKLPASIILRALEYSTEEILD
FT                   MFFDTTYFEILKTKVKMQLVPERLRGETAKFDIKGAEGEVLVEKGRRITARHIRQLEQL
FT                   DIKEMEVPAEYMVGKVLAKDYANKKTGEVVGHANDVLTLELIAELSEAGIKKIETLFVN
FT                   DLDHGPYMSETLRVDSSNNRLEALVEIYRMMRPGEPPTREAAETLFDNLFFSEERYDLS
FT                   TVGRMKFNRRLGREDLSGDNTLSREDIVEVMKKLIEIRNGLDEVDDIDHLGNRRIRSVG
FT                   EMAENQFRVGLVRVERAVKERLSLGDLDNTMPQDLINAKPISAAVKEFFGSSQLSQFMD
FT                   QNNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLINSL
FT                   STFSRTNEYGFLETPYRRIENGSVTDDVDYLSAIEEGNYVIAQANVGLNDKGELTEDLV
FT                   PCRHKNEFTLMSKEQVQYMDVAPQQIVSIAASMIPFLEHDDANRALMGSNMQRQAVPTL
FT                   RADKPLVGTGIERTIAVDSGVTVVAKRGGVVDYVDASRIVVKVNEEEMVPGEAGIDIYN
FT                   LTKYTRSNQNTCINQKPTVNPGEPVTRGDVLADGPSTDLGELALGQNMRVAFMPWNGYN
FT                   FEDSILISERVAQEDRMTTIHIQELNCVARDTKLGAEEITSDIPNVGESALGKLDESGV
FT                   VYVGAEVNGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVNGTVI
FT                   DVQVFTRDGVEKDKRAVAIEEMQLAKVKKDLTEEFKILEEGIYNRARNLLLSNGFDEAK
FT                   LASVDRSSWLTQDLGNEDAQAQLEQIAEQYQQIRDDFDTKFETKRRKITQGDDLAPGVL
FT                   KIVKVYLAVRRSIQPGDKLAGRHGNKGVISTIIPVEDMPHDDEGNPVDIVLNPLGVPSR
FT                   MNIGQILETHLGMAARGIGSKIEKMLKQQRAISELRDFLQQVYDLGESRQKVDITEFTD
FT                   DEVMRLAGNLKAGLPTATPVFDGAVEEEIKALLKLADLPESGQIRLFDGRTGDKFERDV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDNNLQMEAGMPESFNVLLKEIRSLGINIELEQN"
FT   gene            357753..361988
FT                   /gene="rpoC"
FT                   /locus_tag="IL0346"
FT   CDS_pept        357753..361988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="IL0346"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81189"
FT                   /db_xref="GOA:Q5QWA4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA4"
FT                   /protein_id="AAV81189.1"
FT                   /translation="MKDLLKLLKPTNQAEEFDGIRIALSSPDMIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTLTKVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFESYVVTEGGLTSLEQGQILTED
FT                   EYLDALEEHGDEFDAKMGAEAVLDLLRAVDIDGDVQKLREELPETNSETKRKKISKRLK
FT                   LLEAFQVSNNKPEWMILKVLPILPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPKLRLHQCGLPKKMALELFKPFIYGKLERRGLATTIKAAKK
FT                   MVERETAEVWDVLDEVIKEHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHLPLTLEAQLEARALMMSTNNVLSPASGDPIIVPSQDVVLGLYYMTKEK
FT                   INGKGEGMVFKDPNEAEKAYRTGQVELHSRVRVRITDTTIDDDGNRTTKTELRDTTCGR
FT                   AILSLIMPEGLPFELINQAMGKKPIGRMLNKAYRDLGLKDTVVFADQIMYTGFHYAMVS
FT                   GASVGINDMVIPEAKKEIVSAAEEEVAEIQEQFESGLVTAGEKYNKVIDIWSTANEKVS
FT                   KAMMDNLSKEIVKNKDGEDEEQASFNSVFMMADSGARGSPAQIRQLAGMRGLMAKPDGS
FT                   IIETPIVANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVSQDVVIMEE
FT                   DCGTYEGLYMKPLIEGGDVVEPLRERVLGRVLCEPVMKPGSEEELLPRNTLLDEKMCDV
FT                   LEENSIDEVKVRSVITCDTDFGVCAHCYGRDLARGHMVNQGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRATAENNIQVKNPGTIKLHNAKWVVNSDKAHVITSRSTELTLTDEYG
FT                   RERERYKVPYGAVLKKGEGDSVDGGETVANWDPHTHPIITEVEGRIKFVDLIDGVTMTR
FT                   QTDELTGLSSIVVLETGQRTSAGKDMRPMVKLVDGKGNDVNIAGTDIPAQYFLPGNAII
FT                   NLEDNSEVKIGDTLARIPQEGSKTRDITGGLPRVADLFEARKPKEPAILAEKTGTVSFG
FT                   KETKGKRRLLITPTDGGDQHEEMIPKWRQLNVFEGEQVTKGEVIADGPEAPHDILRLRG
FT                   VSAVANYIVNEVQEVYRLQGVKINDKHIETIVRQMLRKALILRAGDTNLLEGEMVEMSE
FT                   VLAANAKAEADGKKPAIFERQLLGITKASLSTESFISAASFQETTRVLTEAAVGGKKDS
FT                   LRGLKENVIVGRLIPAGTGYSYHKERMQRRLDELNVDIEPTMTAEQAEQQLADALNAGN
FT                   SSAGDDSAE"
FT   gene            362195..362569
FT                   /gene="rpsL"
FT                   /locus_tag="IL0347"
FT   CDS_pept        362195..362569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="IL0347"
FT                   /product="Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:IL0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81190"
FT                   /db_xref="GOA:Q5QWB6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWB6"
FT                   /protein_id="AAV81190.1"
FT                   /translation="MATVNQLVRKGRQKPVVKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSAMRKVCRVRLTNGYEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVNDRRQGRSKYGAKRPKS"
FT   gene            362642..363112
FT                   /gene="rpsG"
FT                   /locus_tag="IL0348"
FT   CDS_pept        362642..363112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="IL0348"
FT                   /product="Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:IL0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81191"
FT                   /db_xref="GOA:Q5QWB5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWB5"
FT                   /protein_id="AAV81191.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFINVVMVDGKKAVAEKIIYG
FT                   ALDILAEKSGKDRLEVFDTILDNIRPMVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWL
FT                   VDAARTRGEKSMSQRLAAEMLDASENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            363141..365264
FT                   /gene="fusA"
FT                   /locus_tag="IL0349"
FT   CDS_pept        363141..365264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="IL0349"
FT                   /product="Translation elongation factor EF-G, GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81192"
FT                   /db_xref="GOA:Q5QWB4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWB4"
FT                   /protein_id="AAV81192.1"
FT                   /translation="MARKTSIERYRNIGICAHVDAGKTTTTERVLFYTGLSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWQGMDKQFPEHRVNIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCASSGVQPQTETVWRQANKYEVPRMVFVNKMDRAGADFLSVVHQMKTRLA
FT                   AQAVPMQLPVGAEDNFRGVVDLVKMKFINWSEEDMGTSFTYEDIPADMVDECEKYHGEL
FT                   VEAAAEANEELMNKYLEEGELTEAEIKQGLRIRTLANDICLVACGSAFKNKGVQAVLDA
FT                   VIEYLPSPTEVKPITGILDDESEGVRKSSDEEPFSALAFKIATDPFVGTLTFVRVYSGV
FT                   LNQGDGVVNPVKNKKERVGRMVQMHSNSREEIKEVRAGDIAALIGLKDVTTGDTLCDPA
FT                   HKITLERMEFPEPVISVAVEPKTKADQEKMGIALGKLAAEDPSFRVKTDEESGQTIISG
FT                   MGELHLDIIVDRMKREFKVECNVGQPQVAYREAIRDAVEIEGKFVRQSGGRGQFGHVWL
FT                   KLEPMTIEEDANGDDITYKFVNEIVGGVVPKEYIPAVDKGIQEQMQQGVLAGYPVLGVK
FT                   ATLYDGSYHDVDSSEMAFKIAGSMAFKKGALKANPALLEPMMKVEVITPEESMGDVVGD
FT                   LNRRRGLIEGMEEAPGGLKAVNAQVPLSEMFGYATDLRSQTQGRASYSMEFLKYAEAPN
FT                   NIAEKVMAERNAK"
FT   gene            365324..366508
FT                   /gene="tufB_2"
FT                   /locus_tag="IL0350"
FT   CDS_pept        365324..366508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB_2"
FT                   /locus_tag="IL0350"
FT                   /product="Translation elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:IL0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81193"
FT                   /db_xref="GOA:Q5QWA3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWA3"
FT                   /protein_id="AAV81193.1"
FT                   /translation="MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKVYGGAAK
FT                   DFAAIDNAPEEKERGITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLSRQVGVPFIVVFMNKCDMVDDEELLELVEMEVRELLSEYDF
FT                   PGDDLPVIQGSALKALEGDEEWSKKIVELADALDNYIPEPERDIDKPFIMPIEDVFSIS
FT                   GRGTVVTGRVERGIVRTGDECEIVGMKDTTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKRDDVERGQVLAKPGTITPHTKFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   AVELPEGVEMVMPGDNLKFVVDLIAPIAMDEGLRFAIREGGRTVGAGVVSKIMD"
FT   gene            366681..367472
FT                   /locus_tag="IL0351"
FT   CDS_pept        366681..367472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0351"
FT                   /product="Uncharacterized periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81194"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB2"
FT                   /protein_id="AAV81194.1"
FT                   /translation="MKLLRYFSVFVFMGLSCSATAKVPVYVAAYDYPPYFSAVLQTDLT
FT                   RELITLLNEHQDSYVFRIQVIPPTNRHKALSTKGCCDVIFFESPLWGWKKSGVGFQETI
FT                   PLVKGNERLVALKKTGRDQSFFDTFDGKTLGGVKGYHYLLGGELLASDEVEEKYTTYLA
FT                   DSRMTNLQMVLGGRIDLTIINDELLAALKGSNQINVGSLLLSEKVSLEYKLHLLVGDNK
FT                   NISADTLQRLLRELGRQGEFEILFRRFNMERFQIYRPTTTR"
FT   gene            complement(367469..368425)
FT                   /locus_tag="IL0352"
FT   CDS_pept        complement(367469..368425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0352"
FT                   /product="Glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81195"
FT                   /db_xref="GOA:Q5QWB1"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB1"
FT                   /protein_id="AAV81195.1"
FT                   /translation="MTRDLVSGGQQIHAPDDLKSLLEEIHQQAMKITEGHVADYIPALA
FT                   EVDPELCGLTLATLDGEVFNVGDTQEQFSIQSISKIFGLMLAMERLGEDLWDRVKMEPS
FT                   GQAFNSIVQLEWEKGIPRNPMINAGAIVVSDVLVSRYSASKNAVLSLVRTLCGNDNVYA
FT                   DNIVHQSEKEHGHRNAALAHLMKSFGNIDAEVDELLDHYFWQCALTMSCENLARSFTFL
FT                   ANDGICPFSKKKIMSKRDSQRINALLSTSGMYDQSGEFAFTVGVPAKSGVGGGMIAVVP
FT                   DFGVICSWSPRLNSYGNSARGMYMVRELANRLGLSVY"
FT   gene            complement(368415..368822)
FT                   /locus_tag="IL0353"
FT   CDS_pept        complement(368415..368822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0353"
FT                   /product="Predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81196"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB0"
FT                   /protein_id="AAV81196.1"
FT                   /translation="MLTEDFKVRFYETDALGHVNNTVIPGWIETGRLPIFEFFGEMSPK
FT                   TQSLIVARLEVDYLLPIYFGGHVTVNTYVSRLGGSSFDITTEIWQKEKMCAKGKTVLVY
FT                   FDFQQERSVKLSDQLKDRLSTITHPEHSLDA"
FT   gene            complement(368835..371660)
FT                   /gene="uvrA"
FT                   /locus_tag="IL0354"
FT   CDS_pept        complement(368835..371660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="IL0354"
FT                   /product="Excinuclease ATPase subunit, UvrA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81197"
FT                   /db_xref="GOA:Q5QWC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC1"
FT                   /protein_id="AAV81197.1"
FT                   /translation="MDTIEVRGARTHNLKNFNLTIPRNKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDSIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLMFARVGEPRCPTHDVPLAAQTVSQMVDNVLSAPEGEKRMLLAPIIQNRKGEHL
FT                   KVLENLALQGYIRARIDGEICDLSDPPTLELQKKHTIEVVVDRFKVRDGMEQRLAESFE
FT                   TALELSGGTALVVPMDGDGDAEVYSANFACPHCGYSMQELEPRLFSFNNPAGACTTCDG
FT                   LGVEQFFDPAKVVVNAELSLTGGAIRGWDKRNFYYYQMLQSLAKHYEFKLSQPFNELPD
FT                   DIREKILFGSGKEEIKFTYMNDRGDKVVRAHPFEGIIPNMQRRYRETESQAVRDELSKY
FT                   VATQPCKSCSGTRLRTEARHVFIQGTTLPEVVEQSIGDALEFFQQLSLEGQRAQIAEKI
FT                   LKEINDRLRFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIG
FT                   LHQRDNERLLNTLTHLRDLGNTVIVVEHDEDAIRQADHVIDIGPGAGVHGGEIIAQGQV
FT                   EDIVGSEDSLTGDYLSGRKEIEVPKQRHKPDKRRLTIHGASGNNLKNVDFNLPLGIMTC
FT                   VTGVSGSGKSTLVNNTLFHIAHRELNGATTGEPAPYKSVDGMQLLDKVVDIDQSPIGRT
FT                   PRSNPATYTGIFTPIRELFAGVPESRARGYKPGRFSFNVRGGRCEACQGDGVIKVEMHF
FT                   LPDVYVPCDICKGQRYNRETLEVQYKGKNIHEVLDMTIEDAREFFDPVPAIARKLQTLM
FT                   DVGLSYVRLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILDEPTTGLHFHDIKQLLA
FT                   VIHRLRDHGNTVVVIEHNLDVIKTADWIIDLGPEGGSGGGEILCEGTPEDICENERSHT
FT                   ARFLKPMLKLS"
FT   gene            371777..373153
FT                   /locus_tag="IL0355"
FT   CDS_pept        371777..373153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0355"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81198"
FT                   /db_xref="GOA:Q5QWC0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC0"
FT                   /protein_id="AAV81198.1"
FT                   /translation="MTPQKLNKTEKKAALALASVFGIRMLGLFLIMPVLAVYAQDYPDY
FT                   SPLWVGIALGAYGLTQALLQIPLGMLSDRLGRKPVIVGGLLVFILGSVVAAQADTLFGV
FT                   SIGRALQGLGAIAAAILALAADLSRDEQRPKVMATIGMCIGLAFAISLVAGPLLGNIIG
FT                   LSGLFWFTAASGVLGILVLLLSVPKVVTTSARRESLPVLSELGHLLKHKQLWCLNSGIF
FT                   VLHAILTAWFVTLPMQLQNAGFESQTHAWFYLPTLAASILFMVPMIISSSRNNNSVQWL
FT                   RFSIVVLIVALLIIAVAGQNPWLLVAALVIFFTGFNFIEASLPSLLTRVAPAGSKGSAS
FT                   GIYSTGQFLGSFVGGVAGGSVLQFFGISGVVVFCLILLVCWLLISLVMVNPAGVTSVSL
FT                   SLPGLTESKATKLSEQLLTVTGVTEARWVEEDQATYLKVDKKHYDEKAVNQLLKEASVA
FT                   "
FT   gene            373198..373758
FT                   /gene="ssb"
FT                   /locus_tag="IL0356"
FT   CDS_pept        373198..373758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="IL0356"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81199"
FT                   /db_xref="GOA:Q5QWB9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB9"
FT                   /protein_id="AAV81199.1"
FT                   /translation="MASRGVNKVILIGNLGADPEVRYTQNSTAIANLSIATSETWKDKQ
FT                   TGEPREQTEWHRCVAYRRLAEIAGEYLKKGSKVYVEGRLQTRKWTGQDNVERYTTEVVI
FT                   NEMQMLDSRGGPQGGAPQQGQGFGGGQQQGGGYGGGQPQQQSQQQQRPAPQPAQQQNQQ
FT                   SQQKPAEPAPFSPDNDFDDDIPF"
FT   gene            373929..374417
FT                   /locus_tag="IL0357"
FT   CDS_pept        373929..374417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0357"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81200"
FT                   /db_xref="GOA:Q5QWB8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB8"
FT                   /protein_id="AAV81200.1"
FT                   /translation="MTLTQEQLRQLSVPERLGRVARQWQAIADKELAPLGLTYPRWSAM
FT                   WKLARIGDGVSQKQLAEALELELGSLMRTLAQLEEQELITRKASPDDGRAKQVFLTNSG
FT                   HALVKKMEAKILKVRRALLANIEDEEIETVKKVLAMISYNANHMSEAQKLDQNNEEEV"
FT   gene            374414..375475
FT                   /locus_tag="IL0358"
FT   CDS_pept        374414..375475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0358"
FT                   /product="Multidrug resistance efflux pump, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81201"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWB7"
FT                   /protein_id="AAV81201.1"
FT                   /translation="MTADEKFARWVKRALVLFVLVFAYFLWADLSLPLTPQAMVTRVVT
FT                   QVAPQVNGTVEKVLVNNNQYVEEGEPLFKIDPRPYQLQLQQAELAMAQAQQSNQQFDAQ
FT                   IRTAQAKIKSAQATAQELSREARRIKDLVEDGSSSQQAFDRAQSSKLEALANVEAAQSQ
FT                   LQSLKVQRGAEDDANNLLIQQAKNAIETAKLNLSYTTVRAKHAGRVGNLKLSEGAYARQ
FT                   GTPLMALVSPNADIIADFREKNLRNIESGQQALVVFDAEPGTLYEAKVESIDAGVNAGQ
FT                   LSADGALAAPVNSNRWVRDAQRLRVHLRLTEKPDSERPAGAKATVQIVPEGSFKAAIAK
FT                   AQIRLLGWLHYIY"
FT   gene            375489..376517
FT                   /locus_tag="IL0359"
FT   CDS_pept        375489..376517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0359"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /note="probable transporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81202"
FT                   /db_xref="GOA:Q5QWC2"
FT                   /db_xref="InterPro:IPR016926"
FT                   /db_xref="InterPro:IPR022604"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC2"
FT                   /protein_id="AAV81202.1"
FT                   /translation="MATSALSENGLRQCLRIAFGGSIGFLVTALFDLSYGVFFTVLPML
FT                   LLGLVPMINRQVARQILAASVMCGLEVGILAQILGGHSVLMTMAAFVLFLYRFAFMARG
FT                   TAFLFGANGVLMLSIMLHYASYPGTDVNNLIASNFFASILAIAIAFVMHAMIPNKEQNA
FT                   SPPALPDKSPNRVRHEAILGATVTTLSFLVFQLFDLQDSISAQATTILVLFPMNWNGAL
FT                   TYARKRAAGTLIGVMFGLGVQLLLYGWYDILWLIVPLFWLGVMLFARIHVLEASGAGVG
FT                   FGAMTTMGILFGQYLSPAQDLVYSGLYRLSSTFVAIIAAMMVCYLVHKLLNQFAGTRFG
FT                   AA"
FT   gene            complement(376607..377839)
FT                   /gene="add"
FT                   /locus_tag="IL0360"
FT   CDS_pept        complement(376607..377839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="IL0360"
FT                   /product="Adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81203"
FT                   /db_xref="GOA:Q5QWC8"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC8"
FT                   /protein_id="AAV81203.1"
FT                   /translation="MQYSPEFIKAIPKADLHLHLDGSLRASSLIDMAKRADIELPSYTE
FT                   EGLFDLVFKSHYNNLGEYLNGFQYTCAALRDLENLEQASYELAVDNQNEGVNYIEVRFA
FT                   PQLLMDPGKGVTFDTIMHVVNDGLLRAKKEYNNRADVKNGDKPPFDYGIINCAMRMFGK
FT                   KGFSPYYTQMFQLMRDFEPMQVIKTAAMDLVRASVRMRDEEGMPIVGLDIAGQEIGYPA
FT                   GEFKEVYEYAHENFLLKTVHAGEAYGAESIFEALTKCHADRLGHGYSLFSPEMTQDPSI
FT                   EDPKAYGESLASYIADRRIAVEVCLTSNLQTNPDIGDIKNHNFQHMLDNRLATIICTDN
FT                   RLVSRTTVSNEYQLAVDNFDISLKRLKDIVAYGFKKNFFPGRYVEKRDYAKQNLEYFDK
FT                   VVKQFGLSDAS"
FT   gene            377941..378522
FT                   /gene="tdk"
FT                   /locus_tag="IL0361"
FT   CDS_pept        377941..378522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="IL0361"
FT                   /product="Thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81204"
FT                   /db_xref="GOA:Q5QWC7"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWC7"
FT                   /protein_id="AAV81204.1"
FT                   /translation="MASLYFTYSAMNAGKSTSLLQVAHNYEERQQHVLLMTPALDDRAG
FT                   KGRIASRLGIGRDAVSFTHRTDLAAVVRARYMQQAIDCVLIDEAQFLSEEQVWQLSSLA
FT                   DTDNIPVMCYGIRTDAFGNAFPGSAVLLAIADKLVEMKTICHCGRKATMSLRVDEQGNA
FT                   IRMGQQIAIGGNDRYVSCCRKHWKEAMGLR"
FT   gene            378609..379643
FT                   /gene="pyrC"
FT                   /locus_tag="IL0362"
FT   CDS_pept        378609..379643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="IL0362"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81205"
FT                   /db_xref="GOA:Q5QWC6"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWC6"
FT                   /protein_id="AAV81205.1"
FT                   /translation="MQSLTIPRPDDWHLHLRDGAMLQTTVPATAAVFHRAVVMPNLVPP
FT                   VTTVAAAMEYRERILAEIPAGMSFNPLMALYLTADTTPAEIAEAAANEHVIGFKLYPSG
FT                   ATTNSAAGVKSVEALAPVLAAMQEHQVPLLVHGEVTDSDIDIFDRERVFIERHLIPITE
FT                   RFPQLKLVLEHITTADAVKFVENANSNVAATMTPQHLLMNRNDLLVGGIRPHNYCLPIL
FT                   KRRSHQQALQQAALSGNPKFFLGTDSAPHVQANKETACGCAGCYSAPAAIELYAEFFSQ
FT                   HNALDKLANFASVFGADFYQLPRNTETIELVQQPWTVAETVDTATGPMVPYWAGSDLQW
FT                   KLRG"
FT   gene            379774..380685
FT                   /gene="mshI_1"
FT                   /locus_tag="IL0363"
FT   CDS_pept        379774..380685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshI_1"
FT                   /locus_tag="IL0363"
FT                   /product="Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81206"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC5"
FT                   /protein_id="AAV81206.1"
FT                   /translation="MLGFSKQKQNDHRICFQITQNSVRLLVAKGSANAPELIVNDYEPV
FT                   QRGSLLKHADTLLGKYSRLSLKHAQVTLVLGTDLYESVQVDRPMLDPEEISESLKYSLS
FT                   DLVSFAADEIIADYYEFPEQPSGQDKVVAVAANKSDLMPWVELFGEHDLSLTDIAITEL
FT                   TLPRLAETQNHAELTLYQNPAGNYLAQINTPKGLMFTRLLRGVTDVSKYTESEIEAGAL
FT                   EPLATELQRSVDYFESHLRQAPISRIILAVEHMKPASLEKSLAELLAVECTMYQYPQWS
FT                   ADLREGDYSDLAGLGALVEGDL"
FT   gene            380682..381290
FT                   /gene="mshI_2"
FT                   /locus_tag="IL0364"
FT   CDS_pept        380682..381290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshI_2"
FT                   /locus_tag="IL0364"
FT                   /product="Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81207"
FT                   /db_xref="GOA:Q5QWC4"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC4"
FT                   /protein_id="AAV81207.1"
FT                   /translation="MKQWVNLYRNELKPVKQRLTLTKVSSVLGLWLGLLLVVVGVTQWQ
FT                   KATIVQKNEQLSATLESLNSDLANNRERISLRQPSPQLQAEKEQLQQELQDARSFSQQI
FT                   AEFRQNQSSSVSEFLHELAEITPEDIWLTDFSMSGENIRLHGQALNSEALVLWMDKFGQ
FT                   SGVLSDKRFAVVELKRSEQGYQQFLLQSVRSSEGESNNE"
FT   gene            381283..381918
FT                   /gene="mshJ"
FT                   /locus_tag="IL0365"
FT   CDS_pept        381283..381918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshJ"
FT                   /locus_tag="IL0365"
FT                   /product="Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81208"
FT                   /db_xref="GOA:Q5QWC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC3"
FT                   /protein_id="AAV81208.1"
FT                   /translation="MNNWWLRAQEAFNSMPGRQRALLSLAGFLMITLPLMSYVIFPTLE
FT                   QNKILSAENHRIASQIEQSKQLAQDLQAQLVTDIDAPLRAEIKQLKQRLAQAKGNFSES
FT                   EVLLPAQQRKQFLNSVLRHASELGMDSLEAKEPTVVFETGSIKLYQHAVQVEFTGRFFA
FT                   ISDFVDTLQKEYPNVQWARFDYQVGDYPTAKVTIVWYLLSTDKEFISA"
FT   gene            381911..382252
FT                   /gene="mshK"
FT                   /locus_tag="IL0366"
FT   CDS_pept        381911..382252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshK"
FT                   /locus_tag="IL0366"
FT                   /product="Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81209"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD4"
FT                   /protein_id="AAV81209.1"
FT                   /translation="MLRGIVLLLLMVAVSAFSQERDPTQPPFTVSQPAVEMDSWGQNIK
FT                   LSQIFYSEQRQSARINGEWVKPGENIDGFRVNSVNPNSVILEKNNERVEITLFKPIKQN
FT                   EKGNPGAVQ"
FT   gene            382249..383922
FT                   /gene="mshL"
FT                   /locus_tag="IL0367"
FT   CDS_pept        382249..383922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshL"
FT                   /locus_tag="IL0367"
FT                   /product="Type II secretory pathway"
FT                   /note="PulD-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81210"
FT                   /db_xref="GOA:Q5QWD3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD3"
FT                   /protein_id="AAV81210.1"
FT                   /translation="MKRVAAGALLLALSGCAYQPSYSPDEANKAMKPEASGKKETEVKK
FT                   ELPAEVSNFLNQTANKEQEDGLALLEEPRFVLQADDVDAKAFFYGLAADSPYNILVHPN
FT                   VSGEISLSLKDVTLDETLDAVQDMYGFEVRRSGRTIQIYPAGVRTQTFSLDYLSLRRFG
FT                   MSQTEISGGGVSEERNNNRGLGNNSGNSNTRVEGTPLLGNSDGEYRRDSQQNQLQGNGS
FT                   SINTQSETDLWGGLKDVIEGIIGDGNVVLSPQAGIVSVTASPSKLRAVGDFITVLESRL
FT                   QRQVILEARIIEVTLNDGYQQGINWSDIYSGNAGFGVDFNGVTPSNATSAAIGGLFGLT
FT                   YTDDGNNFSGMIEMLQTQGTVQVLSNPRVSASNNQKAVIKIGEDEYFVTDVTSRTVLNT
FT                   GGASSSDSDIEFTPFFSGISLDVTPQISDDGEVILHVHPSVVETSEQEKVITVSGEESV
FT                   LPLARSNIRESDTIVKARNGEIVVLGGLMQTTNSEEVGKVPLLGDIPLLGELFTNRRNR
FT                   QEKKELVILLKPTVVGVDTWRDELKRSRELLQEWFPDIEQ"
FT   gene            383933..384841
FT                   /gene="mshM"
FT                   /locus_tag="IL0368"
FT   CDS_pept        383933..384841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshM"
FT                   /locus_tag="IL0368"
FT                   /product="General secretion pathway protein, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81211"
FT                   /db_xref="GOA:Q5QWD2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD2"
FT                   /protein_id="AAV81211.1"
FT                   /translation="MYLYHYGLRELPFTITPNTQFYYDLKSHHEAFEVVLTALKTGEGF
FT                   IKITGEVGTGKTLLCRRLLNDIPDFFKTAYIPDSYLDPAELRLAIAQELDLETGQMTNQ
FT                   QQLARALQQRLLDINKNGQAVVILIDEAQALPEESLEALRLLSNLETERRKLVHIILLG
FT                   QPELDERLSQKAFRQLRQRISFSHKLTAMNADETAEYIAHRMDVAGYQGTPIFDWKLVR
FT                   RLHRCSRGVPRLINMLCHKMLLLAYGEGRHQLSTRDLKLAVNDTEDTELTRSVWLPVTV
FT                   SVCVFFLAAAALSYWQMGGSL"
FT   gene            384838..385911
FT                   /gene="mshN"
FT                   /locus_tag="IL0369"
FT   CDS_pept        384838..385911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshN"
FT                   /locus_tag="IL0369"
FT                   /product="Membrane associated TPR repeats containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81212"
FT                   /db_xref="GOA:Q5QWD1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD1"
FT                   /protein_id="AAV81212.1"
FT                   /translation="MSVINKVLKDLDRRGQQPFSKRAASSAVERRSSHRLGLWLLALML
FT                   LIVLALVVFWWQSRSENTMTVTESEPAEMPKLQERVEPFIDTAVIEVPAERTPRSESDS
FT                   RQSSEIVSQDLASVVIPETEPEKVEKTEPMPEEPVVATKETENEAQKGGEFSKQPVQLS
FT                   PAEISAQHIEKAQKAQQQGRLTSAEDHWRKALAVTPENKEVRKKLAALQFGRNKVSQAL
FT                   TTLEAGFKLNPDDFEFRLLSARILEKEARPAAALSLLKQATPDADVYPEYVQKQALLAQ
FT                   AQGDYKAAADAYQRLLESEPEQGRWYLGKAVAQQEFAPEAAVASYQEAFKRIKHQPTLD
FT                   FIEQQITSLQVTEAGEQ"
FT   gene            385908..387623
FT                   /gene="mshE"
FT                   /locus_tag="IL0370"
FT   CDS_pept        385908..387623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshE"
FT                   /locus_tag="IL0370"
FT                   /product="Type II secretory pathway, ATPase"
FT                   /note="MshE-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81213"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD0"
FT                   /protein_id="AAV81213.1"
FT                   /translation="MKRPRLKMRLGDLLVHEQIISEEQLQKALEQQRISGRKLGATLTD
FT                   LGYISEQQLLEFLAQQLKLPLISISERKIPAEAFKLLPEVQARRHRALVIEASEEQALV
FT                   GMSDPADLSSIDAINQLLAPRQVELAVVPEGELMQAFDNLYRRTKEIETFASQLQDEYE
FT                   DTSEFELGQLSLDDDTDEATVAKLLQSIFEDAVQVRASDIHIEPDDRKLRIRQRVDGVL
FT                   QENVLEETNIANALVLRLKLMAGLDISERRLPQDGRFNIKIRKHSIDVRVSTMPVQYGE
FT                   SCVLRLLDQSAGLLSLEQTGMPASIVKRIRALIKRPHGMLLVTGPTGSGKTTTLYGALS
FT                   ELNTEGKKVITVEDPVEYRLPRISQVQVNSKIGLDFSRVLRTTLRQDPDIIMVGEMRDH
FT                   ETVEIGLRGSITGHLVLSTLHTNDAITSAMRLIDMGAPPYLVAAALRGILAQRLVRRVC
FT                   DKCAESYQPDEAESQWLEHLREGSSDYSFKRGVGCQTCNHTGYRGRIGVFELLEMNTPM
FT                   MDALRDGNTREFAIAAKAHPGYQSMATVALDYAREGITSVDEVLFLAESVEDSI"
FT   gene            387623..388861
FT                   /gene="mshG"
FT                   /locus_tag="IL0371"
FT   CDS_pept        387623..388861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshG"
FT                   /locus_tag="IL0371"
FT                   /product="Type II secretory pathway"
FT                   /note="PulF-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81214"
FT                   /db_xref="GOA:Q5QWC9"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWC9"
FT                   /protein_id="AAV81214.1"
FT                   /translation="MQFRYRARDKAGQLQQGSLDASDERNAADVLMRRGLVPLSINSVK
FT                   SQSFSFLNSGFGESLKSAFQQKVSLDELIIFCRQMYSLTQAGIPMLRAIEGLADTTQNK
FT                   RLRKTLQDVHEQLERGRNLSSAMSHHRGVFPRLVIAIVHVGENTGQLEESFQQLSVYLE
FT                   KEQDTRKRIKAATRYPSFVLIALVIAMFVLNIFVIPTFASMFSRFNVELPWATRALLGS
FT                   SEFFVAYWHVLLLAMVGTFFGIRYYIATDDGRLKWDSLKLKIPIIGSILMRSMLGRFAR
FT                   SFSVMIGAGVPLTQALSLVAEAVDNAWMEKRIIEMRRGIERGENLSRVARQSGLFTPLI
FT                   LQMISVGEETGRVDVLLLEVAEYYERETDYDLKTLTARIEPLMIAVVAVMVLILALGIF
FT                   TPMWDMMSAYQGR"
FT   gene            388861..389310
FT                   /locus_tag="IL0372"
FT   CDS_pept        388861..389310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0372"
FT                   /product="Predicted Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81215"
FT                   /db_xref="GOA:Q5QWE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE0"
FT                   /protein_id="AAV81215.1"
FT                   /translation="MTRTATDERKGIQRLQNILVVLLLLVLAAVAARMVLVEEPQKWRQ
FT                   TELDIAVSRFIDSLWLARTEWMRRGKPKEIALLYENKAQQTKVVMNEQGWPSVEVGCLQ
FT                   LWQHLGSNVPGSALDTELENGNCHYRINQKPWFSYKSDRGQVVRK"
FT   gene            389375..389980
FT                   /gene="mshB"
FT                   /locus_tag="IL0373"
FT   CDS_pept        389375..389980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshB"
FT                   /locus_tag="IL0373"
FT                   /product="Pilin protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81216"
FT                   /db_xref="GOA:Q5QWD9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD9"
FT                   /protein_id="AAV81216.1"
FT                   /translation="MRAKMSKRQQGFTIIELIIVVVILGLLAAAAIPRFTDVSSDAEDA
FT                   ALEGVAGGFASAVGIVRGEWELSGRPKGANGTGAGAEVSMDQIQLYVDGSTGYPVSGDN
FT                   ANAHDENLAATDCVSVMQSILQGAPTVTTNFNNLNETRYFTYVTQDSAAGNDMCVYYLA
FT                   NTIKNETEAPSGDDYLTVGNAFVYNPRNGGVSIHSNNQ"
FT   gene            390011..390523
FT                   /gene="mshA"
FT                   /locus_tag="IL0374"
FT   CDS_pept        390011..390523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA"
FT                   /locus_tag="IL0374"
FT                   /product="Type II secretory pathway, pseudopilin"
FT                   /note="PulG-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81217"
FT                   /db_xref="GOA:Q5QWD8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD8"
FT                   /protein_id="AAV81217.1"
FT                   /translation="MRNQKGFTLIELIIVIVVLGILAVTAAPQFINFSTDARTSTVKGL
FT                   KGALQGAAQTVYARAAIDDDLDGTSAAPVTVNGVATVNGYPAATQAGIATAANLDATNV
FT                   DPAATVTTDWAFFADSGTISIAPGDQVPAPTAAEVEDITDTNCYATYSDAADSNTPPAI
FT                   TIVTTGC"
FT   gene            390579..391013
FT                   /gene="mshC"
FT                   /locus_tag="IL0375"
FT   CDS_pept        390579..391013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshC"
FT                   /locus_tag="IL0375"
FT                   /product="Type II secretory pathway component"
FT                   /note="PilE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81218"
FT                   /db_xref="GOA:Q5QWD7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD7"
FT                   /protein_id="AAV81218.1"
FT                   /translation="MKSRGFTLIELIIILVIIGILAVSAGPVFFDNSGTQSQVVRQRAM
FT                   SILRSIQLQAMQDTTGNYSSVVSENTLGVPPFVENNNRQISNVDNVTFSFSGSLPATIG
FT                   FDGLGRPTEQCSGGCTITLTESSGISRDLCINSEGYINEC"
FT   gene            391003..391524
FT                   /gene="mshD"
FT                   /locus_tag="IL0376"
FT   CDS_pept        391003..391524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshD"
FT                   /locus_tag="IL0376"
FT                   /product="Pilin protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81219"
FT                   /db_xref="GOA:Q5QWD6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD6"
FT                   /protein_id="AAV81219.1"
FT                   /translation="MSVKQSKGFTLIELIIGIVVIAIVTLVVTGGLGQLFRQSVDPWQQ
FT                   VRATEIGQSLMNEILSRRFDENSHAGNQSLRCSETGAGGCAALNSCPADGSLPNSEESQ
FT                   RSNFDDVDDYHCLELDGGELSDLGENLYKGFQAKVFVSYEIPNEVKLITIEVQTPQQET
FT                   LEFNAQKGNW"
FT   gene            391524..392342
FT                   /gene="mshO"
FT                   /locus_tag="IL0377"
FT   CDS_pept        391524..392342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshO"
FT                   /locus_tag="IL0377"
FT                   /product="Tfp-like pilus assembly protein"
FT                   /note="PilW-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81220"
FT                   /db_xref="GOA:Q5QWD5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWD5"
FT                   /protein_id="AAV81220.1"
FT                   /translation="MRNMRGFTLIELIIVIIILAIVAGFSFQFVGIGARMFTTGAERLQ
FT                   TIEKSRFAAERVTRELRNAVPNSIRIRSSDGTQCLEFSPVRTVGTYYDAPIRPQRSDQM
FT                   TLVTLSSLSTPWVAEPTDRIFIYATRANFIYASNAQRYAVLAESYDSASASASTPATHI
FT                   LPLVADSRFAQSSPRERAYIGKQPVSFCLQNDGLYRVENYGWNQSQTVPPVTLSQSQLL
FT                   AERLNMDNSSFLLEPGASQRNNVINIQLEFVSRSNESIYYNQKVHIPNAP"
FT   gene            392332..392763
FT                   /gene="mshP"
FT                   /locus_tag="IL0378"
FT   CDS_pept        392332..392763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshP"
FT                   /locus_tag="IL0378"
FT                   /product="Type II secretory pathway component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81221"
FT                   /db_xref="GOA:Q5QWE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE1"
FT                   /protein_id="AAV81221.1"
FT                   /translation="MHHNDNFRRSLNKQRGNTLVIAIFVIVVLGALVAALSNLVRTTSE
FT                   SVVVEVLGTRSFMAAQSGIEQGMMELYPIGGSPATACPGFSESIEVGNCEAAVACESVT
FT                   HTSDSNETYIHFRLEATGTCTAGGQAASRKLAIETRVKN"
FT   gene            392763..397058
FT                   /gene="mshQ"
FT                   /locus_tag="IL0379"
FT   CDS_pept        392763..397058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshQ"
FT                   /locus_tag="IL0379"
FT                   /product="Type II secretory pathway component"
FT                   /note="component PulK"
FT                   /db_xref="EnsemblGenomes-Gn:IL0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81222"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE7"
FT                   /protein_id="AAV81222.1"
FT                   /translation="MSLLKTLKFVIISVIAFASTPAMATNYNLPNNNLPGCSKSGNTYT
FT                   CPNGLNLNFRDRIQISGNNSVVINVNGNFNLGSEMRINENGGAQQLTITTTGSYNGGFQ
FT                   SVINANISSQQNITLANENIFSGSLVAANDVSVGFRTNIDGSIRSTSGSVILQGENSIT
FT                   GNVDARDNVIVRFLTEVNGNLNATNGNVVLEGQNDVSGAIFSGGDTILRFRSDVEGAIT
FT                   SNGRVVLEGENTVNGNIIAGDDVTLRYGSDVNGDIDADGSVTLDGANIVDGNINATDRV
FT                   TIPNSSTVTGYVNAPQIIDESNVQGETCDINNNEGPCGSEPPDQPLDGLGYWAFDQVEW
FT                   RGQFGEVLDISGNGLHGQALRGANTSGFNPAIAGNPGTCRYGKFNGDNAVRVDNAQSIA
FT                   NAESVSVAFWFKGSATGQNQSDRYQSLLVIGNGPTEGASGRFEVYRQDTRDGGGLYFEI
FT                   RRNNGEIVNVEAGNTRQGQTNLLDDNWHHLAASYDRNARRLTLYIDGQQADQTSFNGSS
FT                   NLNAVAPRLYIGGQGIGENSFYGEIDEVFIDDKVLTQSDVTTLKSITRPCNDQRPLCED
FT                   VWPVAFEVPNNVPKPFDLPDRSYNTQLPAQLQPIDYLRTGNFGNTGFNYTTNGQTSRVY
FT                   IDGDVTIQSGRRINVGGNANEMMLIVTGDLTLEQDVQFNGYIYVAGNFLFERSFFFWQT
FT                   SEVTGGVSVGGRSFATGNFGFFDPEVNYQAPVEPIAGGNFCRASDTAPPVSPVHHYQLS
FT                   YNSPALTCSAADIEVTACANASCSELYEGSSTVQLNSTAGDWSTNPVSASPVGTTSLEQ
FT                   TNAGIYPLAVETTGTLPQPQNPTRCLVNGNLSESCNIEFSDTGFIFTSGDNFEDTDIPS
FT                   QVSAVPFSNLQLRAVETNSQTLACQAVTQPLNSVSMSMNCVDPDQCLMGASVNETEVTE
FT                   NNTSNISVSFTDGKAPLEINYKDAGAINLTAQATLPNGKTLRGTSEAFVWRPASIDVEA
FT                   SQDASSNYEGTILAKAGDVFTARLAAINDEGDVTPNFGNEANPETLQLMAQTEAVESYN
FT                   GEITNADGFTKDGAGIFTNSGLTYTEVGSTRVTAYIGSQNYLPGYHGSPVMLTTESEIG
FT                   RFIPYEFQMETFDGFSGVCNRNNAGQGDEFYYIGEAQLLGPSFALTAVNKNGETTKNYP
FT                   TDVVEGELEFYPFNGANGSPELLNPGQLFATDVELEWGQNEESAGTASFKSPAPSVTYR
FT                   RNGAEEGPYEDYKLGIQFNDSEGGNYYSVITESNLPAAAQAPAFKLYDSVKLLYGRFVL
FT                   DNIFGAEVDDLPLSGRAQFWNGDNFVINTNDNCFTVSVSKLDVLSAIDPTKDPVISLDT
FT                   ESIELSDTPDSVSLTEGELQEAYSPMEDLLRWQAYGSAAEFTFELTVPSFLQYDWDGDS
FT                   NYQDNPTAEGTFGIYRGSDRQIYWQEVGW"
FT   gene            397256..399115
FT                   /locus_tag="IL0380"
FT   CDS_pept        397256..399115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0380"
FT                   /product="Secreted protein with uncharacterized domain"
FT                   /note="possibly involved in signal transduction"
FT                   /db_xref="EnsemblGenomes-Gn:IL0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81223"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE6"
FT                   /protein_id="AAV81223.1"
FT                   /translation="MMRLARLALVMASTLTFASTALAQQEMTVEEIANQISTLESDFEN
FT                   FSGTVNTLQQEERDLREKLQNLRERNSELETKRESALAEMNDRYQRLVEDPTIDIAGAQ
FT                   EAYKQAVMAHQQNKADIKQQVSLVNEKAREVEEARVSKHSLINEIETLKEQRNLARVDR
FT                   LENEFNRTGELEVSQSISCDRQETLGQCENRGKLMAKQKASKQYLNTILDGLSEASLAR
FT                   ENIEKASPNVQILGSKTISNGFSGAGNYGVKLAVELRGQLPQSQACTLLNVDMRYCASE
FT                   QRPGELQAGDEETVDSSVMHPLTIRSNVYDDEVVIDGVSYGSTPLEVMLPGGEHQIEIL
FT                   KYGYSAYAEKILLKDATAIRAELEKSDYSFTRGEKIQDILYRDVRGPELVVVPAGKFKM
FT                   GDLVGNGLPNERPAETREIPTALGISDTEITVEQFGNFVEDTAYVTEAEKNGTCASLSN
FT                   GRPQFNEKLSWKNPGFKQSESSPVVCVSYNDAQAYAEWLTQKSGFKYSIPTEAEWEYAA
FT                   RAGSETDFWWGNDVGYGKANCRNCGTDWSNTRPAPVASFHRNPWGLYDTVGNVWEWAET
FT                   DEGVVVKGGAWNFTPSLARVSTRMELPSDFNSNYIGFRVVRAQ"
FT   gene            399175..400218
FT                   /gene="mreB"
FT                   /locus_tag="IL0381"
FT   CDS_pept        399175..400218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="IL0381"
FT                   /product="Actin-like ATPase"
FT                   /note="involved in cell morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81224"
FT                   /db_xref="GOA:Q5QWE5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE5"
FT                   /protein_id="AAV81224.1"
FT                   /translation="MFKKIRGLFSNDLSIDLGTANTLIYVKDEGIVLNEPSVVAIRQER
FT                   SGGPKSIAAVGAAAKQMLGRTPGNIRAIRPMKDGVIADFYVCEKMLQFFIKQVHDSHYF
FT                   RPSPRVLVCVPCGSTQVERRAIRESALGAGAREVYLIDEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDEAIINYVRRNFGALIGDATAERIKHEI
FT                   GSAFPGEELKEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLMGIVSAVMVALEQSPPE
FT                   LASDISERGMVLTGGGALLKDIDRLLLEETGIPVIIADDPLTCVARGGGKALEMIDMHG
FT                   GDLFSYE"
FT   gene            400222..401079
FT                   /gene="mreC"
FT                   /locus_tag="IL0382"
FT   CDS_pept        400222..401079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="IL0382"
FT                   /product="Rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81225"
FT                   /db_xref="GOA:Q5QWE4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE4"
FT                   /protein_id="AAV81225.1"
FT                   /translation="MKTLFARGPSLLSRLVLALACSFLLIFIDHRLQAMKPVRLFLNSL
FT                   VAPVQYLAILPEQLLDGVSESLKTTSQLSDENKRLKRAILELQGEQQQLRFLQNENKRL
FT                   RELLGSDARDSVRRMVAEVIAVASEPFSQQLVINKGTLSGVYEGQPVLDSNGIIGQVQD
FT                   VGGNTARVLLLSDQSHAISLRSERNDIRVLAQGTGDIGRLELMFIPHSTELKEGDLLMS
FT                   SGLGGIFPEGYPVATIRQIVRDESLPFAKVIADPVSALDRVRNVLLLWPSDGEQQPIFD
FT                   EDEE"
FT   gene            401076..401561
FT                   /gene="mreD"
FT                   /locus_tag="IL0383"
FT   CDS_pept        401076..401561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="IL0383"
FT                   /product="Rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81226"
FT                   /db_xref="GOA:Q5QWE3"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWE3"
FT                   /protein_id="AAV81226.1"
FT                   /translation="MIVIKPGFITLLITYIIALTLMVMPMPAAFDTFRPDWPTLVMLYW
FT                   IIALPHRVNMGTALVLGVLSDILLGSIVGVHALGMVVVTYFAARHFQRIRNFALIQQAL
FT                   VIAVLIFIKRFVVFEANVFLHDAEFTFSYFWPVLTSAVFWLWVFPLLRKVRRQFGVV"
FT   gene            401561..402157
FT                   /gene="maf_1"
FT                   /locus_tag="IL0384"
FT   CDS_pept        401561..402157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf_1"
FT                   /locus_tag="IL0384"
FT                   /product="Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81227"
FT                   /db_xref="GOA:Q5QWE2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWE2"
FT                   /protein_id="AAV81227.1"
FT                   /translation="MRLLLASSSPRRRELLTLLHRPFDCEVPEVEELRGANENAGDYVT
FT                   RLAEEKAQTVAQRQQTPCLVIGSDTLISFKGQVLEKPESYEHFSQMMKQLSGQTHQVLT
FT                   SVSVCQWNGHKVVARETALVTTQVEFAALSQGEIDAYWATGEPHDKAAGYGIQGYGGKF
FT                   VKRIEGSYFAVVGLPLYETEQLLRMFEMTGEVDER"
FT   gene            402147..403616
FT                   /gene="cafA"
FT                   /locus_tag="IL0385"
FT   CDS_pept        402147..403616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="IL0385"
FT                   /product="RNase G"
FT                   /db_xref="EnsemblGenomes-Gn:IL0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81228"
FT                   /db_xref="GOA:Q5R0H8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H8"
FT                   /protein_id="AAV81228.1"
FT                   /translation="MSVEVLMNVTPTETRVVLVENGILQEVHIERQAKRGLVGNIYMGK
FT                   VSRVLPGMQAAFIDIGLDKAAFLHASDIVVQVDGDDLPRPDEKPQQSITELVHQGQHIM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPKSDHVGVSQRIEEGEERERLRQLAEEVSK
FT                   SDGKFIVRTAAEGASDQSLRGDADFLFRLWEKIKARKKSQRKVGMLYEDLNLSCRVLRD
FT                   FVGEEIERIRVDSKVTFDTLKVFTQDFIPELTKVLEYYTGDRPIFDLFDVENEMQRALD
FT                   RRVDLKSGGSLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNIEATQSIARQLRLRNL
FT                   GGIIIIDFIDMQDEEHKRRVLHSLEQALGKDRAKTTINGFTSLGLVEMTRKRTRESLEH
FT                   VLCSECPVCLGRGSMKTVETVCYEIMREIVRVHKAYEADKFVVYASAQVSEALLNEESH
FT                   ALAELELFVSRQIKIQTEPLYNQEQFDVVMM"
FT   gene            403622..407491
FT                   /locus_tag="IL0386"
FT   CDS_pept        403622..407491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0386"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81229"
FT                   /db_xref="GOA:Q5R0H7"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H7"
FT                   /protein_id="AAV81229.1"
FT                   /translation="MRTLSWILNKLWLTLAIVLVLVAVGLSLLRYSLPYLPDLTEPLEQ
FT                   QLEARFQQPVSISDLSMAWTREGPSIVLDNLVLLEREQSPVQVRVGKVHVVLDFWRTLL
FT                   DQQLIAQQFILNDARIAVDIRKFSAANEAEKLDLDYVNRLFLQQLEKFSLNNGELLLTN
FT                   LRGVTREIDIDRLSWTNEGKKHQGIGQFRMEDFATNSLDFIIDLRGDRWSEFNGQFYVN
FT                   SQNVDISPWLEEQLGDIDVQASNVNFTGWLDVRNGQLFEGLVKLRDNRITWLDNNSEEL
FT                   NWLQLPEGEIVLRPEENGWLLNSMPMTVNTSVGHLELPRIAWQKLDEIHDISVDNIAID
FT                   EVTGLLPLLPFNISAESVMSLGLKGKASVRYRLHPVSGQQWSVKSHNLSADGNERWPGF
FT                   NGLDVSISSLSNHGLWQVEGDNVSLTGNSLSGKQAWDIDTFNLSGSWLLQADNWRVNLE
FT                   QLQLRRDDFQLTGSGGLSGDSETTPQIDLLLSTAQGFSVDTARKLLPSIMGQGVKDYLS
FT                   AALVSGRARGMELLWRGPVTQFPAATNQGVFNARVEFDDLTYRFQPDWLPLADAPVKLD
FT                   FYNRSLFMSTDAGHIEDVQVTRVDAQIKDLADASQGLQVQASVSGKGESLLPVFEQSPL
FT                   DSVTETLIQIDPSGEVSGSFQLDIPLNSSRDVDVAVDAPLAGLSFNIDAIQQDFTVSEG
FT                   ILKIDNSKVSTEGLRLNWYGMPIPTKVSGELKGADYLLNVNTTLDWQSEPLFKQLPYPQ
FT                   WKPFFYGAVNGEANLLLTFNADDVGVALESQFDLTGLETSLPAPLQKDFGDNWQLSVQL
FT                   NGTGEELRLRASIDQRLNWDSRWQPGSGGWQMARLDIGEVNSANELVNGFAINAQLPHA
FT                   DIGRWYSVLYALAGDSNVDTESGSGEGWLPDSIRIETPQLQWGQQKFAQADIQVWPENS
FT                   VWQARVDAKNAVLSATIPESFVQQGITVRADYLALSSNVELPEATEKTDWNWLEKVPAL
FT                   NFFCRSCRIDEHELGEVELVLAPLEDGFSIEKMALKKGSDELAVTGYWRYTDEQALSAL
FT                   SGRLEAGDLGDLLRDYGLETAVRDSAAVIDFNLNWRDHLYQPDWSSLSGEVVWDLEKGY
FT                   LAEVSDGGARIFSLLSLDSILRKLTLDFRDIFSQGMFFTDLTGSVQIENGVATTEDARL
FT                   LGSAGDMDIRGWTNMKTGELNYNLTYAPKVTSSLPIILAWMVNPPSGLAALFIDKVLHD
FT                   AKVISRLRYQVTGTIDEPVVEEIERDSRPVDLPELEENSTDSEADDDTSATDGAANEQS
FT                   PGSAR"
FT   gene            407463..408260
FT                   /locus_tag="IL0387"
FT   CDS_pept        407463..408260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0387"
FT                   /product="Predicted amidohydrolase, nitrilase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81230"
FT                   /db_xref="GOA:Q5R0H6"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H6"
FT                   /protein_id="AAV81230.1"
FT                   /translation="MSSRPDPQDNLAIVAKLLEQLPAARPQLVVLPEAFSCFGAGDRAQ
FT                   LAMAEPYKDGEVQKQLAALAKKHEVYLVGGTLPVDAGERFSAASILFGPDGAILNRYDK
FT                   IHLFDVDVADNTKEYRESKWTQPGSKVVTTETDFGVVGMAVCYDLRFPELFRALRQAGS
FT                   QIIVLPSAFTQVTGKAHWHALVRARAIEQQVFIVAPGQVGEHANGRETFGHSIIVSPWG
FT                   EILAEQELDEGVVSVSVDVADIEPIRKQMPVAQQNQFEVVQKT"
FT   gene            408257..409678
FT                   /gene="tldD"
FT                   /locus_tag="IL0388"
FT   CDS_pept        408257..409678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="IL0388"
FT                   /product="Predicted Zn-dependent protease"
FT                   /note="TldD"
FT                   /db_xref="EnsemblGenomes-Gn:IL0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81231"
FT                   /db_xref="GOA:Q5R0H5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H5"
FT                   /protein_id="AAV81231.1"
FT                   /translation="MTLTDYELSQDDISKALSTLYSGDIDFADIYLQHSVNESWVLEDG
FT                   IIKDGAFHIETGMGVRAVQGEKTGFAYADEITLKALQRTSEAARGIARQGQSKKVEALK
FT                   SVQAKSRYEALNPLDTLSEEEKIELLKKVDAHARAQDSRVSQVVVSLSGSYDEVLVAAT
FT                   DGTLATDKRPLIRLNCSVITEQNGRRERGSAGGGARVGYEFFLDEASGNARWQRFAEEA
FT                   VRQGLVNLEAKPAPAGNMPVVLGSGWPGVLLHEAVGHGLEGDFNRKGSSAYSGKIGQQV
FT                   ASPLCTIVDDGTLNDRRGSMSIDDEGTPSGYNVLIENGVLRGYMQDKMNARLMGQATTG
FT                   NGRRESFAHLPMPRMTNTYMLAGESSPGDIIGSVKKGIYAPQFAGGQVDITSGQFVFSA
FT                   SEAYLIEDGKITTPIKGATLIGNGPEAMAQVSMVGNDLSLDEGVGVCGKDGQSLPVGVG
FT                   QPTLKLDSMTVGGTE"
FT   gene            complement(409694..410209)
FT                   /locus_tag="IL0389"
FT   CDS_pept        complement(409694..410209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0389"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81232"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0H4"
FT                   /protein_id="AAV81232.1"
FT                   /translation="MPKRPAENPEQSDDFVSKSQKKREMAERQELGTQLVNLTDSQLAK
FT                   MPLDDELRDAVLLARKIRNKHEGYRRQLQFIGKLMRLRDIAPIEQALNNLKNAHQQQTS
FT                   IFHEIETTRDKLLHEGDDALQEFIEEHPHADRQKLRQLIRLAEKQRAEQKPPVAARQLF
FT                   VYLRELLG"
FT   gene            410264..411610
FT                   /gene="pmbA"
FT                   /locus_tag="IL0390"
FT   CDS_pept        410264..411610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="IL0390"
FT                   /product="Predicted inactivated Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81233"
FT                   /db_xref="GOA:Q5R0H3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H3"
FT                   /protein_id="AAV81233.1"
FT                   /translation="MIVQLSDLQVQMKQVESAVKEALRLAEAKGVSSAECSISHSSGIS
FT                   VGTRLGEVETVEFNQDGALGISVYRGNQKGSASTTDLSEQAISAAVDKACDIARFTSPD
FT                   PYNGLAPAELMATDVPDLDLCHPGDQSAEYAIKQALACEKHALNLDERIVNSDGAHYGS
FT                   HTGFRVYGNSHGFIGGYLQSRHNLSCVLIAKEGDKMQRDMSYSVARKMHELKSAESVAE
FT                   EAAAETLSRLGARKVPTAKVPVIFRADVAGSLFGHMVSAISGGNLYRKSSFLLDHLGKP
FT                   VLPEWLSIQEKPHIIGGLASSPFDAEGLATKDREIITDGVLQTYLLTSYAARKLDMQPT
FT                   GHAGGIHNWRVTQQDNSLAQLCKKMGTGLLVTELMGQGVNMVNGDYSRGAAGFWVENGE
FT                   IQYPVEEVTIAGNLKDMLANIVAIGNDTDERHALHTGSVLLEQMSIAGN"
FT   gene            complement(411623..412984)
FT                   /locus_tag="IL0391"
FT   CDS_pept        complement(411623..412984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0391"
FT                   /product="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81234"
FT                   /db_xref="GOA:Q5R0I4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I4"
FT                   /protein_id="AAV81234.1"
FT                   /translation="MIAELSDKEYAMQRIQEVNSALSDGMFVAARRMLHNMPACDVALL
FT                   LESSPPKSRSIVWKLVDVDEHGEILEELNEEVQKDIIRQMAPENLAAATEGMDTDDLAY
FT                   VLRGLPEPVYQQVLKSMDESDRERAETALSYAEDSAGGIMNTDTITLRSDVTIDVVLRY
FT                   LRLKGELPEATDKLYVVDRHEKLIGEITLTQLLTIDPSRRIDEIMSADITTIPVTMDET
FT                   EVAKLFERHDWVSAPVVDNEQQLVGRITIDDVVDIIREEAQHSMLSMAGLEDDEDTFAP
FT                   VLKSTRRRTVWLAVNLVTALLAAMVSSLFEDILAQMAVLAILNTIVPSMGGIAGSQTLT
FT                   LVIRGMALGHIGTSNSRWLIGKELAIGFLNGIIWSVLIAAVVALWKQDWLVGGIIAFAM
FT                   MMNLVAAALAGATIPLVLKRFNIDPALAGGVILTTVTDVVGIFAFLGSATLLLS"
FT   gene            complement(412987..413262)
FT                   /gene="ptsO"
FT                   /locus_tag="IL0392"
FT   CDS_pept        complement(412987..413262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="IL0392"
FT                   /product="Phosphotransferase system, HPr-related protein
FT                   NPr"
FT                   /db_xref="EnsemblGenomes-Gn:IL0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81235"
FT                   /db_xref="GOA:Q5R0I3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I3"
FT                   /protein_id="AAV81235.1"
FT                   /translation="MDKVCRKLIIRNKLGLHARAATKLAQLTQEFESDITVTQGEQCVN
FT                   AASVMCLMLLASQQGKTVEVCAEGKDAQAALDAVSALFEDRFEEDE"
FT   gene            complement(413255..414106)
FT                   /locus_tag="IL0393"
FT   CDS_pept        complement(413255..414106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0393"
FT                   /product="Predicted P-loop-containing kinase"
FT                   /note="probably involved in sugar uptake"
FT                   /db_xref="EnsemblGenomes-Gn:IL0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81236"
FT                   /db_xref="GOA:Q5R0I2"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0I2"
FT                   /protein_id="AAV81236.1"
FT                   /translation="MQLIIVSGRSGSGKTIALRVLEDLGFYCVDNLPISLLPTLVHAVI
FT                   EQYQKIAISIDVRNLPEHSEELLDSLSFLPKGVEPEILFIDSDDNTLLKRFGETRRLHP
FT                   LSQKELPLLEALQAEHKMLEPIMERATWRLDSSDLSLHQLSEQVTERVLGRADKKLIIV
FT                   FQSFGFKYGLPKDADFVFDARILPNPHWQPELKLLTGLDTDVQIFFRQEPLVTKFIYQL
FT                   ENFLDTWLPHFQRSNRSYLTIATGCTGGQHRSVYISQQLAERFEQKAVKVQVRHRELKT
FT                   HG"
FT   gene            complement(414097..414567)
FT                   /gene="ptsN"
FT                   /locus_tag="IL0394"
FT   CDS_pept        complement(414097..414567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="IL0394"
FT                   /product="Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81237"
FT                   /db_xref="GOA:Q5R0I1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I1"
FT                   /protein_id="AAV81237.1"
FT                   /translation="MQLSELLSPDCTKCAVEGASKKRLLETISQIVAPKLSGITRHDIF
FT                   ESLLNRERLGSTGIGLGIAIPHGRLPNANHPVAVLLTLDEPIEFDSIDNQPVDIIFALL
FT                   VPESEHENHLQTLATVARRMNDKDCTRALRHADSDKALYQLFVGEGEQSPCN"
FT   gene            complement(414571..414858)
FT                   /locus_tag="IL0395"
FT   CDS_pept        complement(414571..414858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0395"
FT                   /product="Sigma-54 modulation protein"
FT                   /note="S30EA ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81238"
FT                   /db_xref="GOA:Q5R0I0"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I0"
FT                   /protein_id="AAV81238.1"
FT                   /translation="MQINLTGHHIDITEALRDYVDTKFAKLERHFDHITNVHVILNVEK
FT                   TIQKAEATLHVNGGELFADAKHEDMYAAIDGLINKLDRQVIKHKEKMKQH"
FT   gene            complement(414886..416346)
FT                   /gene="rpoN"
FT                   /locus_tag="IL0396"
FT   CDS_pept        complement(414886..416346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="IL0396"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   54/60 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81239"
FT                   /db_xref="GOA:Q5R0H9"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0H9"
FT                   /protein_id="AAV81239.1"
FT                   /translation="MKQSLQLKIGQHLTMTPQLQQAIRLLQLSSLDLQSEIQDALDSNP
FT                   LLEVEGETSNDADQPETRNIEERDDSQRETSDVIKTQEMPDELPVDSSWDDTYSSHTPA
FT                   NGAASSGKSFDGDFEVYQGSTSESLQDHLLWQMQLSHFSEEDTAIAEAIIEAIDDNGYL
FT                   MVDVNEIIEAVRLPEVEVEEVCMVLKRIQHFDPIGVGARSVSECLAIQLRQLSDDTEYK
FT                   QVALCLVTEHMDLLGSRDFRTIQRKLKLSEDDLRQTMRLIQQLHPHPGEQVAQQPVEYV
FT                   IPDVAVTKKNGRWMVELNPDSVPKLKVNEEYAALSKATKSVADSQYIKNHTQEARWFIK
FT                   SLESRNDTLLKVANCIVQRQQGFFEHGEEAMKPMVLNDVAEAVDMHESTISRVTTQKYL
FT                   HCPSGVFELKYFFSSHVSTEGGGECSSTAIRALIKKMVAAENRSKPLSDSKIAELIAEQ
FT                   GIQVARRTIAKYRESLNIPSSSQRKSLL"
FT   gene            complement(416368..417093)
FT                   /gene="yhbG"
FT                   /locus_tag="IL0397"
FT   CDS_pept        complement(416368..417093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbG"
FT                   /locus_tag="IL0397"
FT                   /product="Unclassified ABC-type transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81240"
FT                   /db_xref="GOA:Q5R0J1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J1"
FT                   /protein_id="AAV81240.1"
FT                   /translation="MATLRVKHLAKSYKSRQVVKDVSLEVSQGQVIGLLGPNGAGKTTT
FT                   FYMIVGLVNSDKGQILLDDNDLTLLPMHERARRGIGYLPQEASIFRKLTVRDNLMAILE
FT                   TRKELSTNEREEQLDALLEEFHIGHIANSQGMSLSGGERRRVEIARALAAEPTFILLDE
FT                   PFAGVDPISVIDIKKIVEHLKQRGIGVLITDHNVRETLSVCEHAYIVSHGELIASGDAE
FT                   SILSNQQVRDVYLGEQFTL"
FT   gene            complement(417095..417637)
FT                   /locus_tag="IL0398"
FT   CDS_pept        complement(417095..417637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0398"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81241"
FT                   /db_xref="GOA:Q5R0J0"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J0"
FT                   /protein_id="AAV81241.1"
FT                   /translation="MLKRFSSLLSKLILVALIPSAVMAQGKSDFSKPMEVESSKEELDI
FT                   KNNRLVLTDNVIIRQGTLLIRADRLEASASESAEQADIFIAEGTPATYSQTLDDGNEIN
FT                   AEAKKITYFQSEQRLELSGDARISQGSSSSSGSLITYDLNKQTVTASSSGEEDSRVITI
FT                   FTPKPKTDTDEKNNENP"
FT   gene            complement(417606..418169)
FT                   /locus_tag="IL0399"
FT   CDS_pept        complement(417606..418169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0399"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81242"
FT                   /db_xref="GOA:Q5R0I9"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I9"
FT                   /protein_id="AAV81242.1"
FT                   /translation="MSRRVTVILILLFGAGLLLVWRPFSDDADGNNAATTRTMQPDFTA
FT                   FGLETRIFESDGLLAHKIKSEKMSHYNQIGLTELKRPVYTVFSEQGEELWEVSAAQGTF
FT                   YDDQTLILEHDVEILALEPDTHIEQVLTEYLIVDLKNESMSTEHPVSIHGPRLLIRGNG
FT                   MTADLKAERMELKRHVKTIFQPAE"
FT   gene            complement(418166..418720)
FT                   /locus_tag="IL0400"
FT   CDS_pept        complement(418166..418720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0400"
FT                   /product="Predicted phosphatase, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81243"
FT                   /db_xref="GOA:Q5R0I8"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I8"
FT                   /protein_id="AAV81243.1"
FT                   /translation="MECINTWYGDIEKSLFKRFSEIKLLVLDVDGVFSDGRIYLGNDGE
FT                   ELKAFHTRDGFGMKALKKSGVETAVITGRTSRIVEHRMEHLDVGFIYQGQNDKTAAFDE
FT                   LLTKLGLSAEQVAYVGDDTPDLALIKAAGLGIAVQDAHASVQQQADYISRCHGGHGAVR
FT                   EVCDLIMLSQGQLHLATGASV"
FT   gene            complement(418720..419697)
FT                   /locus_tag="IL0401"
FT   CDS_pept        complement(418720..419697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0401"
FT                   /product="Predicted sugar phosphate isomerase involved in
FT                   capsule formation"
FT                   /db_xref="EnsemblGenomes-Gn:IL0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81244"
FT                   /db_xref="GOA:Q5R0I7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I7"
FT                   /protein_id="AAV81244.1"
FT                   /translation="MKQVTQNFRLLGEQVLDIEKKAIEGLYQYLDDNFDAACQTLFNCK
FT                   GRVIVTGMGKSGHIGGKIAATLASTGTPAFFVHPGEASHGDLGMVAAQDVVIAISNSGE
FT                   TAEVLNIIPVIKRLGVPLISMTGKPGSTLARLADTHVCIAVEQEACPLGLAPTASTTAT
FT                   LVMGDAMAVALLNARGFTADDFALSHPGGSLGKRLLLRLHDVMHTGERVPVIPADAIIS
FT                   DALLEMSRKGLGMTAIVDENQRLAGIFTDGDLRRILDNRIDVHKTPIAEVMTRSCITAN
FT                   EDMLAAEALKLMQDRKINGLIITNDDGQPCGAMNMHDLLQAGVL"
FT   gene            419854..420429
FT                   /locus_tag="IL0402"
FT   CDS_pept        419854..420429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0402"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81245"
FT                   /db_xref="GOA:Q5R0I6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I6"
FT                   /protein_id="AAV81245.1"
FT                   /translation="MVEKKGAGRPSNRDVILDAADQLVAAEGAGHLTFDALSQTTGISK
FT                   GGLLYHFKSKDCLLQAMLKRRVERYEKLREQYHHQFADDPKGELKSILLAALDTDAECS
FT                   RLGSGMLAAAATNPELLGPLKEHIALTLQRLERIAGSKVGKTLFYAVHGARLFEQLNLC
FT                   DACVHEREDFAQYLLKLVDELTEIESIR"
FT   gene            420514..421314
FT                   /locus_tag="IL0403"
FT   CDS_pept        420514..421314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0403"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81246"
FT                   /db_xref="GOA:Q5R0I5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0I5"
FT                   /protein_id="AAV81246.1"
FT                   /translation="MTNLVELKDLTFAHGSHRVYDGLSLDVPKGKMVAVMGPSGIGKTT
FT                   LLRLIGGQLKPDSGSIKVAGEEVPQLKRDALYQLRKRMSMLFQSGALFTDMSVYENVAF
FT                   PLREHTDLPEEIIRSVVLMKLEAVGLRGARHLMPSELSGGMARRAALARAIALDPELIL
FT                   YDEPFAGQDPISMAVIVKLIKSLNESLGLTSIVVSHDVKEVLSIADYAYVIADKKVVGK
FT                   GTPDELRNNETAIIKQFLNGAPDGPVAFHYSDDDFTTDLLRGKE"
FT   gene            421311..422090
FT                   /locus_tag="IL0404"
FT   CDS_pept        421311..422090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0404"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81247"
FT                   /db_xref="GOA:Q5R0K0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K0"
FT                   /protein_id="AAV81247.1"
FT                   /translation="MIQFIRSVGRQVLDSLAGIGYALAMLMGAIIGKPQPAKSWPLFIK
FT                   QMYVVGVLSMLIVIVSGLFIGMVLGLQGYTILVDYGAEQSLGPMVALSLLRELGPVVTG
FT                   LLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVVSMPLLALMFSA
FT                   VGIYGGYLVGSGWLGVDEGAFWSVMQSAVDWQDDLLNGIIKSIVFAFVVTWIALYKGYR
FT                   SVPTSAGISAATTSTVVTASLAILGLDFILTAIMFGG"
FT   gene            422093..422560
FT                   /locus_tag="IL0405"
FT   CDS_pept        422093..422560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0405"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81248"
FT                   /db_xref="GOA:Q5R0J9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J9"
FT                   /protein_id="AAV81248.1"
FT                   /translation="MESRKTQLWVGVFVVVGILALFFIALRAASGTMTTSGDSYTLYAK
FT                   FDNIGSLKVRSPVKVGGVVVGRVTDISLSGDYYEPRVTMSISKDYDKFSEASTLSVLTS
FT                   GLLGEQYLGLEPGFIDDSVGTLDDGDTITDTKSALVLENLIGQFLFSQGNE"
FT   gene            422578..423249
FT                   /locus_tag="IL0406"
FT   CDS_pept        422578..423249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0406"
FT                   /product="ABC-type transport system involved in resistance
FT                   to organic solvents, auxiliary component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81249"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J8"
FT                   /protein_id="AAV81249.1"
FT                   /translation="MAVKQWITAVFVTLVLVASASADLIRNDDPQELLKAVAEKTFDRI
FT                   ASDRNKIDADPNYLKEVVEDEMMPYVDNMYASKKVLGRYLRDTTKEQRERFYQAFYDYL
FT                   VATYARAFTQYDEDKHKVTFEPSQEISDDARSAVVKARIKEEGRPEIRLDFRIRYDSDE
FT                   EIWKAYDLVVEGVSLLNSKQSEISSVIRANGIDKTIELIEKKASEPIKADDEVESPAEG
FT                   L"
FT   gene            423249..423542
FT                   /locus_tag="IL0407"
FT   CDS_pept        423249..423542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0407"
FT                   /product="STAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81250"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J7"
FT                   /protein_id="AAV81250.1"
FT                   /translation="MLASVKVSDDKTLVFSGSLTRHSVAKLWSQRKSWSVGSETRVDLT
FT                   DVEVIDTAGVAFLLEILKLVGDGKGPLTCIGASEQLKQIARVSGVESLLSLS"
FT   gene            423580..423834
FT                   /locus_tag="IL0408"
FT   CDS_pept        423580..423834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0408"
FT                   /product="Predicted transcriptional regulator, BolA
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81251"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J6"
FT                   /protein_id="AAV81251.1"
FT                   /translation="MNTEELKTLLNDALSLEELLVKAEGANVEIIAVSEDFKDMSRVKR
FT                   QQAVYGPLNPLIADGSIHAVSIKAYTPEDWARDKKLMMP"
FT   gene            423851..425110
FT                   /gene="murA"
FT                   /locus_tag="IL0409"
FT   CDS_pept        423851..425110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="IL0409"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81252"
FT                   /db_xref="GOA:Q5R0J5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0J5"
FT                   /protein_id="AAV81252.1"
FT                   /translation="MDKFKIRGGQPLSGSVTISGAKNAALPILMASLLPSEKITLSNVP
FT                   DLHDVDTTLELLDCLGISHSNLNNNSVCIDPTTLNHFKAPYDLVKTMRASILVLGPLLA
FT                   KTGKAEVSLPGGCAIGARPVNLHIEGLRKMGAHIDVENGYIKASVEGRLQGAEILLDTV
FT                   SVTGTENLMMAAVLAEGETVIENAAREPEVIDLANFLNSLGANVRDAGSDTIHITGVNK
FT                   LHGGEYSVMPDRIETGTFLVAALATGGSVRCEKTDPASLDAVLKKLEEAGATIDKGDNW
FT                   IAIQSHGRPKAVNIITAPHPAFPTDMQAQFCALNAIAEGTAGIRETIFENRFMHIPELR
FT                   RMGANVESEGNTALCHGVDELTGAEVMCTDLRASASLVIAGLVATGETVVERIYHIDRG
FT                   YEGIEKKLQGLGADIERVTA"
FT   gene            complement(425117..426166)
FT                   /gene="degS"
FT                   /locus_tag="IL0410"
FT   CDS_pept        complement(425117..426166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="IL0410"
FT                   /product="Periplasmic trypsin-like serine protease"
FT                   /note="contains C-terminal PDZ domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81253"
FT                   /db_xref="GOA:Q5R0J4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J4"
FT                   /protein_id="AAV81253.1"
FT                   /translation="MQQLSSTLRFLLQSVGLGLVVAAIVIIAKPFWAQSESLRQNGNEI
FT                   TSFNQAVRKAAPAVVNIYSMGEIQGSYYQPQSSRVWRLGSGVIMDSQGYILTAHHVVDN
FT                   VDKIEVALQDGRRYAAQLIGSDRYTDLAVLKIDAENLPVIPVQSTRRVRVGDIVLAIGN
FT                   PYNIGQTITQGIVSASGGRVGVSNSYSDLIQMDAVINQGASGGALVNTAGELIGINNAR
FT                   YNSAFGDGGEGIYFAVPYENARKVMKTLIQEGKVVRGYIGISVNPNFSEEQSLSGILIT
FT                   GVERNSPAAKAGLQPNDFLVAIGGDPVRSAPEGLDRVAGSEPGTKLEVEFYRNEKRMTT
FT                   TVTVAELPR"
FT   gene            complement(426230..427585)
FT                   /gene="degQ"
FT                   /locus_tag="IL0411"
FT   CDS_pept        complement(426230..427585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degQ"
FT                   /locus_tag="IL0411"
FT                   /product="Periplasmic trypsin-like serine protease"
FT                   /note="contains two C-terminal PDZ domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81254"
FT                   /db_xref="GOA:Q5R0J3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J3"
FT                   /protein_id="AAV81254.1"
FT                   /translation="MKRVLALFSLICVVSFTSIPSAHAGIPFFGNDDEQPTLAPMLEEV
FT                   TPAVVNISVKGKREVRQRLPEALRFFFGPDSPREQVRERPFRGLGSGVIIDAEKGYVVT
FT                   NNHVVDDATEILVTLKNGREFDAKVIGTDERSDVALLKIENGENLTAIELGKSSELRVG
FT                   DFVVAIGNPFGLGQTVTSGIVSALGRAGLGIEELENFIQTDAAINSGNSGGALVTLDGK
FT                   LIGINTAILGPNGGNIGIGFAIPSDMMNNLVQQLIEFGEVRRGVLGVRGNDLTHDVAQA
FT                   LNIPVNRGAFVSQVVPGSSADEAGIESGDVIISVDGQTIRSFSELGAMVGSIGSGNSLK
FT                   LGVIRDGEEQSINVTLGAQDMSVTAESIHPALQGATLAATDGNGIEVEELEERSPAARI
FT                   GLEEGDIIQGVNRKAVSSISELRAAIEDKSGVIALNIKRGDSSLFIVLRNAN"
FT   gene            complement(427673..428134)
FT                   /locus_tag="IL0412"
FT   CDS_pept        complement(427673..428134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0412"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81255"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0J2"
FT                   /protein_id="AAV81255.1"
FT                   /translation="MSWIIGVLLVVAGAIIGFFAARYSQSKGQSGDLEEQVQQSQQRLT
FT                   DYQREVAEHFATANAMVEQLADTQQRLQSYLNQSAELLEKSDVQSDLPFFAEDTIKQLR
FT                   VANSLNKDHRSGRDSYSANDIPRDYTEGSSGLFSSSYEQDQEKESSKTS"
FT   gene            428239..429348
FT                   /locus_tag="IL0413"
FT   CDS_pept        428239..429348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0413"
FT                   /product="Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81256"
FT                   /db_xref="GOA:Q5R0K7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K7"
FT                   /protein_id="AAV81256.1"
FT                   /translation="MSKQQMSPLERYQYDIEHNDFSKDAAQLNAVKHLQRLHDELIEWH
FT                   QYQTLPGWQKWFNKEPDQPQGIYFWGGVGRGKTYLVDTFFESLPIERKWRIHFHRFMHR
FT                   VHNELKQLDKQSDPLRIVADNIAAEARVVCFDEFFVQDITDAMLLGRLFEYLFEKGVVL
FT                   VATSNIVPDELYKNGLQRARFIPAIKLINQHCEVVNVDSGIDYRLRTLTRAEIFHSPLD
FT                   EKADKNLWKYFKELAPECKERYESDCIEIEGRDIDVRAECDDVVFFDFTSICKTARSQN
FT                   DYMEIARLYHAVLISNVEQMGAGKDDTARRFIALVDEFYERRVKLILSADVGIEALYTE
FT                   GQLTFEFRRCVSRLQEMQSQEYLAMAHKA"
FT   gene            429546..429974
FT                   /gene="rplM"
FT                   /locus_tag="IL0414"
FT   CDS_pept        429546..429974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="IL0414"
FT                   /product="Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:IL0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81257"
FT                   /db_xref="GOA:Q5R0K6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0K6"
FT                   /protein_id="AAV81257.1"
FT                   /translation="MKTFVAKPETVKRDWYVVDAEGKTLGRLATEIARRLRGKHKPEYT
FT                   PHVDTGDYIVVINAEKVAVTGNKAQGKMYYSHTGFPGGIKSISFEKLIAKKPEMVIQKA
FT                   VKGMLPRGPLGRAMFRKLKVYAGTEHNHIAQQPKQLDI"
FT   gene            429992..430384
FT                   /gene="rpsI"
FT                   /locus_tag="IL0415"
FT   CDS_pept        429992..430384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="IL0415"
FT                   /product="Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:IL0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81258"
FT                   /db_xref="GOA:Q5R0K5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0K5"
FT                   /protein_id="AAV81258.1"
FT                   /translation="MADNQYYGTGRRKNSTARVFLRPGSGNIKINNRELNEYFGRETAQ
FT                   MVVRQPLELVEMTEKFDMYITVSGGGTTGQAGAIRHGITRALMQYDEALRGPLRKEGYV
FT                   TRDARQVERKKIGLHKARKRPQFSKR"
FT   gene            430610..431200
FT                   /locus_tag="IL0416"
FT   CDS_pept        430610..431200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0416"
FT                   /product="Ubiquinol-cytochrome C reductase iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81259"
FT                   /db_xref="GOA:Q5R0K4"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K4"
FT                   /protein_id="AAV81259.1"
FT                   /translation="MSNAPVDKGRRRFLTVATSVVGGAGAVAVAVPFIASWNPSAKAKN
FT                   AGAPVEVNIRKAEPGQLVRVKWRGKPVWVVRRTPDMLEELGEIEGRLRDPNSQEPQQPP
FT                   YAANQYRSIKEEFFVAVGICTHLGCSPSYLASGMGEHVEGVESGFFCPCHGSKFDVAGR
FT                   VFQGVPAPLNLVVPPHYFIDDNTILVGEDKGQA"
FT   gene            431200..432468
FT                   /locus_tag="IL0417"
FT   CDS_pept        431200..432468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0417"
FT                   /product="Cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:IL0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81260"
FT                   /db_xref="GOA:Q5R0K3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K3"
FT                   /protein_id="AAV81260.1"
FT                   /translation="MFKRFVEWMDARIPMTKTWNIHLAQYPAPKNFNMWYVFGFLATIV
FT                   LINQILTGVWLTMNYVPSADGAFASVEYIMRDVEYGWLLRYMHSTGASAFFVVVYLHMF
FT                   RGMMYGSYQKPRELIWLFGMFIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVI
FT                   GDDLTLWIRGDYVISGATLNRFFALHVIALPLVLVILVFLHIVALHEVGSNNPDGIDTK
FT                   KPKGSVPDEDKPKFKFHERFTNKKDIVDSIPFFPYYIIKDLFGFGVFLFLFCYVIFFNP
FT                   EMGGFFLEPPNFEPANPLKTPEHIAPVWYFTPFYAILRAVPDKLFGVILMFAAIVFLAL
FT                   LPWLDRGRVRSIRYRSLLHKLNLGVFAISFVVLGYLGTQPATPVATIFAQIFTFLYFAF
FT                   FGLLWFYSKREKTKPVPERVTSK"
FT   gene            432465..433199
FT                   /locus_tag="IL0418"
FT   CDS_pept        432465..433199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0418"
FT                   /product="Cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:IL0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81261"
FT                   /db_xref="GOA:Q5R0K2"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K2"
FT                   /protein_id="AAV81261.1"
FT                   /translation="MKKLLIALITLVPSLVFAAGPEVPLDKAEVDLHDKASLQRGAQLY
FT                   MNYCLGCHQLQYHRYNRTFEDLGIPQELGEKNLQFTGDKAGDRITNNMNPESAANWFGT
FT                   AVPDLTNVARVRGADWIYTYLRSFYKDDSRPFGVNNAVFPNVGMPHVLQELQGLPEKTY
FT                   EERLIDGEMEDVYVGIETDGGGRLSESEYDQAMLDLTAFLVYTGEPMLLEQRRIGWFVF
FT                   GFLLVFTILAWLLKKEFWKDLK"
FT   gene            433284..433907
FT                   /gene="sspA"
FT                   /locus_tag="IL0419"
FT   CDS_pept        433284..433907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="IL0419"
FT                   /product="Glutathione S-transferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81262"
FT                   /db_xref="GOA:Q5R0K1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="PDB:4DEJ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K1"
FT                   /protein_id="AAV81262.1"
FT                   /translation="MAVAANKRSVMTLYSGKDDLKSHQVRLVLAEKGVGVEITYVTDES
FT                   TPEDLLQLNPYPEAKPTLVDRELVLYNAQIIMEYLDERFPHPPLMPVYPVARGTSRLMM
FT                   YRIERDWYSLAEKIQKNDAQARQELKEGILSLAPIFADTPYFMSEEFSLVDCYLAPLLW
FT                   RLPAYGIDLEGQGAKEIKQYMVRLFERKTFQDSLTEEEKELARN"
FT   gene            433934..434344
FT                   /gene="sspB"
FT                   /locus_tag="IL0420"
FT   CDS_pept        433934..434344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="IL0420"
FT                   /product="Stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:IL0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81263"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L3"
FT                   /protein_id="AAV81263.1"
FT                   /translation="MTPKRPYLLRALYEWIVDNDLTPHLVVDATIVGTVVPQNFVSEGQ
FT                   IVLNISPTAVQGLQLAHHEVRFNARFGGQPMQVIVPMTAALAIYARENGAGAMFEAEPE
FT                   LDKMPELDEEDKGSDDAEQKSAKKKPNLKVVK"
FT   gene            complement(434357..434932)
FT                   /locus_tag="IL0421"
FT   CDS_pept        complement(434357..434932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0421"
FT                   /product="Secreted protein"
FT                   /note="similar to OsmY"
FT                   /db_xref="EnsemblGenomes-Gn:IL0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81264"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L2"
FT                   /protein_id="AAV81264.1"
FT                   /translation="MTLSRTFLPVIFISLLSLQGCAAVAVGAAAVGISSATDPRTIGTQ
FT                   VDDQTIELKANAKLGNDEQLEDARVVAISYDTNVLLVGQVPSEALKRRAEETIKDTNGI
FT                   NKIFNQLRIGSKASAAVRAGDSWITSKIKLKFANNKSIDATNIKVVTENAEVFLLGHVS
FT                   QIEADTAVEVARNVDGVERVIKALTIKR"
FT   gene            complement(434938..435480)
FT                   /locus_tag="IL0422"
FT   CDS_pept        complement(434938..435480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0422"
FT                   /product="Phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81265"
FT                   /db_xref="GOA:Q5R0L1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L1"
FT                   /protein_id="AAV81265.1"
FT                   /translation="MNDELIKALFTESIQTQISAVESLTDEMATTVELLVANLLNGQRV
FT                   FCCGDRTTGIVAQHFANLMTEGMKLERPPFPVLALALGKQKQLAALGQAGDILLVIADN
FT                   QENEELASVMETAISRDMLIIALTGEGNDSVSGLLGANDIELRAPSLNPARILETQLFI
FT                   VHGLCEQIENTIFPQEH"
FT   gene            complement(435483..435833)
FT                   /locus_tag="IL0423"
FT   CDS_pept        complement(435483..435833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0423"
FT                   /product="Predicted endonuclease"
FT                   /note="similar to archaeal Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81266"
FT                   /db_xref="GOA:Q5R0L0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0L0"
FT                   /protein_id="AAV81266.1"
FT                   /translation="MQEVVTGKRAELLSAEFLKKNNLTIICKNYRIDGGEVDIIARDGH
FT                   YWVFCEVKFRDDESFAAVIEQIQPQQCRRIRYTARHYLLSNNIDEHTAAIRFDVIAIVG
FT                   QPTKIEWFKDAF"
FT   gene            complement(435811..437694)
FT                   /gene="lppC"
FT                   /locus_tag="IL0424"
FT   CDS_pept        complement(435811..437694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lppC"
FT                   /locus_tag="IL0424"
FT                   /product="Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81267"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K9"
FT                   /protein_id="AAV81267.1"
FT                   /translation="MFRTHSFVLLALMALLVLTQCTSAPDRSTKDPAEAVDVADQELSL
FT                   TEEKSAGDWLQEADAAANEVEQHSALIRAANAFQNEHQWQQAAAILSQLAPKKITHHSQ
FT                   KYYRLAKARWAAEQKVWAKVIEELEDVATQFNQREFRVLSLQLLSQAAYQQQDYWQSLV
FT                   WQVDAQRFAEQRNTDTVWSIARRIKQSELPQQRPNDLALAGWWRLVDYHHQAMTHPDSL
FT                   TSFLNQWQQSFPNHDAATLVDIWLEPPLKPSESELEAEQAPPEPTLAVLLPLSGRYKQQ
FT                   GQAVRDGVIARTGEMKNLRVVFIDSEASDIESQQKQISELSPVGIIGPLLKDKVAAWSA
FT                   QPITGIPQVYLNQIDDEAAQNSLTNVFFALSPESEAQQAAQKINQQFPSSKSALVITAD
FT                   GSSGRRMVDAFTSSWENEQAEQPTISYFSEREDMKTTVERSLGLTDSQQRIRAVKIAAG
FT                   KIIVDEQERSRRDISAIYLPGNLQQTRLLKPFIDVSVSPFAEPIPVYASSATHELRNRL
FT                   GDSDLNGIIFSDVPWLIESSGKNILLSQWLELRNGWGLSLARLTAMGYDSVSLIQRLEM
FT                   MNRMPGLVWSGLSGELHIDNSVVQRKLIWATFSKGEITLAKEADNAGSRYR"
FT   gene            437770..438624
FT                   /locus_tag="IL0425"
FT   CDS_pept        437770..438624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0425"
FT                   /product="Tetrapyrrole methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81268"
FT                   /db_xref="GOA:Q5R0K8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0K8"
FT                   /protein_id="AAV81268.1"
FT                   /translation="MAEQGILYIVPTPIGNLGDITERAVKTLAEVAAIAAEDTRHTRKL
FT                   MQHYGIQNDVFALHEHNETQRVDAVIERLLQGDSLALVSDAGTPLINDPGYVLVHRCRE
FT                   RGLKVIALPGACAVTVALSAAGLPTDRFAFEGFLPSKPQQRRAKLEALKTETRTVVVYE
FT                   SPHRILHTLTDMNVVLGSGRQIVLARELTKQFETYLNGTAAELLQALTDDTNQQRGEMV
FT                   LLIAPAQSEADVRDGPGEAAKRTLLLLLEELPLKKAAAMTAKIHDERKNELYQWALENK
FT                   NNE"
FT   gene            complement(438750..439000)
FT                   /gene="rnpB"
FT                   /locus_tag="IL_SC0001"
FT   ncRNA           complement(438750..439000)
FT                   /gene="rnpB"
FT                   /locus_tag="IL_SC0001"
FT                   /product="RNA_rnpB_region"
FT                   /ncRNA_class="scRNA"
FT   gene            complement(439033..441171)
FT                   /locus_tag="IL0426"
FT   CDS_pept        complement(439033..441171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0426"
FT                   /product="Signaling protein with a sensor domain, CHASE,
FT                   GGDEF and EAL domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81269"
FT                   /db_xref="GOA:Q5R0L9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L9"
FT                   /protein_id="AAV81269.1"
FT                   /translation="MKRYLFVIFVSFCILVTGVIWFAENQHSQVVESRKRVATERLGKL
FT                   RAALEGQINSSLVTARALQAEIKLSPDISPERYRLLMQELIDGDVPVRHVALAPNLIIE
FT                   FVYPLAPNKAALGFDYRTSPAQFESVQEAIQKKQIVIDGPVNLIQGGWALIARAPVFIN
FT                   DNKLWGMIAVVIDIGDLIASSGLDSVDDYLFALKKENGNGDHLFDFGDASLWQQDYVAI
FT                   EVAVSTGKWILALAPKNAVWAHRGSIYWIIIVAGLLLSFLMTAFMYNLVTAQSRLRSAL
FT                   VTIDHQAHFDSITDLPNRRAFVDYLDQLTQKGREQHFAILFIDLDHFKEVNDNLGHDAG
FT                   DELLVSVSDRLRNQLRGSDFIARIGGDEFVVVINRFTSHQIINDLASQINRQLSEPFNL
FT                   RQNQIQTTCSIGIALYPDDGIKASELLKNADLAMYAAKTAGRRTHYFFNDELREQTERQ
FT                   NAIHKRMREGLKRHEFYLVYQPIIDFSTGKISKCEALLRWQDEDGNMISPAEFIPVAER
FT                   TGLIHELGQFVLEQACVDWAVVHKSGYPIEVSINRSERELNDMESAKRWLSCISQHGIP
FT                   NTSITFEITESLLMSNKQRQLQILHYLRSQGVQLAIDDFGTGYSSINYLQRYPVDYIKI
FT                   DRSFLSQAPQNKVQVALLDALLQVARALDINVIAEGVETRQQWELLQRQRCDFAQGYFI
FT                   SEPLPLNELLKFLKDWQF"
FT   gene            441396..441854
FT                   /gene="mraZ"
FT                   /locus_tag="IL0427"
FT   CDS_pept        441396..441854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="IL0427"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81270"
FT                   /db_xref="GOA:Q5R0L8"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0L8"
FT                   /protein_id="AAV81270.1"
FT                   /translation="MFRGATTLSLDSKGRLAIPAKYRHALSLDCEGKMVCTIDIKQPCL
FT                   LLYPLPEWQIIEQKLTRLSSMNPAERRLQRLLLGHADDCEMDKNGRLLLSAPLRQHAGL
FT                   EKKLMLVGQLNKFEVWNEDAWHEQVAQDMDVEREGDFTLNERLEDFSL"
FT   gene            441854..442801
FT                   /locus_tag="IL0428"
FT   CDS_pept        441854..442801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0428"
FT                   /product="Predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /note="involved in cell envelope biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81271"
FT                   /db_xref="GOA:Q5R0L7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0L7"
FT                   /protein_id="AAV81271.1"
FT                   /translation="MITTSPQHVSVLLEESIEALATDPQGTYIDATFGRGGHTRALLNQ
FT                   LGDDARVIALDQDPEAIAAAAAFADDPRFQIIHTPFSNLQQVLDDLQLNRQVTGILFDL
FT                   GVSSPQLDDAERGFSFMRDGPLDMRMNTTSGETAAEWLNRAEKDDISWVLKEYGEERFA
FT                   RRIASAIVMDREKKPFTRTKQLAEMIARVSPVKEKHKHPATRTFQAIRIHINRELEQIE
FT                   QALEASLSGLKEDGRLVVISFHSLEDRLVKRFIRKHSEGKQLPPGLPVTEAERNKDKAL
FT                   EKVGKAIKPGKAEVQLNPRSRSSVLRIARRVRND"
FT   gene            442794..443111
FT                   /gene="ftsL"
FT                   /locus_tag="IL0429"
FT   CDS_pept        442794..443111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="IL0429"
FT                   /product="Cell division protein, FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:IL0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81272"
FT                   /db_xref="GOA:Q5R0L6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L6"
FT                   /protein_id="AAV81272.1"
FT                   /translation="MTKQRYPSLMKMLLQDLLQHKWILLLSVVVIGNALSIVYTAHLNR
FT                   QLTGERDDLLSHRDTLDREWRHLVVEQNALTEHSRVERIAQEQLGMRDVEPEQEVLVSW
FT                   Q"
FT   gene            443102..444835
FT                   /gene="ftsI"
FT                   /locus_tag="IL0430"
FT   CDS_pept        443102..444835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="IL0430"
FT                   /product="Cell division protein FtsI"
FT                   /note="penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:IL0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81273"
FT                   /db_xref="GOA:Q5R0L5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L5"
FT                   /protein_id="AAV81273.1"
FT                   /translation="MAVTRRKKHTEPAGTRWRFYTAVFLLFGVFSALIARAAYIQVISP
FT                   DAFSLQGDMRSLRASSVAVQRGTIVDRNGRELAVSVPVETVWADPKRIADKDALADEMR
FT                   WQALAETFRMNRKELVSKVDDPSKRFVYLQRKVTPSEADYVKQLKIPGVYLKTESRRYY
FT                   PTGEISAHLIGLTDIDGVGQEGLELLYDEHLTGKPGKRVYRKDAQGRVVEEISQTDAQQ
FT                   PKQLTLSIDQRIQATAYTELKKAVRYNQATSGSAVVLDVETGEVLAMVNSPSYNPNNRT
FT                   DLQSFRMRNRAITDSYEPGSTMKPLVVLSALEKGRHKAGDTIDTSPGWLRIGGRRVSDP
FT                   RDYGELTLSEVLEHSSNVGVTKIALDLGVDSLLQTYADAGLGSDTGVALLGESIGLLSG
FT                   RRRWSDFETATLAYGYGLSATTLQLANAYNIIANGGKKRPLTIFRQESPLPAEQVFNPD
FT                   NTRAVMHMLEEVVRDGTAKAAQVPGYRIAGKTGTTRKTKATGGYGDEYVALFAGIAPVS
FT                   DPKVVVVVTINEPGTDDYYGGTAAAPVFSKIVSQTMRLLNIPPDNLDDTQVHAAGFGGD
FT                   K"
FT   gene            444835..446298
FT                   /gene="murE"
FT                   /locus_tag="IL0431"
FT   CDS_pept        444835..446298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="IL0431"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81274"
FT                   /db_xref="GOA:Q5R0L4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0L4"
FT                   /protein_id="AAV81274.1"
FT                   /translation="MKLAELLTMLPTSFSVPDVTVSGIKLDSRQVANGDVFVAIPGYET
FT                   DGRAYIDAAIDAGAAAIIAEAPGMAVEQRRGVVVIGFSGVREHLSRIAGNFFGHPSEKM
FT                   NLVGVTGTNGKTSVTHIMAQLAKALGMEAAVIGTTGSGLIGRLLPERHTTPDAVTVQQR
FT                   LATLLAEGAELVAMEVSSHALIQRRVEALHFAAAAITNISRDHLDYHGTMENYVAAKQR
FT                   LFADFGVQNRVVNADDDTLSHWQQDDLADLWVSLNASPNEPCLQATGVQFHEQGSVFSL
FT                   NWQGESCVVETPLLGRFNVYNLLCAVAVLLKLNKPLADIGKACGRLQPVPGRMEAFHNN
FT                   QSPLVVVDYAHTPDALHQVLSALRLHCKGRLWCVFGCGGDRDRGKRPQMGKVAADYADV
FT                   VVVTDDNPRTEPAEQIIEDILTGIADKTQVKVWPGRREAVIRAMQEAGKDDVVLLAGKG
FT                   HEDYQVIGTQRIDYNERAVVSEWLQGDCA"
FT   gene            446295..447698
FT                   /gene="murF"
FT                   /locus_tag="IL0432"
FT   CDS_pept        446295..447698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="IL0432"
FT                   /product="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81275"
FT                   /db_xref="GOA:Q5R0M5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0M5"
FT                   /protein_id="AAV81275.1"
FT                   /translation="MISVSLKWIAEQVEGRLIGSDCTIDAVSTDTRADLTDALFIALKG
FT                   KNFDAHDFVEQAIAKGAAAIICEKKVDSECRQIIVENSRHALGRLGAAIKAKVAPKTVA
FT                   VTGSNGKTTVKEMLAAILSIRHPVLATQGNFNNDIGVPLTLLRLQEEHKYAVVELGANH
FT                   PGEISYTTDLVKPDVAILNNVSAAHVEGFGSLHGVARAKTEIFRGVGGQGTAITPRDSE
FT                   FYPCWQRACSDMQWKTFGLSDSADVYASDVTLNSEGHPSFTLHLGGETKQLELKLSGRH
FT                   NVLNALSAAAAASELGISLNDIANGLQQVQPAQGRLTTIKVSDHLRIIDDTYNASVAST
FT                   KAALDLLGSYQGYRIFVLGDMGELGADARAYHEDIGEHAIGSGIDNLYSLGVLSQSASE
FT                   VFNGHGGKHFGSLQSLVESVLQRLTEQTGKQPVTVLVKGSRSAHMERVVAAIQQAVTVS
FT                   DSVEDKHAC"
FT   gene            447692..448774
FT                   /gene="mraY"
FT                   /locus_tag="IL0433"
FT   CDS_pept        447692..448774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="IL0433"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81276"
FT                   /db_xref="GOA:Q5R0M4"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M4"
FT                   /protein_id="AAV81276.1"
FT                   /translation="MLVWLAEYLTQFESAFNVFSYLTLRAILSVLTALVLSLWLGPTLI
FT                   RRLQRLQIGQTVRDDGPESHLVKSGTPTMGGVLILAAVLGSSLLWADLDNRYVWVVLLV
FT                   TTGFGIVGFVDDYRKVVRKDPKGLIAKWKYFWQSVIASVAAVYLYWSSTQGAETALLVP
FT                   FFKDVMPQLGMLYMLMAYFVIVGTSNAVNLTDGLDGLAIMPTIMVAAALGIFAYVSGNV
FT                   NFAEYLQIPYLPLTAELLVVCTAIVGAGLGFLWFNTYPALVFMGDVGSLALGAALGIIA
FT                   ILVRQELVLFIMGGVFVMETLSVMLQVGSYKLRGKRVFRMAPIHHHYELKGWPEPRVIV
FT                   RFWILSLIFVLIGLATLKLR"
FT   gene            448781..450172
FT                   /gene="murD"
FT                   /locus_tag="IL0434"
FT   CDS_pept        448781..450172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="IL0434"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81277"
FT                   /db_xref="GOA:Q5R0M3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M3"
FT                   /protein_id="AAV81277.1"
FT                   /translation="MTKIAWQNTKHIVVLGLGKTGVSVLRYLQHKRQQDQKLAEVKIQV
FT                   FDSRENPPGLEEAKQILGDAELINRHWELEDTLAADLIIASPGIDLREDPVVLARDADI
FT                   PIVGDVELFAQESKLPIVAVTGSNGKSTVTRMVEFVAKQCGKNVAAAGNIGVPVLDLLL
FT                   QEQHPDAVILELSSFQLESVSSLKLKAAALMNISADHMDRYCTLDEYVKAKQRIFTHAK
FT                   TWILNRQQQDTWPHPVTGKLMTFGNDSHPKHFGLLSGNIDRVSGPVAVTFDGSVVLRAD
FT                   QLQLQGIHNLVNVQAALALCQAIDIDIEAAVRAVKEFKGLPHRCELVSDNEGVLWVNDS
FT                   KATNIGATAAAVEGLRPMINGRLLLIAGGVGKGADFRELQSTLERVDILLTIGEDGPRI
FT                   GQLFNGSRQVKSLQQAVELAASLVQTGDMVLLSPACASFDQFQNFEHRGDSFRHAVEAL
FT                   YVNSA"
FT   gene            450156..451385
FT                   /gene="ftsW"
FT                   /locus_tag="IL0435"
FT   CDS_pept        450156..451385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="IL0435"
FT                   /product="Bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81278"
FT                   /db_xref="GOA:Q5R0M2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M2"
FT                   /protein_id="AAV81278.1"
FT                   /translation="MSTVREEQLNLEIPASDVGSRWQKLINWFQPKASQPLYDRMLFTL
FT                   AMALLAFGFVMVTSASLPTADRLTGNPFHFAIRHGIYILISLAVMLATLRVPANSWNQQ
FT                   SGKLLLLGLIMLLMVLVVGYEVNGAQRWIKVGPITFQAAEVAKLFFCIYMASYLSRRED
FT                   EVREATKGFIKPLALLFIAAVLLLMQPDFGTVVVLSATTVAMLFLAGARLWQFFAVFIT
FT                   CVLALILLIIVEPYRMQRLLTFLEPEKDPFGAGYQLMQSLIAFGQGHFSGAGLGNSIQK
FT                   LQYLPEAHTDFIMAVVAEELGFLGVLAVIATVLMLVWRALIIGRRCLMQEQRYGGYLAY
FT                   GIGIWFSIQAFVNIGVASGALPTKGLTLPLVSYGGNSLIISALAVGLLLRIDHERRMLG
FT                   RKVAPRGGAE"
FT   gene            451382..452470
FT                   /gene="murG"
FT                   /locus_tag="IL0436"
FT   CDS_pept        451382..452470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="IL0436"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81279"
FT                   /db_xref="GOA:Q5R0M1"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M1"
FT                   /protein_id="AAV81279.1"
FT                   /translation="MNKVLIAAAGTGGHIFPALAVAEQMRDNGWQVDWLGTQEGRLESR
FT                   VIPAANFPLHSISMTGVRGHGLKRKLFMPFTLAKAVLQCRRLLKTLQPQVVATFGGYVC
FT                   APMGLAAKLLGIPLVVHEQNAIPGMTTRLLAPRANKVMLGLPVALPQWQQYPVVGNPLR
FT                   KGLLAQAAEQTEKSNTDGALNILVVGGSLGAQVLNEAVPEAVKALEGVELNVLHQCGAE
FT                   REATTEKAYLGASVLKTLKVTEFIEDMGDAFKNADLVICRAGALTISELAVMGVASILV
FT                   PLPHAVDDHQSANAKVLESRGAAVLLPQTEVVEGALKQQLKRLLHDRQQLWTMARFARQ
FT                   CAMPEATQRLVNECMEYRQSDD"
FT   gene            452463..453935
FT                   /gene="murC_1"
FT                   /locus_tag="IL0437"
FT   CDS_pept        452463..453935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC_1"
FT                   /locus_tag="IL0437"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81280"
FT                   /db_xref="GOA:Q5R0M0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M0"
FT                   /protein_id="AAV81280.1"
FT                   /translation="MTSMTATNAQPFTIVNVPEMRRVQRIHFVGIGGAGMAGIAEVLLN
FT                   QGYQISGSDIAENANTERLRCLGATVVLGHMANNIEGASVVVVSSAIKADNAELVAAHQ
FT                   LRVPVVRRAEMLAELMRFRHGIAVAGTHGKTTTTSLVASIFAEAGRDPTFVIGGLLNSA
FT                   GSNARLGNSKYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYEGDFNKLLDTYVEFL
FT                   HNLPFYGLAVMCVDDPVVSDLIPRLGRQTMTYGFSEAADVRAIDYKQTASESCFTILRK
FT                   GLKPLDVCLNLPGKHNVLNALAAVAVATDEGINDEAIKSALNKFEGIGRRFQHYGNFAI
FT                   SDKDSNKEPGEVMLVDDYGHHPSEVAATIQAAREGWPERRLVMAFQPHRYSRTRDLYED
FT                   FVNVLSQVDVLLMLEVYSAGETPVSGADSRSLCRSIRQRGQIDPVYVATVDDMPEVLES
FT                   VLAPGDLLLTQGAGNIGALAKRIATEVLSHES"
FT   gene            453925..454854
FT                   /gene="ddlB"
FT                   /locus_tag="IL0438"
FT   CDS_pept        453925..454854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="IL0438"
FT                   /product="D-alanine-D-alanine ligase B"
FT                   /note="affects cell division"
FT                   /db_xref="EnsemblGenomes-Gn:IL0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81281"
FT                   /db_xref="GOA:Q5R0N1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0N1"
FT                   /protein_id="AAV81281.1"
FT                   /translation="MKANAFGKVAVMLGGTSAERDVSLKSGMAVLKGLVAKGIDAHAFD
FT                   PAAHSLQELVEQKFDRVFIALHGRGGEDGSMQGALQILEMPYTGSDVLGCALGMDKVRC
FT                   KQIWHSVGLPTANWRVVTQAEIEQVNVEAMLQELGGRVIVKPAREGSSIGMSIADNGRS
FT                   LALALQHAAEFDDDLLVEQWVEGAEYTIGILEGKALPVIRLQTPHEFYDFEAKYQANDT
FT                   QYHCPAGLSDDDEASLRTLAERAFAAIGGSGWGRIDVMRNNAGEWFLLEANTVPGMTEK
FT                   SLVPMAAKVAGLQFNDLVERILAQTLER"
FT   gene            454857..455603
FT                   /gene="ftsQ"
FT                   /locus_tag="IL0439"
FT   CDS_pept        454857..455603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="IL0439"
FT                   /product="Cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81282"
FT                   /db_xref="GOA:Q5R0N0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0N0"
FT                   /protein_id="AAV81282.1"
FT                   /translation="MAAEQRLRSVNFWSGVVVLCLTIAGALVGIYQLNEVLTDEQQVPL
FT                   AELSVQGELHYTASEEVRQALTAEPLGSFFTADVDDLRRRVEQLPWVQKVSIRKVWPDK
FT                   LSVYVTEHKPVAMWNGDRLINQHQEVFRADITRADSSLPQLFGPENAVKETWKEFNRVQ
FT                   QMLEVNGFQIRALRLTERFAVNVVLAQGIEIKLGREATLERIKRFIDVFPSIVEHEKSK
FT                   NNEIDTVDLRYDTGAAVAWREAKSES"
FT   gene            455634..456842
FT                   /gene="ftsA"
FT                   /locus_tag="IL0440"
FT   CDS_pept        455634..456842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="IL0440"
FT                   /product="Cell division ATPase, FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81283"
FT                   /db_xref="GOA:Q5R0M9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0M9"
FT                   /protein_id="AAV81283.1"
FT                   /translation="MVVGLDIGTSKVTALIGELLPDNEISVVGVGTATSRGMDKGGVND
FT                   LNLVVQSVQRAVDEAELMADCRVASVYLNISGRHISCQNESGMVPINEAEVTQDDVDSV
FT                   IHAAQSVPIAKERRILHVLPQEYVIDSQESIRSPIGMSGVRMESKVHIITCANDMAKNI
FT                   IKAVERCGLSVDKLIFSALASSISVLTDDEKDLGVALVDLGGGTIDICIYAGGVLRHTA
FT                   VIPAAGNQVTSDIAKIFRTPTNHAEEIKTKHACALRQMVSMEDTIEVPSVGGRPSRVMS
FT                   RHTLAEVVEPRYQELFELVRDEIQQSGLDEQIAAGVVITGGSAKMEGCVDFAEEIFQMP
FT                   VRIGVPLGMKGLRDYVEDPVYATAVGLLRYGQEDAAVSQKESSKTDVIGLWQKVQSWFK
FT                   GEF"
FT   gene            456882..458081
FT                   /gene="ftsZ"
FT                   /locus_tag="IL0441"
FT   CDS_pept        456882..458081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="IL0441"
FT                   /product="Cell division GTPase, FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:IL0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81284"
FT                   /db_xref="GOA:Q5R0M8"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0M8"
FT                   /protein_id="AAV81284.1"
FT                   /translation="MFELMDNYESEAVIKVIGVGGGGGNAVQHMVKESIEGVQFIAANT
FT                   DAQALRNHTADVTIQLGQDITKGLGAGANPEVGRQSAEEDRENIRVHLEGADMVFIAAG
FT                   MGGGTGTGAAPVVAEVAKELGILTVAVVTKPFPFEGKKRMAVADEGINALAQSVDSLIT
FT                   IPNEKLLKVMGRGTSLLDAFSAANNVLLGAVQGIAELITRPGLINVDFADVRAVMKEMG
FT                   TAMMGTGVASGEDRAQEAAEMAINSPLLEDIDLSGARGVLINVTAGMDMSIEELDTVGN
FT                   TVKAFASDNATVIVGTVIDTEMSDELRVTVVATGIGAERKPDISLVNNTNQTTAKREPQ
FT                   PAYRSNDIDRGGAAPRYEEQEELQPEAKAEPKRQPAAKAKQDKELDYLDIPAFLRKQVD
FT                   "
FT   gene            458205..459125
FT                   /gene="lpxC"
FT                   /locus_tag="IL0442"
FT   CDS_pept        458205..459125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="IL0442"
FT                   /product="UDP-3-O-acyl-N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81285"
FT                   /db_xref="GOA:Q5R0M7"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0M7"
FT                   /protein_id="AAV81285.1"
FT                   /translation="MIKQRTLQQAISTTGVGLHKGNKVNLTLRPAPANTGLIFRRVDLD
FT                   PVVDIPARADWVRDTQLCTCLINEENVRVSTVEHLLAALAGVGIDNAIIEVDSHEIPIM
FT                   DGSSHPFVYLLQSAGIEEQSAAKKFIRIKQPVRVEDGDKWAELLPHDGFRIDFAIDFEH
FT                   PAIADTGQTVSIDFSANAFIKEISRARTFGFMKDIEYLRENNLALGGSFDNAVVLDEFR
FT                   ILNSDGLRYDDEFVKHKMLDAIGDLYMGGHSILGHLRAYKSGHALNNQLLQALLAQQSA
FT                   WEFVTFDEEQATAPIAFWSPATTTA"
FT   gene            complement(459122..459580)
FT                   /locus_tag="IL0443"
FT   CDS_pept        complement(459122..459580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0443"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81286"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0M6"
FT                   /protein_id="AAV81286.1"
FT                   /translation="MSRHPKTPSEWLRSGQKTLSSTLRHYAQFAAQLSHWQQLFQQCVD
FT                   KNTSQHCQLLNIRDGQMIIQVDNGSWATRLKLQQAAIITHFRHNATVPVQSLSIKVSPS
FT                   MNSFEKSIKNQKGSSSAERLLTMAEGCDEPLKSELKALAAKFTANDKD"
FT   gene            459615..460547
FT                   /locus_tag="IL0444"
FT   CDS_pept        459615..460547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0444"
FT                   /product="Membrane protein"
FT                   /note="similar to metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81287"
FT                   /db_xref="GOA:Q5R0N8"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0N8"
FT                   /protein_id="AAV81287.1"
FT                   /translation="MSLSVFYRGSKIRFRIRLSRRRFFSFVGIAAFIGLASWQPWQYQG
FT                   IDPAVAQNKITEEQKKLVLQEQALKELKEDTQKRLGAMTIYLGELRAQMRRLDALGERL
FT                   AGVANLDNGEFNFNQELPIGGPELEVAELPHSSGKDVLTEIEDMLSQISDKQKQLSLLE
FT                   SVMMNHQLNNDAYIAGRPISDGWLSSQYGVRKDPFNGTPAMHKGLDFASYNEDVKVIAT
FT                   GAGVVTWAGDRYGYGTLVEIDHGGGLKTRYGHNDELTVSVGDVVTRGQQIAKMGSSGRS
FT                   TGPHVHYEVLRNGRQIDPNQFVYRKADSK"
FT   gene            460630..463347
FT                   /gene="secA"
FT                   /locus_tag="IL0445"
FT   CDS_pept        460630..463347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="IL0445"
FT                   /product="Preprotein translocase subunit SecA,
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81288"
FT                   /db_xref="GOA:Q5R0N7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0N7"
FT                   /protein_id="AAV81288.1"
FT                   /translation="MLGSLFRKVFGSRNDRILKTMKKDVERINLLEPEFEALSDAELKE
FT                   KTAEFRKRLNDGERIEKILPEAFATVREASRRVFGMRHFDVQLIGGMVLNDNRIAEMKT
FT                   GEGKTLTATLPAYLNALPGKGVHIITVNDYLAKRDAEFNQPLFDFLGLTVAFNIPGMAP
FT                   EDKKAAYQADITYGTNNEFGFDYLRDNMAFAPQDRVQRELNYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYRKMNELVPHLVRQEKEDTEEEQGDGDFTIDEKAKQLHLTEHGQEH
FT                   IEELLKEKGMLDADDSLYSAANISLLHHINAALRAHHLFQKDVDYIIKDDKVVIVDEHT
FT                   GRTMEGRRWSEGLHQAVEAKEGVPIQNENQTLASITFQNYFRLYNKLAGMTGTADTEAF
FT                   EFQSIYGLETIVLPTNKPMVRDDRADLIYLTTLEKYEAIAEDIEECRKQKRPVLVGTVS
FT                   IENSELLSQLLKKKKIPHAVLNAKFHEHEADIIAQAGRPGTVTIATNMAGRGTDIVLGG
FT                   SWMAEVEKLEEPSNDKIEKIKQDWQKLHDAVIEAGGLHIIGTERHESRRIDNQLRGRAG
FT                   RQGDPGSSRFYLSLEDPLMRIFASDRIGTMMKRLGMKEGEAIEHPWVTRAIENAQRKVE
FT                   GRNFDVRKQLLEYDDVANDQRSVVYDQRNELLDEGDISETIVAIRDDVINSVISEYVPP
FT                   QSLAELWDLKGLEERLRGDFHIELPLQQWLDEEDHFHEEVLRERVLEELVKAYQEKEEM
FT                   VGPEVLRRFEKSIMLQSLDQHWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKKEAFELFT
FT                   EMLEALKLDVVTILSKVKVRAQEDVDAVDEQRKAADSAPREFRHEQSGPAAEEPQKNTD
FT                   NAQGQPVRKGAKVGRNEPCPCGSGKKYKHCHGKL"
FT   gene            463354..463770
FT                   /gene="mutT"
FT                   /locus_tag="IL0446"
FT   CDS_pept        463354..463770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="IL0446"
FT                   /product="7,8-dihydro-8-oxoguanine-triphosphatase"
FT                   /note="MutT"
FT                   /db_xref="EnsemblGenomes-Gn:IL0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81289"
FT                   /db_xref="GOA:Q5R0N6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0N6"
FT                   /protein_id="AAV81289.1"
FT                   /translation="METQKSPAVHVAVGVIENEQGEIFIAQRHPEQHQGGKWEFPGGKV
FT                   EAGENVQQALQRELKEECGIDVTDMAPLTVIEHQYKDKRVLLDVWWVLSYSGEARQLEG
FT                   QDWCWVDKNQLDAFQFPEANQPIVECIMQSLNAY"
FT   gene            complement(463806..464000)
FT                   /locus_tag="IL0447"
FT   CDS_pept        complement(463806..464000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0447"
FT                   /product="Uncharacterized zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81290"
FT                   /db_xref="GOA:Q5R0N5"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0N5"
FT                   /protein_id="AAV81290.1"
FT                   /translation="MSISVNCPTCQTKVEWSEKSPARPFCSERCKLIDLGEWANEEKSI
FT                   PGEPVVIANDDYNNEESDY"
FT   gene            complement(463997..464761)
FT                   /locus_tag="IL0448"
FT   CDS_pept        complement(463997..464761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0448"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81291"
FT                   /db_xref="GOA:Q5R0N4"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0N4"
FT                   /protein_id="AAV81291.1"
FT                   /translation="MTSTDNDNILYEYPLQERMRTYLRLEHGFEQLKASRVCFDEQAEP
FT                   FFNALFAVTELLERCDIRTELTKDLELDKQRLQKWEEHPDVDRDALQRTISEIEHCINT
FT                   LQDIPKYLRQLKDDALLTSIRQRFSQPGMSGLFELPQLHLWLSQSAEEKQQQCERWSQT
FT                   LALVELAITLKLTLLREQSVFAPIQLQNGFLQESSEQLLAMLRIKVPRSAKIYPVISGH
FT                   RQRFTVRFMPLPGESKETSLHDIEFELARCSP"
FT   gene            complement(464802..465410)
FT                   /gene="coaE"
FT                   /locus_tag="IL0449"
FT   CDS_pept        complement(464802..465410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="IL0449"
FT                   /product="Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81292"
FT                   /db_xref="GOA:Q5R0N3"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0N3"
FT                   /protein_id="AAV81292.1"
FT                   /translation="MTYVVGVTGGIGSGKSAATAEFEKLGITVIDADIVSRQVVMPGTP
FT                   CLRAIAEHFGRDLLTDKGELDRKALRQKVFSDPAEKDWLNSLLHPAIREEILTQLEQAS
FT                   SPYVILSAPLLLENNLDKYCQRVLVVDVPEELQLQRTIQRDESPKEEVEAIMKAQLSRK
FT                   ARLRKADDILNNESSIDQLRRQVNQLHQRYLAATVAQEE"
FT   gene            complement(465413..466273)
FT                   /gene="pulO"
FT                   /locus_tag="IL0450"
FT   CDS_pept        complement(465413..466273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulO"
FT                   /locus_tag="IL0450"
FT                   /product="Type II pili prepilin peptidase PilD/XcpA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81293"
FT                   /db_xref="GOA:Q5R0N2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0N2"
FT                   /protein_id="AAV81293.1"
FT                   /translation="MEYLLAAGSIPTLMVALVLGAVIGSFLNVVITRLPIQLERQWQRE
FT                   CAEMNGTPVTKQDRFSIAFPGSHCPECKASIAWYDNIPLLSYLVLRARCRHCQTRIPVT
FT                   YWLVEIISCLAFGIIGWYFGFTLPALVYATVFSLLICLFVIDWRHQLLPDQLTYPLLWV
FT                   ALLWSISDLSDMTPTSAIIGAAAGYLSLWSVFWAYKLITGKEGMGYGDFKLLAAITAFT
FT                   GATLLPVTILASSVCGAVIGLIMLRRQSRSQPIPFGPFLIGGGLLSYFYGMELLFSYWH
FT                   WLGGT"
FT   gene            complement(466289..467467)
FT                   /gene="pulF"
FT                   /gene_synonym="hotC"
FT                   /locus_tag="IL0451"
FT   CDS_pept        complement(466289..467467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulF"
FT                   /gene_synonym="hotC"
FT                   /locus_tag="IL0451"
FT                   /product="Type II secretory pathway, PulF-like"
FT                   /db_xref="EnsemblGenomes-Gn:IL0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81294"
FT                   /db_xref="GOA:Q5QYN1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QYN1"
FT                   /protein_id="AAV81294.1"
FT                   /translation="MKTLDYCWQWQADNASGLVHADSLLQAKQLLSQHHIRCTKIKRLS
FT                   KRQRKLIRPKLSLWYILLQQTASLLESGLPLSEALRHSICETKSRSLRWLIEDCIRSIE
FT                   HGFSFSRALTYYEHWLPKADINAIAWAEQNGQLADALQQLQELEKRQHQLKKQLTKALR
FT                   YPVIVLLVAAGVCFMMMGWVLPAFAQLFGEGELPWLTAVLLNSSAFLKEQAFVIFSAIL
FT                   AAAVTLLTVKNKAPLFSQRTLAQLPVIGQLLQDIKLQQLFHRLAVALRAGIETRQAILS
FT                   TESSLNWLPHKAALRQIHQQLESGNGWVDSFRSSALNEPRTLSFLKVGEQNGKIDNAFA
FT                   ALADFKQQRFEENCERLTALAEPLLMVVLGGIIGTLLVAMYLPLFSMGQQFQ"
FT   gene            complement(467454..468767)
FT                   /gene="pulE"
FT                   /gene_synonym="hofB"
FT                   /locus_tag="IL0452"
FT   CDS_pept        complement(467454..468767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulE"
FT                   /gene_synonym="hofB"
FT                   /locus_tag="IL0452"
FT                   /product="Type II secretory pathway, ATPase PulE"
FT                   /db_xref="EnsemblGenomes-Gn:IL0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81295"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QYN0"
FT                   /protein_id="AAV81295.1"
FT                   /translation="MTDFACCSLTHLPGPTSSSENEYDPFLQQHGLLPFAQGEKWLMLL
FT                   QKPGFAPVDAVLLSFYSDKRVLLIRGKGKRSGIQLPKDSAIEYVDQLLLYCSEKGLSDL
FT                   HLQPLNQGVVVRGREAGQLHRLDFIAREFAQQVYSRIKVQASLDLTEQRQPQDGRLSVQ
FT                   FRDNTQLEFRLNCCPVIGGEKLVLRCLQPTHNITPLQQTGLLEQQYAWFARCLSQTQGL
FT                   ILVTGPTGSGKTSTLYSAMSQLDTERSNVCSVEDPVEVPLPGCSQVMVNARQGLTFASI
FT                   LRALLRQDPDVILIGEIRDAETAKIAVQAAQTGHLVLSSLHTNNCLDTLKRLHSLGVNP
FT                   LDIRSSLKLIVSQRLLPVADSHSRTEKNRQAVFEVVPWLDTTEGLIETLTNSRASIEDL
FT                   RHYLGHLKLPDFSQALQHYIDSGLISPAEKERFTYEDA"
FT   gene            complement(468767..469249)
FT                   /gene="pppD"
FT                   /gene_synonym="pilA"
FT                   /locus_tag="IL0453"
FT   CDS_pept        complement(468767..469249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pppD"
FT                   /gene_synonym="pilA"
FT                   /locus_tag="IL0453"
FT                   /product="Pilin protein PilA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81296"
FT                   /db_xref="GOA:Q5QYM9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QYM9"
FT                   /protein_id="AAV81296.1"
FT                   /translation="MQEAHFRRLPVLRLPGKGFSLIEMMVVVAIIAILSAIAVPSYTYY
FT                   TQQAKVSKALAHAQPLQLGIALCWQIEGQLNKCNQAGNKGIPGLPSPLPDELSDLSLTE
FT                   SAAVRLTLNSVSINNQPLQIELTPNATNTHLDWNIACSDYSEMRSVVQNCEQQVSY"
FT   gene            complement(469349..470218)
FT                   /gene="nadC"
FT                   /locus_tag="IL0454"
FT   CDS_pept        complement(469349..470218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="IL0454"
FT                   /product="Nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81297"
FT                   /db_xref="GOA:Q5QYM8"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QYM8"
FT                   /protein_id="AAV81297.1"
FT                   /translation="MSQPELQLAIQDGVRAALKEDLFGEDARLDITAQLIPEQSQSRAS
FT                   IITREDAVICGCAWVDQVFRQMGNQVEIEWLVKDGDNVKANTELCRLKGPSRILLTGER
FT                   TALNFLQTLSATATTTYHYSKLLDGYKTQLLDTRKTLPGMRLAQKYAVRCGGGVNHRIG
FT                   LFDAYLIKENHIFACGGITQAVATAKRLNPGKTVEVEVENLDEFGQALKAEADVIMLDN
FT                   FSIEDIKQAVQQNRDNAGHSAQLEVSGNITDERLPELAATGVDFISSGALTKNVQAIDL
FT                   SMRISEDN"
FT   gene            470328..470834
FT                   /gene="ampD"
FT                   /locus_tag="IL0455"
FT   CDS_pept        470328..470834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="IL0455"
FT                   /product="N-acetyl-anhydromuramyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81298"
FT                   /db_xref="GOA:Q5R0P4"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0P4"
FT                   /protein_id="AAV81298.1"
FT                   /translation="MQHPSPHYDDRPQSAEVSLLVIHCISLPEGQYGTPYIRQLFMGEL
FT                   EPDAHPDFAILNGLRVSAHCVIRRNGTVEQYVPFDKRAWHAGMSRYCGRRRCNDFSIGI
FT                   ELEGTDHSAYTQQQYEQLIAVTKALISTYPRLNRRRIVGHQDIAPGRKTDPGSEFDWQT
FT                   YLNAL"
FT   gene            470845..471669
FT                   /gene="ampE"
FT                   /locus_tag="IL0456"
FT   CDS_pept        470845..471669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="IL0456"
FT                   /product="Membrane protein required for beta-lactamase
FT                   induction"
FT                   /db_xref="EnsemblGenomes-Gn:IL0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81299"
FT                   /db_xref="GOA:Q5R0P3"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0P3"
FT                   /protein_id="AAV81299.1"
FT                   /translation="MVLIALLIALSVERLYHSPAFLHWSFFLERWQHWSAARLTNEKWK
FT                   SEPLQLVRLLVPALAVGFLVVLLDNLMVTFIVSILSLLLAMNCEPARKSYKAYLKAANR
FT                   GDEQQVNEHQHALTEFAGQHQPKQLSDSLIWINYRQYIAVMFYFVLFGSFGALVYASLR
FT                   YAEKQISEPESTKLWQQFMWFADWVPARLAGFGLLIVGHFSRAFPVWVKHSLNPQADPD
FT                   KLLFNVASKAEDIPQHPDDRTEHIACQLRLMRRQQIFWVCVIAALTLTGWVN"
FT   gene            471818..472501
FT                   /gene="pdhR"
FT                   /locus_tag="IL0457"
FT   CDS_pept        471818..472501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="IL0457"
FT                   /product="Probable transcriptional regulator for pyruvate
FT                   dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:IL0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81300"
FT                   /db_xref="GOA:Q5R0P2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0P2"
FT                   /protein_id="AAV81300.1"
FT                   /translation="MIVDGRLSAGQKLPAERQLAQQFNVSRPSLREAIQKLEAKGVVER
FT                   RQGGGTYVVNSINEQLTEPLFELLAKHPESQFDLLEFRHALEGISSFYAALRGTEADLD
FT                   RISESIKDLENSRANSIDDQVNAIVEFYHRIAEASHNVILLHVIHGMQELLAENIRQNL
FT                   EILAGRDDLLGKLNQHRQQLVSAIVAGKPEQARDACHQHLAYIEQTLLNLGKEQSRIQR
FT                   SLRRS"
FT   gene            472527..475199
FT                   /gene="aceE"
FT                   /locus_tag="IL0458"
FT   CDS_pept        472527..475199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="IL0458"
FT                   /product="Pyruvate dehydrogenase (decarboxylase component,
FT                   E1)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81301"
FT                   /db_xref="GOA:Q5R0P1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0P1"
FT                   /protein_id="AAV81301.1"
FT                   /translation="MSEELNKDVDQQETQEWLDALEGVLEAEGPERAHYLLEQLVDKAR
FT                   RNGAYLPYKPTTAYLNTIPASQEPTMPGNQTLESRIRSAIRWNAAMMVLRASQKGEELG
FT                   GHLASFASSAMLYDVGFNHFFRAPNEDDGGDFLFIQGHVSPGIYGRAFIEGRLTEEQLN
FT                   NFRQEVDGKGLPSYPHPNLMPDFWQFPTVSMGLGPIQAIYLARFLKYLTDRGIKDCSKQ
FT                   RVYCFLGDGETDEPESLGAIGLAAREELDNLTFVINCNLQRLDGPVRGNGKIIQELEGN
FT                   FHGAGWEVIKVIWGRYWDPLLYRDTEGKLQQLMEETVDGDYQNFKAKGGKFTRENFFGK
FT                   YPETEEMVANLSDEDIWRLNRGGHDPVKVYSAYHKAANTKGRPQVILAKTVKGYGMGAA
FT                   GEGKNIAHQVKKMDLDAVKHMRDRFNIPFEDKELEDLPYYKFDDDSDEMKYLNERREKL
FT                   GGYMPVRRPESDVELELPALKAFDAVLKGSGDREISSTMAFVRVLTALLKDKKIGKRIV
FT                   PIIPDEARTFGMEGLFRQVGIYSHHGQKYTPQDKDQVAYYREDKKGQVIQEGINELGAM
FT                   ASWIAAGTSYSLNNEPMIPFYIYYSMFGFQRVGDLVWAAGDSQTRGFLVGGTAGRTTLN
FT                   GEGLQHQDGHSMVHFGTVPNCISYDPTYGYEIAVIVHDGLKRMFGDQENVFYYLTVMNE
FT                   NYHQPEMPEGVEEGIIKGIYELDKVKAKNKAKGDVQLLGSGTILQQVREAATILSEEYD
FT                   VNSTVYSVTSFNELARDGLDTDRWNMLNPEKKEKEAYITQVMKKAKGPAVAATDYIKLY
FT                   ADQVRAWVPTSYRVLGTDGFGRSDSRANLRKHFEVNPHYIVVAALKELADQGDIDKKVV
FT                   AKAIKDYDIDTDKLNPRLA"
FT   gene            475212..476987
FT                   /gene="aceF"
FT                   /locus_tag="IL0459"
FT   CDS_pept        475212..476987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="IL0459"
FT                   /product="Pyruvate dehydrogenase
FT                   (dihydrolipoyltransacetylase component, E2)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81302"
FT                   /db_xref="GOA:Q5R0P0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0P0"
FT                   /protein_id="AAV81302.1"
FT                   /translation="MADQIELKVPDVGGEEVEVIEILVSEGDTVEQEDGIVTVESDKAS
FT                   MDIPASSGGKITELKVKVGDTISEGDVLAMIEASGGADESDESDSEEEAEDKTDDKADE
FT                   EATKDKAEESEDKQEEEKDEDSEPEKKSSGGGSKVIDVEVPDIGDEEDVEIIEILVSKG
FT                   DSVSAEDGLITLETDKATMDVPCPEDGEIEEMLVKVGDKVSQGSVIAKLKVSGGADDSE
FT                   AEEKDSAKEEKSESNKESDKDSGKKSEDKDQKKDSGSSVKPSSERQPPVPDHPSQRSDR
FT                   KEGILHASPAVRRVAREFGVDLSQVKGSGPKDRILKEDVQEFVKYELSRPKAVAGATGQ
FT                   GGGGLQVIDPPKVDFSKFGEVEEVQLSRIQRKSGPNLHRNWVTIPHVTQFDEADITELE
FT                   NFRKSENEVAKKKDLGFKITPLVFILKACAKGLREFPTFNSSLSESGESLYMKKYVNIG
FT                   VAVDTPNGLVVPVIRDVDKKGIYELSEELVEISSKARDGKLKATDMQGGCFSISSLGGI
FT                   GGTAFTPIVNAPDVAILGVSRNEMKPKWNGKEFEPRLTLPLSLSYDHRVIDGAEAARFT
FT                   AYLSGVLGDIRKLVL"
FT   gene            477099..478526
FT                   /gene="lpd"
FT                   /locus_tag="IL0460"
FT   CDS_pept        477099..478526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="IL0460"
FT                   /product="Lipoamide dehydrogenase (NADH); component E3"
FT                   /db_xref="EnsemblGenomes-Gn:IL0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81303"
FT                   /db_xref="GOA:Q5R0N9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0N9"
FT                   /protein_id="AAV81303.1"
FT                   /translation="MSDKITTQVVVLGSGPGGYSAAFRAADLGLDVVLIERYSTLGGVC
FT                   LNVGCIPSKALLHMTKHIEEAQHLAEEGIEFGEPKIDLDKLRKHKEKVVGQLTGGLGQM
FT                   SKMRKVKVVNGYGKFTGSNTIKVEGDDGETEVKFDNAIIAAGSQAIKLPFIPHDDDRVW
FT                   DSTDALELKEIPKKMLLLGGGIIALEMGQVYASLGSKVDVVEMTDQLVPPADADIIKNF
FT                   NKQIKGRFENIMLNTKATNVEAKKDGVYVTFEGDKAPKDPVKYDAVLVAVGRAPNGNKI
FT                   DADKAGVNVDDRGFIKVDSQMRTNVDHIFAIGDVVGQPMLAHKAVHESHVAAEVISGKK
FT                   HFFEPKVIPSIMYTNPEVAWAGVTEKEAKEQGIEYDAVTFPWSASGRAIASNAQQGMTK
FT                   LIFDKNNRIIGGSMCGTNAGELLGEVCLAIEMGCDAEDIALTVHAHPTLHESVGLAAEI
FT                   QEGAITDMPNPKAKKKK"
FT   gene            478661..480730
FT                   /gene="pepO"
FT                   /locus_tag="IL0461"
FT   CDS_pept        478661..480730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepO"
FT                   /locus_tag="IL0461"
FT                   /product="Secreted zinc metalloproteinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81304"
FT                   /db_xref="GOA:Q5QTS8"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTS8"
FT                   /protein_id="AAV81304.1"
FT                   /translation="MKKLTAVALGVSMALTLGACSPQQEESKQQTQQAEEAKKELSSGV
FT                   VLENFDHSVKPQNNLFHYVNGTWIDKTEIPSDRSSVGSFFDLREQNQKRLRDIIESAAS
FT                   SNPEPGTNERKIGDFFNAYMDVETLNELGAKPIASDLDVIQALEDYDSVAEHMARMFRG
FT                   GVSVPFGFYVYPDAKDPQINAMYVSQSGLGLPDRDYYLKDDEKFEEFRNAYVEYAEDIL
FT                   GMVGVEDAAGAAERILKLETQLAEIQWSRVESRDANKTYNKKSAGEVAEMLNNFDFKKF
FT                   IETSELSDVKEMVIRQPSYFEEFGELFNEVDLQAWKDYLSFRLVNEYASALSEDISKRR
FT                   FDFYGTTLRGTPEQEPRWKRAVDATNSVLGEVLGQVYVKEYFPPEAKEKMEGLIENLRD
FT                   AYGQSIRNLEWMTDETKEKALEKLKKFDPKVGYPSKWRDYSELEISSTDLVANYKAYAE
FT                   FNYQEEIAKIGGPVDEEDWGMTPQTVNAYYSPVRNEIVFPAGILQPPFFDMDAEMAVNY
FT                   GGIGAVIGHEMGHGFDDQGAKYDGDGNLQSWWTDADKKAFEERTQQLSEQYSQYEPIEG
FT                   LNVNGDLTLGENIGDLAGLTIAYEAYKMSLEGEEAPVLDGFTGEQRVFIGWAQVWRGKY
FT                   REDAIREQVMSDPHSPAEYRVNGTVVNVPAFYEAFDVEEGDELYVAPENRVTIW"
FT   gene            480820..481095
FT                   /locus_tag="IL0462"
FT   CDS_pept        480820..481095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0462"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTS7"
FT                   /protein_id="AAV81305.1"
FT                   /translation="MPMSDTVSASSSQDMSQHDCCDESDISMEQSNCDSESSFCQQCEQ
FT                   HCAGQLALLNPFKQLSPAASTHAAHPLYSNLPVITETLIRPPKYAV"
FT   gene            481139..482380
FT                   /locus_tag="IL0463"
FT   CDS_pept        481139..482380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0463"
FT                   /product="Probable Co/Zn/Cd efflux system membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81306"
FT                   /db_xref="GOA:Q5QTS6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QTS6"
FT                   /protein_id="AAV81306.1"
FT                   /translation="MRYWIAILLLIPLLSVAQEHNHNHSEDQNPFEQSSEYVCPMHSQV
FT                   VRNEPGTCPICGMDLVEKEPKQDLSEHEGEKSFTVPESSQQAIRVTTAKAVRKDLQPQL
FT                   MAQAQVRWQESAQRHIHSRAEGWVEELHADVEGQWVEKGDKLYSLYAPDLVVAQDDYLQ
FT                   LLDSLSDIRNGNSQQSFKRRGQQRLRLLGMSEAQIKALEQGGETEYVVDYYAPESGYIT
FT                   SLDIQEGMYVSPGLKLLTLTQDNQLWFFADVPAHYSKQLKIGQMAHISSEHFPGGHWMN
FT                   AIDYIYPQIDPVTQTIKVRIPVNDSIDRLREGLWATAHIELEAVKDAVVVPVASLIVTG
FT                   ANNRVVVKSGAREFEVREVTTGLRVGNQIAIEEGLQEGELVVTSGQFLLDSEASLQGLG
FT                   LDSSDDAPAPQHNH"
FT   gene            482389..485490
FT                   /locus_tag="IL0464"
FT   CDS_pept        482389..485490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0464"
FT                   /product="Probable Co/Zn/Cd efflux system membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81307"
FT                   /db_xref="GOA:Q5R021"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R021"
FT                   /protein_id="AAV81307.1"
FT                   /translation="MLARIIEASIRNSWMVLLLFLGLAFWAWQSLQQTKLDAIPDLSEV
FT                   QVIVKTNYPGQAPAVVEEQVTYPLSSVMLSVPKATSVRAFSFFGDSYVYVIFEDGTDPY
FT                   WARSRVNEYLDQAQSQLPDQVRPELGPDASGIGWVYQYALVDETNQLNLGELTRLQNWF
FT                   LKQELQSVQGVAEIATVGGMVETYQVVVQPEALHRYNLTLNQIKQSIQQANNEVGGSVV
FT                   EMGEAEYMVRGLGYLKSIEDIRKIPLPLTSEQQGTVLLEEVADIRIGPQVRRGITELNG
FT                   DGEVVGGIVVMRHGENALQTIAAVKDKLEELKQGLPEGVKVVPTYDRSNLIQASTDNLT
FT                   TKLIEEMFFVAVVCILFLWHARSAVVAIVSLPLSVLFAVWIMNMLGISANIMSLGGIAI
FT                   AIGALVDAAIVMIENTHKHLQNYQERHKIVAKGSARLKVVNEACREVGPSLFFSLLVIT
FT                   VSFVPVFVLQGQQGRLFEPLAYTKTLAMAAAAIIAVTLIPVLIALLVRGKIPAEEKNWL
FT                   SRGLIALYRPLLAFTLKFPKTIIVLALLITASAWHPYKQLNYELMPPLHEGDLMYMPTT
FT                   LPGISVESAGKLLQQTDKLIAAQPEVERVFGKVGRADTATDPAPMTMIETSITLKPESE
FT                   WREGMTVDDIIAELDERVQIPGVTNAWVQPIRTRIEMLATGVKTPLAIKVSGSDFREIE
FT                   KLATRIEDTLSEQDATGSVIAERSGGGRYIEIEPKLRQAARYGLTQADIHEHIQYAIGG
FT                   ANIATSVQGNERFPINLRYPREQRDHIEKLKTLPVKSASGQWLTLSDVADIRVTQGPAM
FT                   LKSEDARLSSWVFIEPDKGVTVGDYITQVSGVMDKLEIPVGYNWSWTGQYKAMQQVESD
FT                   LKEIIPLTLLVILLLLYMTFRSLPQALLVIGTLPLALTGSLWLIYLLDYNLSLAVIVGM
FT                   IALAGVAAEFGVVMLLYLNNAWKAVAYDKNQLKAAVEEGALLRVRPKAMTVLTIIVGLL
FT                   PIMLGGGVGNEVMQRIAAPMVGGMVLAPLISMLVIPAVFYLARK"
FT   gene            complement(485780..486658)
FT                   /locus_tag="IL0465"
FT   CDS_pept        complement(485780..486658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0465"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81308"
FT                   /db_xref="GOA:Q5R026"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R026"
FT                   /protein_id="AAV81308.1"
FT                   /translation="MNLSHLKMMITVANLGSLQKTAEQLNRTQSAVSMALKKLEENAGF
FT                   ALFNRDGYRLELTEQGQHFLRQAEEVVRQQQRLQSLATQLKHGAEPLLTLCYDHTCDSK
FT                   LWVPSIQHIQQQYPTTELHVDGESQMRALKRIDNGSADLALCPWLPLFRQYGDFETLPV
FT                   APFELTVVISTALMKEFGRMPQSRQDLLELPMLVPQNLEIGINLDAVLRLPSQQRIRVN
FT                   EVNTQFELLMAGFGWGIIPKHIALDALEQGKLVEISIPGFVQQVRLEIHLVRSANRTLG
FT                   PAANAIWESFA"
FT   gene            486765..487832
FT                   /locus_tag="IL0466"
FT   CDS_pept        486765..487832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0466"
FT                   /product="RND efflux system membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81309"
FT                   /db_xref="GOA:Q5R025"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R025"
FT                   /protein_id="AAV81309.1"
FT                   /translation="MRWLKPLSIALAAVVVAACSEQAEVNDTQQARPARLMQVAEADGP
FT                   RLREFPAVVEAAKVAQLTFRVAGEITELPARPGTEVKQGDLIAQLDPTDYQLAADQAKA
FT                   QYELASSQYDRNKVLVNEGVMSEGQFDQIESELAVAKSNYETAKANLGYTKLTAPFDGV
FT                   VANLAVEAYENVQAKQPIVTLQISNAIDISINVPEKLFAKVKKQIDYQPEVRFDAAPEF
FT                   TYPAHLKEWDSQSDGATNTYEVVFTLPKPQNINVLPGMTATVIVDINEVLRSSQIGMVV
FT                   PAKAVFSDTNDASYVWVVNDDMRVQKRKVNVGPMTNDGLTVLDGLQEGETIVIAGVHQL
FT                   KENQQVREWQRERGL"
FT   gene            487832..490885
FT                   /locus_tag="IL0467"
FT   CDS_pept        487832..490885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0467"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81310"
FT                   /db_xref="GOA:Q5R024"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R024"
FT                   /protein_id="AAV81310.1"
FT                   /translation="MNIAQYSMERKTTSWMLFLILLIGGLVALTQLGRLEDPKFTIKQA
FT                   MVITPYPGASAQQVEEEVTYKLENAIQELSYVDHVKSISKPGLSQITVEMKSIYREEHL
FT                   HQIWDELRRKINDTKGQLPPGTSEPIIRDDFADVYGVMMAITGPDYSYKDIEHYADFLR
FT                   RELVLVDGVGKVTLAGEQQEQVVVEVSRSRLANFGVPPSRIAGLLQTQNAVANAGRVTV
FT                   DQEALRIATSGEFANVEDMAKLVISNPGAEQRIYLRDVATIYRETKDIPDHVVRYNGKA
FT                   SLWLALSFADNVNVVEVGERLQKRMDELEYAKPIGMSVDRIYDQPHQVENSVNDFLLNL
FT                   VEAVAIVIIALLLTMGFRSGLLIGTVLLLTVLGTFIFMRLGDINLQRVSLGALIIALGM
FT                   LVDNAIVIADGIMVGMRRGMSKVDAAVSVVKQNQWPLLGATVIGIIAFAPIGLSSDATG
FT                   EFAGSLFWVMLISLLLSWVTALTLIPFLADRLYSAKDIGNSDEQDDVFSHPVYRGYKKM
FT                   LAVCLRHRIISMLVMLVTLVAAVVGFGQAKQAFFPPSTTPLFYVDLWYPQGTDIRHTEQ
FT                   DSKRLEDYLLEKSEVTSVATTIGQGAPRFTLTYLVEKSYESYAQLLVRVEDKDVMDSLM
FT                   RDIRQRIREEHPDVEDKLIRVEIGPATPAKIEARFSGPDIDTLRELSKKAQAILAEDSG
FT                   AVNIRSDWRTPTKLLRPEYDEAAGRRAGITKEDVNNLLLANFVGRQIGIYRDGTDLLPI
FT                   VQRAPAAERVDLDNWQELQIYSPAFDRFVPLAQVARSIDVVWEDPLILRRDRKRTLTVM
FT                   ADHDLLGEETAAQVFERVRPKLEAIDLPLGYELTWGGEHEAAGKAEKALFGALPLGFLV
FT                   MFIITVLLFNSIRQAAVLWTTVPLSIIGVTVGLLLLDKPFGFMALLGFLSLSGMLIKNG
FT                   VVLLEQVNAELDAGKEATHALSDAAVSRVRPVGMAAATTILGMIPLLFDDFFASMATVI
FT                   MFGLGFATLLTLFVVPVMYAIVQRVPRP"
FT   gene            491027..493615
FT                   /gene="acnB"
FT                   /locus_tag="IL0468"
FT   CDS_pept        491027..493615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="IL0468"
FT                   /product="Aconitase B"
FT                   /db_xref="EnsemblGenomes-Gn:IL0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81311"
FT                   /db_xref="GOA:Q5R023"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R023"
FT                   /protein_id="AAV81311.1"
FT                   /translation="MLKEYRQHVEERAAEGIPPKPLNAEQVADLVELLKNPPAGEEDFL
FT                   VELLAERVPPGVDEAAYVKAGFLSAVVKGEIESPVVSKEYAVKLLGNMHGGYNIVTLVE
FT                   LLDDSQLAELAAKELKETILMFDAFHDVEEKMKAGNALAKEVVESWANAEWFTNSDELA
FT                   KSIKATVFKVTGETNTDDLSPAPDAWSRPDIPLHAKAMYKMPREGITDAGKQIEELKEK
FT                   GHPVAFVGDVVGTGSSRKSATNSVLWNIGEDMPGTPNKRAGGICIGSKVAPIFFNTMKD
FT                   AGALVFEADVEKMNMGDVITIYPYEGKIENEAGEIIAEYDYASRVILDEVRAGGRINLI
FT                   IGRGLTEKARESLGMGPSDLFRKPEQPADSGKGFSLAQKLVGKACGMEGVRPGAYCEPK
FT                   MTTVGSQDTTGPMTRDELKDLACLGFNSDLVMQSFCHTAAYPKPVDVETQHTLPDFIMN
FT                   RGGVSLRPGDGIIHSWLNRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAAATGVMP
FT                   LDMPESVLVRFKGEMQPGITLRDLVHAIPAFAIKEGHLTVDKRGKKNIFSGRILEIEGL
FT                   DHLTVEQAFELSDASAERSAAGCTIDLSEESVAEYLRSNITMLRWMINEGYGDARTLER
FT                   RARKMEEWLENPQLTRADKDADYSTVIEIDLNDIKEPIVCCPNDPDDAKFLSEVSGNNV
FT                   DEVFIGSCMTNIGHFRAAGKLLEKNSDPLNTRLWIAPPTKMDKAQLEVEGYYDIYERNG
FT                   VRTEMPGCSLCMGNQARVEPGATVLSTSTRNFPNRLGDGANVYLTSAELAAVGAIVGRL
FT                   PTPEEYLEYAQDINSMAGEVYKYLNFDQMDAFRDAEKAAKENIIPTINVA"
FT   gene            complement(494051..495829)
FT                   /locus_tag="IL0469"
FT   CDS_pept        complement(494051..495829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0469"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81312"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R022"
FT                   /protein_id="AAV81312.1"
FT                   /translation="MPVFVMTPQGKIMRNLILIFGLLGVTACTTTADNQTQRSSTQQLS
FT                   PAAEFHQLADTIWEELNKSSDTELTDMSPEALEKRYQQRSKWLEQLNAVNLNALSRDDQ
FT                   INHAMIHYTLKNKVDEYRFKAHYMPLTAEGSFHSSLAFMPSYTSFSSAEDYQNYIAKLR
FT                   SIPRYMEQQTHWLRKAIEEGYTQPAAAMAGFEESILAYIVQDADQSVYFSPFSEQPGFI
FT                   NDEQWKQLKEDALTAIDQQVMPAYDDYFNFMVTEYLPNARETIGASELPNGDAFYQNRI
FT                   KHYTTLDLTADEIHQIGLQEVARIRGEMLEAIEASGFDGSFDEFVEFLRTDDQFYPETA
FT                   EELLHYAAWIAKKMDGELPKLFKTLPRKPYGIAPVPEEIAPKYTTGRYSGTNRDDRAGF
FT                   YWVNTYALDRRPLYQMEALTLHEAVPGHHLQNAIAGELEDLPEYRQQTYISAFGEGWGL
FT                   YSEYLGLEAGFYEDPYSNFGRLSYEMWRAARLVVDTGMHAKGWSRERAMDFMANNTALS
FT                   LHNVKTEIDRYITWPAQALSYKLGELTIKRLRAEAEQQLGDKFDIREFHDAVLENGSVP
FT                   LKVLEQHINDWIAEQK"
FT   gene            495910..496875
FT                   /gene="yfeK"
FT                   /locus_tag="IL0470"
FT   CDS_pept        495910..496875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfeK"
FT                   /locus_tag="IL0470"
FT                   /product="Dyp-type peroxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81313"
FT                   /db_xref="GOA:Q5R032"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R032"
FT                   /protein_id="AAV81313.1"
FT                   /translation="MDKAQSGVYAEPNLHGLTLFCHVMSDDVESLRRKLARFPAILRDL
FT                   DARFSEGMLTGFVGIGADYWDILYPHKRPLHLQAFPELSDGDREAPRHPYDLVIQIRCD
FT                   RFDANYLAGRTLMEWFGYDIEVAEQIRSFRYLDGRDLTGFIDAPDNPRGMRKRNVALVE
FT                   AQDDADFVDGSYLFVQKFRHDLRRWDYLGPEKQELLMGREKVSGERLSEAKIEGVTHAA
FT                   KSRLIDSSEQPIPLLRQNMPWGDLREQGLLAMYFSHSPKMVVQWLKNRYYADEQGAYDP
FT                   LLDYSQAVSSSGFFVPSMRFMEANKEVADDIADYEEGSTA"
FT   gene            complement(496851..497324)
FT                   /gene="argR"
FT                   /locus_tag="IL0471"
FT   CDS_pept        complement(496851..497324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="IL0471"
FT                   /product="Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:IL0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81314"
FT                   /db_xref="GOA:Q5R031"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R031"
FT                   /protein_id="AAV81314.1"
FT                   /translation="MVQDTLLEAFKTLLREERYGSQGEIVNALKAEGFDNISQSKVSRM
FT                   LSKQGAVRTRNAKQEMVYCLPPDLAVPSTRAPLSQLVLDIQHNDVMVIIRTSPGAAQLI
FT                   ARLLDSVGKKEGVLGTIAGDDTIFIAPLKVADIEFTLRKVRELFANQAVLPSS"
FT   gene            497512..498444
FT                   /gene="mdh"
FT                   /locus_tag="IL0472"
FT   CDS_pept        497512..498444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="IL0472"
FT                   /product="Malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81315"
FT                   /db_xref="GOA:Q5R030"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R030"
FT                   /protein_id="AAV81315.1"
FT                   /translation="MKVAVLGAAGGIGQALSLLLKTQLPAGSELSLYDVAPVVPGVAVD
FT                   LSHIPTDVKVTGFGKDDLASALVGSDIVLIPAGVPRKPGMDRSDLFNMNAGIVKNLVQG
FT                   VADNCPNACVGIITNPVNTTVPIAAEVLKKAGCYDKRKLFGVTTLDVIRSEAFVGELRG
FT                   LNPENVNVPVIGGHSGTTILPLLSQVEGVEFTEQEIKDLTHRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFALSLLKGLQGQDTIECTYVEGPGDNAKFFAQPVRLGKNGAEEILSYG
FT                   KLSAFEQKCMDEMLDGLKGDIQTGIDFAS"
FT   CDS_pept        498749..499780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81316"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81316"
FT                   /db_xref="GOA:Q5QXA4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXA4"
FT                   /protein_id="AAV81316.1"
FT                   /translation="MAIVNRIALDLAKDFIQVLALDENEQEVFNKKLRSNKVLAKLATL
FT                   SRTDDCEVAVESCGMSHYWRRECEKLGYKTVALPPRFVKAYLQGEKNDANDARAIAEAA
FT                   SRPNRQTVRLKSIEQQDLALMVNQREGFVQTRTQFSNRLRGQLAEYGILLPKRVGTILQ
FT                   RVPEVLEDDSNALTLQSRDLINRLYQMLRAVDEEVKALDKHLATQAERNEDSQRLMTLP
FT                   GIGPITATSLLALIGDVSEFKRGRNLSEYLGLVPRQNSSGGKDRLGGITKKGNTKLRTL
FT                   LVHGARSALRVAQQRHDRLSLWAQDVAKRRGNNVAAVALANKHARIIWAMLKNKEDYRM
FT                   TAA"
FT   gene            complement(500344..501318)
FT                   /gene="ispA_1"
FT                   /locus_tag="IL0474"
FT   CDS_pept        complement(500344..501318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA_1"
FT                   /locus_tag="IL0474"
FT                   /product="Geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81317"
FT                   /db_xref="GOA:Q5R028"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R028"
FT                   /protein_id="AAV81317.1"
FT                   /translation="MMDMQSINALAKDDMLGVNALIGEQLQSDVALINQLGLYIVNSGG
FT                   KRLRPLLAILACRALGYEGNDHRKLATIIEFIHTATLLHDDVVDESELRRGRKTANAVF
FT                   GNEASVLVGDFLYTRAFQLMVDLDSLRILRILADATNIISEGEVLQLMNCNDPDTSEAS
FT                   YFNVIYGKTAKLFEAATELAGVLTAQDEKVTQQLADYGRYLGTAFQLVDDLMDYTADSE
FT                   SMGKNAGDDLAEGKPTLPLLYAMWHGNEIEQKLIREAIEQGDGREHLQTVLTAMERTGA
FT                   LQYTRDKALEAAEQARESLSELPDSDYKQALLTLTHLAVDRVA"
FT   gene            501508..501819
FT                   /gene="rplU"
FT                   /locus_tag="IL0475"
FT   CDS_pept        501508..501819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="IL0475"
FT                   /product="Ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:IL0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81318"
FT                   /db_xref="GOA:Q5R027"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R027"
FT                   /protein_id="AAV81318.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQIVRLEKLEAATGDVVEFDQVLMVSDGN
FT                   DVNIGAPFVSGGKVKAEVIDHGRGDKIKIVKFRRRKHSRRQQGHRQWFTEVKITGINS"
FT   gene            501835..502092
FT                   /gene="rpmA"
FT                   /locus_tag="IL0476"
FT   CDS_pept        501835..502092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="IL0476"
FT                   /product="Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:IL0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81319"
FT                   /db_xref="GOA:Q5R033"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R033"
FT                   /protein_id="AAV81319.1"
FT                   /translation="MAHKKAGGSTKNGRDSESKRLGVKRFGGESVLAGNILVRQRGTKF
FT                   HAGANVGIGKDHTLFATSEGKVSFDVKGSKNRKFVSVITD"
FT   gene            502209..503363
FT                   /gene="obg"
FT                   /locus_tag="IL0477"
FT   CDS_pept        502209..503363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obg"
FT                   /locus_tag="IL0477"
FT                   /product="GTPase Obg"
FT                   /db_xref="EnsemblGenomes-Gn:IL0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81320"
FT                   /db_xref="GOA:Q5R039"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R039"
FT                   /protein_id="AAV81320.1"
FT                   /translation="MKFVDEVEIRVDAGDGGNGCISFRREKYIPKGGPDGGDGGDGGDV
FT                   YLEADENLNTLIDYRFERFHKAERGKNGMGKNCTGRRGNDIVLPVPPGTRATDIDTGEV
FT                   LGDLTKHGQRLMVAKGGFHGLGNTRFKSSINRAPRQKTDGTPGEVRPLKLELMLLADVG
FT                   LLGMPNAGKSTFIRSVSAARPKVADYPFTTLIPNLGVVRPAPHQSFVIADIPGLIEGAA
FT                   EGAGLGIQFLKHLERCRLLLHLVDLAPFDETDPAEQARIIINELEKYSPKLAEKPRWLV
FT                   INKVDLLLDEEVQEKVDELVKSLNWDGPVFQIAALEGRGSDALCREVMSYLETLPAPDT
FT                   EQHEEADPVEFMWDTYHEEVLEEEMDDEDDDDDDDHDVEVIYQK"
FT   gene            503435..503935
FT                   /gene="folA"
FT                   /locus_tag="IL0478"
FT   CDS_pept        503435..503935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="IL0478"
FT                   /product="Dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81321"
FT                   /db_xref="GOA:Q5R038"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R038"
FT                   /protein_id="AAV81321.1"
FT                   /translation="MKISLVVAMADNRVIGKDNKMPWHLPDELQYFKKITLGKPIVMGR
FT                   RTFESIGRPLPGRKNIVLSRRTDRSENQDSQVVWVSGVQQAIAAAGPVEELMIIGGGKI
FT                   YEKFLPLADRLYVTKIELNVEGDTYFPDYHQVADWQEIERQNFAADERNSHNFSTLIFD
FT                   RVS"
FT   gene            504046..504420
FT                   /locus_tag="IL0479"
FT   CDS_pept        504046..504420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0479"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81322"
FT                   /db_xref="InterPro:IPR022193"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R037"
FT                   /protein_id="AAV81322.1"
FT                   /translation="MKAIVLGTMMAAVAATGVTFSKSAEANELALSLCTYVQGDDTMRM
FT                   RKKLRDARVRVRDIYSGIQCNGQSLLQFAMSNGSQDIGEFIVGRLSVDELKASGDYEWA
FT                   QSNGHGSSAIAVAIKDRAGL"
FT   gene            504568..506013
FT                   /locus_tag="IL0480"
FT   CDS_pept        504568..506013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0480"
FT                   /product="Probable secreted peptidase of alpha/beta
FT                   hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81323"
FT                   /db_xref="GOA:Q5R036"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R036"
FT                   /protein_id="AAV81323.1"
FT                   /translation="MKQWMALSLLLLGLIPHSGQAQTKINEASGCYLPGVQEKLHCGTV
FT                   SVPENYEQPDGKHIGIYYAILPAIQEGAQADPMLILAGGPGQAATELTPMIARMFEAVR
FT                   QKRDILLIDQRGTGKSHPLECGIERPDELIRADDEQDLRALSRECQEQYPDTDTTQYHT
FT                   VNAVKDFERVREHLGIEQLNLYGGSYGTRVGLTYLREAPSSVRTATLDAVAPPQVIIGP
FT                   FGQHGANAFDEMLKDCSEQSPCHEKFPNLEQEYYEVMSELEAENILLETRDPLSFEPLE
FT                   IKLTPGRFSSIIRVALYHPSTRQLLPYAIHSAAEGNYHAILGLMGGTMSQNSIYLGLML
FT                   SVVCGEDLPRATPELFAQDGNNEFIGSRTGDAFVDMCAGWQSSSVPSYWSDPVVSDKPV
FT                   LLLSGELDPVTPPEWGEIAHRTLPNSKHLIAPNAGHTIASHTCANKLIADFIEQGSIEN
FT                   IDGSCLKEQRLKPFVLNQNAAGL"
FT   gene            506017..506751
FT                   /gene="natA_2"
FT                   /locus_tag="IL0481"
FT   CDS_pept        506017..506751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA_2"
FT                   /locus_tag="IL0481"
FT                   /product="ABC-type Na+ transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81324"
FT                   /db_xref="GOA:Q5R035"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R035"
FT                   /protein_id="AAV81324.1"
FT                   /translation="MINVDALTKTFKNVQALDSLSFQAKDGEITGLLGPNGAGKTTCLR
FT                   IIYGLLQADTGKAEIEGVDANQNPIDARRNLGIFPDKFGLYERLTVREQVAYFAGLHGL
FT                   KGTEQKQAVEKVIEKLDIKELADRRTAGFSQGQRMKVALAQALVHSPKHLILDEPSRGL
FT                   DVMSTRILRDVLREQRAQGTCILFSSHVMQEVAALCDRVVVMAKGKVAAEGTPQELCDM
FT                   TGEQQLEDAFVKIIGTDEGIAA"
FT   gene            506751..507896
FT                   /gene="natB_2"
FT                   /locus_tag="IL0482"
FT   CDS_pept        506751..507896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB_2"
FT                   /locus_tag="IL0482"
FT                   /product="ABC-type Na+ efflux pump, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81325"
FT                   /db_xref="GOA:Q5R034"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R034"
FT                   /protein_id="AAV81325.1"
FT                   /translation="MSALTSVWKKEFRDAIRDKRSVLAAMSYAFFGPLLMAVAFFFLIT
FT                   QLTDPADVEITIEGKENAPQLVEFLNERGVVAKEGEWAKTETPIILTLPQNWQESVSKA
FT                   EPVEVTLRADWSAQKQQTEIKRVEQAVQAYSSQIAAYRLTLRGVDPRVVQPIQLQKQDL
FT                   ATRGSKAALIMGSVLVFIILSVFWSGMNVAIDISAGERERNSLEFLLSQPLSTWDIVTG
FT                   KALTATTFSLFGAILSLVLIPIIFAYVPLHEIGMNVNFSVGMMLLMFVLLVPLALFATA
FT                   LQLFVSFRAKNFKEAQTYISFLLIIPMAASFGVEFARLKNPILYYLPLTGQHQAFLSLI
FT                   RGENVNVMGTVISAIATLAAALLLMKYIARMLKSEKIVFGL"
FT   gene            complement(508260..509579)
FT                   /gene="ordL"
FT                   /locus_tag="IL0483"
FT   CDS_pept        complement(508260..509579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="IL0483"
FT                   /product="D-amino acid oxidase family protein
FT                   (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81326"
FT                   /db_xref="GOA:Q5R040"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R040"
FT                   /protein_id="AAV81326.1"
FT                   /translation="MYDPLVNAPPGPHDAPEPSYWQQHTQAEFPECVDAPEEVEFAVIG
FT                   AGYTGLNAARVLAENGHSVAVFEANQLAWGCSSRNAGFVMKSTGRLGLSAWAERLGADI
FT                   AQDIADEHQKALQLVEETLRYCPSQCQRQNGGYLKIAHRNSAVAPLKQQYEQLKKFNQP
FT                   VEWLTQNQLSGLISSPQAHAALRFTDCFTLNPILLAAATARRATAAGAQLVEHCPVTQA
FT                   VSLGGKGVYLQTAKGSVRARKLLVCSNGYTSGKLLPELASRSLPVLSSIITTPPLSNEQ
FT                   VESIKLSPQYAIMDTRILKYYFRLLPDNRLLFGGRGAIQGKSAEKPIYAKRLLQALHQT
FT                   FPQLREVNKWEYFWSGWVSVSLDDYPRVGKVKDNIYASMGYCGAGVGFTALAGQRLAEA
FT                   AMEKNLPELPYYQSKLKPFPLPRFRRLGQWLYYHYGRLRD"
FT   gene            complement(509862..510431)
FT                   /locus_tag="IL0484"
FT   CDS_pept        complement(509862..510431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0484"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81327"
FT                   /db_xref="GOA:Q5R046"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R046"
FT                   /protein_id="AAV81327.1"
FT                   /translation="MSDIIYREITAADMAAVIDLANEVHGDNYLNEDSFQQYLAGGTAG
FT                   NVQLNWIALRGETPLGVRITLAPGQWPIDDFCTPDAWPIPAEKLCYFKCAAVSEKARGL
FT                   GIGKELLFRSIETAKELGCRGGLAHIWMQSPNNSAYEYFTRCGGEMIKQHEKRWYKASV
FT                   EDGYYCPVCDGTCYCNAGEMLLKFDT"
FT   gene            complement(510431..511810)
FT                   /locus_tag="IL0485"
FT   CDS_pept        complement(510431..511810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0485"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81328"
FT                   /db_xref="GOA:Q5R045"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R045"
FT                   /protein_id="AAV81328.1"
FT                   /translation="MSAENSQDYKVADISLAEWGRKEIAIAESEMPALMTIRRKYADSK
FT                   PLAGARIIGCIHMTIQTAVLIETLLELGAEVRWSSCNIFSTQDHAAAAMAAAGVPVFAW
FT                   KGETEEEYDWCLKQTCHKDGELWDANMILDDGGDLTLMIHDEFPQMLEKVHGITEETTT
FT                   GVHRLLDMLEKGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRSTDHLLSGKKALV
FT                   VGYGDVGKGSAASLRQEGMIVKISEIDPICAMQACMDGFEVVSPYLEGKNNGTGDNINK
FT                   DLLSNTDLIVTTTGNMDVCDRYMLAALKPTALVCNIGHFDNEIDTAFMRKNWRWEEIKP
FT                   QVHKIYRSDDDNDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLFEQKFADM
FT                   EIKQQEEYLRVEVLPKQLDEEVARYMVQGFGGVITKLTADQANYIHVDVEGPFKTDEYR
FT                   Y"
FT   gene            complement(511858..512868)
FT                   /gene="gsk"
FT                   /locus_tag="IL0486"
FT   CDS_pept        complement(511858..512868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="IL0486"
FT                   /product="Sugar kinase, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81329"
FT                   /db_xref="GOA:Q5R044"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R044"
FT                   /protein_id="AAV81329.1"
FT                   /translation="MKTIDVVGIGNALVDQEFEVSEDFLKKHDLKKGMMELIDEYAQNT
FT                   LIAELSQLGELKKQSGGGSAANSLVAFAQFGGKAYYCCKVADDEAGMFYRQDLEKIGIE
FT                   TSLHQQKNPGTTGRCLVMVTPDAERTMRTHLGITADLSSAEIDDHAIAAADYLYIEGYL
FT                   ITSEIARGAIQHAKKVARENNTKLVMTCSDPAMVKFFRSGIDEILDGGVDLMFCNREEA
FT                   ELLTGKDDPQAALSVLLKQADTVAITLGKDGAVIANRERQVHIPGVPVKAIDTNGAGDM
FT                   FAGAMLYGLTRNMSLEDAGRLASHAAAELVTEFGPRLNKDRQQQLIERVMSAQTA"
FT   gene            complement(512918..513874)
FT                   /gene="cbiB"
FT                   /locus_tag="IL0487"
FT   CDS_pept        complement(512918..513874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /locus_tag="IL0487"
FT                   /product="Cobalamin biosynthesis membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81330"
FT                   /db_xref="GOA:Q5R043"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R043"
FT                   /protein_id="AAV81330.1"
FT                   /translation="MNTELLTDIILSPVALALLALLAERWFPWPEQWHPFAVLRLMAAY
FT                   MSGKVNRPNRPVGQQRLAGFLAWLTMSLLVLLPAAIVFAGAEVSLAIGWLILLVSLRQQ
FT                   PVSHAVKLADSHLQRGRKNAARAWLSRITWRDCDLLSEHGIAKTSIELRATSILEHRFT
FT                   PLLFWFVGGPLAALGVRTLSELTQVWPVAQAKYRHFGLATHWLHTITHFLPSFILALAA
FT                   RFMALFQRNKFRLQPLKRNPLFSTILLSWLQSFSYCHRVSLGGPIQVQGIRIARQRFDG
FT                   RPAELLIPRASRWQRQWQGFFIACLLIALFALFIYRP"
FT   gene            complement(513899..514450)
FT                   /locus_tag="IL0488"
FT   CDS_pept        complement(513899..514450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0488"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81331"
FT                   /db_xref="InterPro:IPR014538"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R042"
FT                   /protein_id="AAV81331.1"
FT                   /translation="MEIILLLFVVVLIAVAIIASRMSENYVPYPYKLKDVSLCTAQEDQ
FT                   FLTLLEKSVGDSFRIFTKVRLSDIVTVRSGLSSTARKDAHNKASQRILDYVLCDIHTMQ
FT                   VKAAIELEPGQSSLNQQKRNLFLKNTLAAAGLPFLRFKAKPGYRVAELHDYIHGKIRQA
FT                   EHVRAAVPTNKDKNKQPIAA"
FT   gene            complement(514543..515469)
FT                   /locus_tag="IL0489"
FT   CDS_pept        complement(514543..515469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0489"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81332"
FT                   /db_xref="GOA:Q5R041"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R041"
FT                   /protein_id="AAV81332.1"
FT                   /translation="MPTVMPDVANQTQAQTEGALDWVGMSNIEVPLMVAAAGVPERPVA
FT                   AKVEAFVNLKNPKTKGIHMSRLYLLLDKMSTEGELSHDTLKQLLNDFIESHKDISDQAF
FT                   IKFDFDYHLRRKSLISKKQGWKAYPVSLTGRYDAGQLKLELSVDVPYSSTCPCSAALAR
FT                   QLIQDAFSEKFAGQEQVDASIMHEWLGSTEGIVATPHSQRSVAEVKVALSDSVNDFPIV
FT                   ELIDAIEGALKTPVQAAVKREDEQEFARLNGQNLMFCEDASRRLQHQLNQMSNFRDFWL
FT                   RVNHYESLHAHDAVSVTTKGVPGGYSA"
FT   gene            515669..516019
FT                   /locus_tag="IL0490"
FT   CDS_pept        515669..516019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0490"
FT                   /product="HPt domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81333"
FT                   /db_xref="GOA:Q5R052"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R052"
FT                   /protein_id="AAV81333.1"
FT                   /translation="MAEKSAIDTELLQQYVDTLGVEGVNSTLATFDGIIQSYAQLLHQA
FT                   AKSRNEDELRKQAHKVKGACGSVGLTELSKLMEKVEKDEWEWPVAERLLIEWADAVIPH
FT                   RRQIDAWLAEHH"
FT   gene            complement(516075..516734)
FT                   /gene="arcA"
FT                   /locus_tag="IL0491"
FT   CDS_pept        complement(516075..516734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="IL0491"
FT                   /product="Response regulator (CheY,wHTH domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81334"
FT                   /db_xref="GOA:Q5R051"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R051"
FT                   /protein_id="AAV81334.1"
FT                   /translation="MNARILIVEDEVVTRQTLTRLFQQEGYEVFDAADGLQMENIMRQE
FT                   RVDVVIMDVNLPGKNGLELAESLRESDNIGLIFLTGRDSEDDRLLALELGADDYLIKPY
FT                   NPKELTIRVRNLCRRIEASRSGSPVENNSVEFQFHGWRLNSDSRCLYSPENQMFRLPKS
FT                   EYRALEYFYLTRAAFLTVKHWLNVCWIANCVRMTVPLTLPFVAFVGILSLTRKHRT"
FT   gene            complement(516835..518454)
FT                   /locus_tag="IL0492"
FT   CDS_pept        complement(516835..518454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0492"
FT                   /product="Signal transduction histidine kinase (contains
FT                   HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81335"
FT                   /db_xref="GOA:Q5R050"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R050"
FT                   /protein_id="AAV81335.1"
FT                   /translation="MHTISLKRILIYIVLLVTSFALLVGFTVNIVSQVAQYQESLHDQA
FT                   LSYSRIVAGNAASSLVFNDNANEKQRLSSLENTSFIQHVHVYKMDETSNELTFFSSYNK
FT                   KGLPPIPARFAKLDKLTTPQTNDNYIEVSQPVVLDDEVIGYVYLRGSLEQARLFMWRSI
FT                   GIASVVFVLTLLLCWLITLRLRKTIVTPLDSVVDVISQVARDKNYSLRLAPSKLVEFDM
FT                   MAHAFNTMLDRVQQHISRQRRAEEEASQLNTELERQVTQRTQALKESNSELLKTLEQLH
FT                   QYQGQLVESEKMASLGDMVAGIAHEVNTPIGLSVTASTLLQDKLTIMQEKFDEKRISTS
FT                   EFERFLSDCDENLQIIYRNLGRAADLVTSFKQVAVDQSSEIDRDIHIPSFMNDVLISVK
FT                   PRRLDPEKFPIRISCPEGLTVRAKAGPLNQVLINLIVNSMIHAFEGYSSGRVDISFTMV
FT                   GDDKLEMVYTDNGKGVPSDINRKIFDPFVTTKRGSGGSGLGLHLVYNLVTQVLGGNIHF
FT                   FSEEKNGVEFIVRFPVTLVSNA"
FT   gene            complement(518551..519555)
FT                   /gene="rsmC"
FT                   /locus_tag="IL0493"
FT   CDS_pept        complement(518551..519555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="IL0493"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:IL0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81336"
FT                   /db_xref="GOA:Q5R049"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R049"
FT                   /protein_id="AAV81336.1"
FT                   /translation="MSAAILSMLGRQSAQPWANGSLLVIHPGGGELSALPNASAWSFHA
FT                   GHAAYWKAAGRPVFCQIQPPNLSHYDGVLFLVAKEKELNQYLLEQLASLPTGTPVWFAG
FT                   EKRSGIQPLMKHLPAWLQPPQKLASANHCLLFASERNEQVHQSASIEDYAKNITYELNQ
FT                   QQESFVTLPGVFSREHIDPATLLLLQHIKDLPKGRGMDFACGAGVIAKQLASVATELMA
FT                   CDVSPIAIAASEITLANEPVKTELRLADGIPDNAGQFDFIVSNPPFHTGQRTDYEIARE
FT                   FISNARQHLNKQGVFRVVANRFLPWPEVIESVFGNCSVIADDGRYRVYHATCR"
FT   gene            complement(519572..521278)
FT                   /locus_tag="IL0494"
FT   CDS_pept        complement(519572..521278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0494"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81337"
FT                   /db_xref="GOA:Q5R048"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R048"
FT                   /protein_id="AAV81337.1"
FT                   /translation="MSSPVSFRVSERDVYISIDAGTPPSEVKADKLQQAWQASKFSAAK
FT                   LLDPQMLLQTATKYAQHYSKDSNSSIPFQVAIAEIFDADLNLQVSDDDMKVTASGIVGY
FT                   GGKALTQEIIIAKLKEKKITSGIQRKAIDALVEHTNEAPPGAELSVTVAKGKYPINGSN
FT                   AKFKPLTDDARKRVLRPQLREDGTADMRDLGAEVTVDPDHPLLQKIPPSKGRAGFTVFG
FT                   QELEARDGEDRDFKPGEGTRVSDTDANLIVADRTGMPSFSENSVQVDDVMQLNNVDVST
FT                   GHVKFKGSVIVTGNVSEGMKVTCSGDITVGGYVDSAELHAEGNITVRKGCIGHLIHSGD
FT                   NAENDEDADEWIPDVSTKLIAGGSIWCAYAQYSYFEAQTGVNTDKQLTHCHVITKGPLA
FT                   IGGEGRNARGKLIGGTIETCAHVYCGQLGAPAGTKTRIYWSLPPADPQSLEHLNSMRAL
FT                   LTKTLARVKVVQQGLNRCDKLEDGVKKLEYQKKLKIELRKLKTRIINTRTSIDSILEAF
FT                   ENHPVLRTMVSKEVFPGILFIFKEKSLRIKEHRNGTMFLLQDKQLRVDSLL"
FT   gene            complement(521357..521713)
FT                   /locus_tag="IL0495"
FT   CDS_pept        complement(521357..521713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0495"
FT                   /product="Probable signal transduction protein, containing
FT                   Hpt domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81338"
FT                   /db_xref="GOA:Q5R047"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R047"
FT                   /protein_id="AAV81338.1"
FT                   /translation="MSSNSAQIDFNRGLRHCDNQHSLYREVLNCYLEQFAPLLNTEDLL
FT                   EDVEAARLKLHTLKSLSATIGATDLSLLAAQLFKDWQLKTYEQRIEAVTQVNAELAAVN
FT                   EKIASYCNDVVPDD"
FT   gene            complement(521703..522725)
FT                   /locus_tag="IL0496"
FT   CDS_pept        complement(521703..522725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0496"
FT                   /product="Metal-dependent hydrolase of the
FT                   aminoacylase-2/carboxypeptidase-Z family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81339"
FT                   /db_xref="GOA:Q5R060"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R060"
FT                   /protein_id="AAV81339.1"
FT                   /translation="MNGFELAGQWVEPGSHQHITLPALRLYNDAPLDLRIDVFHGTKPG
FT                   PVLLICAAIHGDELNGIEVCRRLINTTDARTLSGTLVVVPIVNLFGFIQQSRYLPDRRD
FT                   LNRCFPGSERGALGSRMAYLFSEELVKKSTHIVDLHTGAIHRSNLPQIRVDVENEKALA
FT                   MAKVFSTPVILHSKERDGSLRALANELGIPLILYEAGEGLRFDEASISAGVIGVENVMK
FT                   HLKMMKGRRRGRRITPVIARRSTWVRAERDGLIIPKVELGQTIQKQQVLALSVNPHGGE
FT                   GDAIESPVRGIIIGCSNIPVANEGEALFNVAQFDKDAMSDATESVDSFTEVYENKPYEQ
FT                   "
FT   gene            complement(522727..523632)
FT                   /gene="rimK"
FT                   /locus_tag="IL0497"
FT   CDS_pept        complement(522727..523632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="IL0497"
FT                   /product="Ribosomal protein S6 modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81340"
FT                   /db_xref="GOA:Q5R059"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R059"
FT                   /protein_id="AAV81340.1"
FT                   /translation="MRIAILSRNASLYSTRRLVEAAEERGHEVDVLNPLRCYMNINARE
FT                   SSIHKHGKELPHYDCVIPRIGASVTFYGTAVLRQFEMIGSYPLNESVAISRSRDKLRSL
FT                   QLLSRKGIGLPTTGFASQPQDIPDLIDMVGGAPLVIKLLEGTQGIGVVLAETRQAAESV
FT                   IEAFMGLHSNFMVQEYIKEAGGADIRCLVIGDKVIAAMKRQAKAGEFRSNLHRGGSASL
FT                   VKLTPAERATAVKAAKTMGLNVAGVDILRSNHGPLVMEVNSSPGLEGIEQATEKDVASQ
FT                   IITFLEKNAKAHKTRTKGQG"
FT   gene            complement(523629..524051)
FT                   /locus_tag="IL0498"
FT   CDS_pept        complement(523629..524051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0498"
FT                   /product="Predicted aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81341"
FT                   /db_xref="GOA:Q5R058"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R058"
FT                   /protein_id="AAV81341.1"
FT                   /translation="MTTIGWQEWGALPELNINLIHMKVDTGAKTSCLHAFKLEPFERDG
FT                   QEWLRIFMHPEQGSLREQVCEAPVFDKREVTDSGGHTETRYVIRTRLQLGKFDQAVELT
FT                   LTNRDTMKFRMLLGRQAMRGNFIVDPQASHLLGEEQ"
FT   CDS_pept        524214..525245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81342"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81342"
FT                   /db_xref="GOA:Q5QXA4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXA4"
FT                   /protein_id="AAV81342.1"
FT                   /translation="MAIVNRIALDLAKDFIQVLALDENEQEVFNKKLRSNKVLAKLATL
FT                   SRTDDCEVAVESCGMSHYWRRECEKLGYKTVALPPRFVKAYLQGEKNDANDARAIAEAA
FT                   SRPNRQTVRLKSIEQQDLALMVNQREGFVQTRTQFSNRLRGQLAEYGILLPKRVGTILQ
FT                   RVPEVLEDDSNALTLQSRDLINRLYQMLRAVDEEVKALDKHLATQAERNEDSQRLMTLP
FT                   GIGPITATSLLALIGDVSEFKRGRNLSEYLGLVPRQNSSGGKDRLGGITKKGNTKLRTL
FT                   LVHGARSALRVAQQRHDRLSLWAQDVAKRRGNNVAAVALANKHARIIWAMLKNKEDYRM
FT                   TAA"
FT   gene            525603..526337
FT                   /locus_tag="IL0500"
FT   CDS_pept        525603..526337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0500"
FT                   /product="Signalling protein containing EAL domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81343"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R056"
FT                   /protein_id="AAV81343.1"
FT                   /translation="MSVCPSCDCRKPLGFGIKMAFQPIVDISDKSVFAHEALVRGENGE
FT                   GAGRILGQVTEDNKYTFDQSCRVKAIETASRIQLPGSLSINFMPNAIYEPETCLATTLS
FT                   TARKTGFDRNKIIFEVTEQEQVVSQEFLVEVFEAYRKEGFRTAIDDFGAGYAGLNLLAD
FT                   FQPDILKIDMKLIRDINQNKVKQTLVRSIQQISEELGIQLIAEGIETEDEYKYLRDSGI
FT                   TLMQGYFFQKPMLEAFQNINFP"
FT   gene            complement(526386..527048)
FT                   /locus_tag="IL0501"
FT   CDS_pept        complement(526386..527048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0501"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81344"
FT                   /db_xref="GOA:Q5R055"
FT                   /db_xref="InterPro:IPR021367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R055"
FT                   /protein_id="AAV81344.1"
FT                   /translation="MQFNVSPQAKRNALTFCGLAVLLFALLVFLHLVRDDIPVGVTVVL
FT                   GATSGIFLLLGIGKVIEPPVSLVITEDGIRYLHRRGQWQIRWENIIRYDVPRVNRVLEL
FT                   EDAPFLGFRLYQVEEVLDDISPRLASALLFEQRQLLTMALRHQAPEREDYTPYFDIPDS
FT                   YISPNGTVYKGLIGVFGKRMEQMRELLGYDLYVSSNALDRDIYDFKAHLQKLQASRT"
FT   gene            complement(527083..527757)
FT                   /gene="mutH"
FT                   /locus_tag="IL0502"
FT   CDS_pept        complement(527083..527757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutH"
FT                   /locus_tag="IL0502"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81345"
FT                   /db_xref="GOA:Q5R054"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R054"
FT                   /protein_id="AAV81345.1"
FT                   /translation="MTDKPQRPQSIDELFQRAAALAGRTFADLAAETGLQVPKDLRRDK
FT                   GWVGQLLELQLGATAGSKPTQDFPELGVELKTLPVTPDGEPLETTFVCTAPLVNIQGVQ
FT                   WTTSNVRNKLQQVLWLPIDGRREVPLAERVVGSAFLWVPSEQEEALLRNDWEEHMDRIA
FT                   LGQVESITARQGEAMQIRPKAADGSALTEAIGPEGTIIEVRPRGFYLKKDFTRQILQRM
FT                   FM"
FT   gene            527852..528364
FT                   /locus_tag="IL0503"
FT   CDS_pept        527852..528364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0503"
FT                   /product="NTP pyrophosphohydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81346"
FT                   /db_xref="GOA:Q5R053"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R053"
FT                   /protein_id="AAV81346.1"
FT                   /translation="MIDAEGFRANVGIVICNGHGQVFWARRINQQSWQFPQGGIHEGET
FT                   PEQAMYRELYEEVGLKPEQVEILYTSRQWLRYRLPKRLIRREQRPMCVGQKQKWFLLRL
FT                   KCREEDVDVLHSGHPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFATQAMPFRASGG
FT                   RQHRRKR"
FT   gene            528367..530640
FT                   /gene="ptsP"
FT                   /locus_tag="IL0504"
FT   CDS_pept        528367..530640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="IL0504"
FT                   /product="Intracellular signaling protein (GAF,PtsI
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81347"
FT                   /db_xref="GOA:Q5R067"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R067"
FT                   /protein_id="AAV81347.1"
FT                   /translation="MMLVTLQRIVQGVNKAPDFNMALTTMVSQVREALETDSCSVFLAD
FT                   NDQRQFVMAASDGLRAEDGKPVRVDFGEGIISLAAQREEPLNIADASMHPANKKLSDTN
FT                   ENIYKGLLAAPIIHRRKVLGIVVVHQSVARSFSREEEAFIVTLAAQLAAVIAHADAKGL
FT                   LVSEHSPWIHSLRGLPGSPGVAVGEAYVSRPEARIDEVTPRRSDKPIHEIRKFRQAVAR
FT                   TRADLKELSRRMAGQVPDDTLAIFDVYQGMLDAASMGDAVENMIKEGWRAQTALKYVVE
FT                   QFVAQFEALEDSYLQERATDVRDIGQRVLLHLQNRQRKRKPLPDNFILIADEVTASMLA
FT                   ELPREQIAGIISLNGSSNSHAAIMARSMNIPAVLGVDDIELHFFSDRLLAVDGYTGEIY
FT                   VDPPAQVLTQFHQLAEEEQELRDIVTEHSHLPAETQDGQRISLHLNLGLDVTHDYLKTL
FT                   NIDGVGLYRSEIPFMMRDQLPTEDEQTEMYQEVLDQFPDQPVVMRTLDVGGDKPLPYFP
FT                   LKEDNPFLGWRGIRLTLDHPEIFLIQIRAMLRASIGKSNLRILLPMITSTSEVDEASRL
FT                   IKQAYFEVAEEQGCEVGVNLFQPQLGVMIEVPAAIYQLPAMASKVDFFSVGSNDLTQYL
FT                   LAVDRNNRRVASLYDAYHPAVLASLDEIARRCEEIGKPVSVCGELAGDPGGALLLVAMG
FT                   YRQLSMNSYNVDRVRWILRNVRSSTLNVMLAKALQARNPDQIRKMIAEKMESIGLGGFV
FT                   RAGK"
FT   gene            530643..531434
FT                   /locus_tag="IL0505"
FT   CDS_pept        530643..531434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0505"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:IL0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81348"
FT                   /db_xref="GOA:Q5R066"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R066"
FT                   /protein_id="AAV81348.1"
FT                   /translation="MLLTTWIWCIGGGAVAGLLAGLLGIGGGLVIVPLLIYLLPIIGVP
FT                   PELVVPSAIATSLATICMTTASASRAHAKHGLMEKFWLIRVLPGLSVGAMTGAFLVTVV
FT                   DPDWLKIIFSIVLIALAARMVLPQKTGEPLTSVSKRLVALGSYIIGTISGLVGIGGGAL
FT                   TVPFLSRMRLPVRQAIAISSLGSFVIGCSSVVMFILNGWLSGRETGALGLINVPAWLGI
FT                   SVASVLFAPLGAKLAHKLPVKQLQRVFAAFLILVAIQLIFN"
FT   gene            531458..532258
FT                   /gene="lgt"
FT                   /locus_tag="IL0506"
FT   CDS_pept        531458..532258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="IL0506"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81349"
FT                   /db_xref="GOA:Q5R065"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R065"
FT                   /protein_id="AAV81349.1"
FT                   /translation="MPSNDYWQFPAIDPVLFHIWGPLDIRWYGLAYIAAFAFAYFWGMR
FT                   QTKTDPNWSKEEFSDLMFWGFIGVILGGRIGYTLFYHFDYFIDNPLYLFYIHEGGMSFH
FT                   GGLLGVIAAMYLYARKKQRSFLQVGDFVAPLVPMGLFFGRIGNFINGELWGRAAEVPWA
FT                   MYFPSGGPVPRHPSQLYEALLEGLLLFAVILWFQRKPRGVGAVSGLFLLGYGVARFIVE
FT                   FFREPDAHLGLLSLGMSMGQWLTLPMIILGIILMVRAKKQLPTG"
FT   gene            532477..533328
FT                   /gene="thyA"
FT                   /locus_tag="IL0507"
FT   CDS_pept        532477..533328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="IL0507"
FT                   /product="Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81350"
FT                   /db_xref="GOA:Q5R064"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R064"
FT                   /protein_id="AAV81350.1"
FT                   /translation="MKQYLQLCQRIVDEGVWVKNERTGINCLTVINADLEYDVANNQFP
FT                   LITTRKSYYKSAIAELLGYLRGYNSAAQFRDIGCKTWDANANENQAWLNNPNRKGEDDM
FT                   GRVYGVQGRSWQKPDGSHLDQLKKVINNLSKGIDDRGEIVTFYNPGEFELGCLRPCMHT
FT                   HNFSLLGDTLYLTSYQRSCDVPLGLNFNQIQCFALLALVAQITGHKPGKAYHKIVNAHI
FT                   YENQLELMRDVQLKREPFPSPQLHINPEIKSLEDIETWVSKDDFIVSGYQCHDPIKYPF
FT                   AV"
FT   gene            complement(533451..533882)
FT                   /locus_tag="IL0508"
FT   CDS_pept        complement(533451..533882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0508"
FT                   /product="Transposase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81351"
FT                   /db_xref="GOA:Q5R063"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R063"
FT                   /protein_id="AAV81351.1"
FT                   /translation="MRTHPFEIEAWVVMPDHLHCVLRIMDTNAPVRWSKIKALTSKALP
FT                   EFSAKNYSKHYKNKSRQKRQLSSLWQKGYWEHTIRNEKELYMYLLYCCYNPVKHRYVSN
FT                   ATEWPYSTLNRYLRNNRYPPDWAYINESWVDSNLAAYDP"
FT   CDS_pept        complement(534125..535138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81352"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81352"
FT                   /db_xref="GOA:Q5R062"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R062"
FT                   /protein_id="AAV81352.1"
FT                   /translation="MTAYVGIDVSKKKLDVGFYSDKLGKNGQRKKKTKVFKNDRQAFSQ
FT                   LESWLKQQTQHKAQNIAIGIEATGIYHEALIYTLHEQGFKLFIANPGRAKKYFESLGVT
FT                   HKTDKSDSLLLARFTEDKAHKGDITWWEPESPEARHLKLLLRRLNALQKDVLRERNRLE
FT                   ACANTDTSPRVVKSIEDMIAVLNEEIKALLKEIDDHIDGHPQLKKNRELLESIDGVGPT
FT                   VSRELTSLFSVKRFSSAKEAAAYLGLIPRLQESGSHKGMTRLSKIGPSAIRALLYLPAV
FT                   VASRCNPDIAYQKQRLLAQGKTKMQALGAAMRKLVQICFGVIKHQEEYRPQTSLSV"
FT   gene            535523..536545
FT                   /locus_tag="IL0510"
FT   CDS_pept        535523..536545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0510"
FT                   /product="Chemotaxis response regulator"
FT                   /note="contains two CheY domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81353"
FT                   /db_xref="GOA:Q5R061"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R061"
FT                   /protein_id="AAV81353.1"
FT                   /translation="MTLKVTLCDDSKMARKQLLRTLPDDWDAEVHQAEHGEQALTCLRE
FT                   GRAEVLFLDLNMPVKDGYETLQAIKEEQLETLVIVVSGDIQPEAQKRVQALGAMAFVKK
FT                   PMKPEDIQTLLQQFGLYQPAAGQLKLADETPQAPANPLDVYREVSNVAMGQAGDHLARV
FT                   LDTFIELPVPNVNFIAPSELHMAIESIDTNKQVAAVSQGFSGSGILGEALTLFNDASID
FT                   DIGKLLGAKLGESGSIKQQRIESLMDVASILSSACLNGLGQQLHVEFAASQPVLLGEHQ
FT                   SMRELIKHGEHRWQKILAIEIGYQLPEHKLAFDLLLLFPADAVKILDQQLAHWLQGDDE
FT                   "
FT   gene            536542..536961
FT                   /locus_tag="IL0511"
FT   CDS_pept        536542..536961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0511"
FT                   /product="PAS domain containing signalling protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81354"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R074"
FT                   /protein_id="AAV81354.1"
FT                   /translation="MIDDMDELHSKLSILGAIDVGIVVIDNDNNIQMWNEFMQNHSGLR
FT                   PSEVRDKNLFRCCPGIEEAWFQRKIDRVRQLNSRVFITWQQRPYVFRFRHSRPISGQSE
FT                   WMYQNVTLIPLKNPRGEVHQVGIIIYDVSEQPSHE"
FT   gene            536954..537745
FT                   /locus_tag="IL0512"
FT   CDS_pept        536954..537745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0512"
FT                   /product="Dinucleotide-utilizing enzyme of HesA/MoeB/ThiF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81355"
FT                   /db_xref="GOA:Q5R073"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R073"
FT                   /protein_id="AAV81355.1"
FT                   /translation="MSEEVPDQRFGGVSRVYGQASLTQFQQLHIVVAGLGGVGSWAVEA
FT                   LARTGIGKLTLIDLDDVCVTNINRQLPATDDTIGQLKSEVLAQRVKSINPNCEVRVIDD
FT                   YLLPENFEEYLTGADAVLDAIDSVNTKSALVAWCKRRKLRIVVCGGAGGQIDPGMIRVG
FT                   DLAKAKQDPLLAKVRSQLRRDYGFSKNPKRKWGVDCVYSEEQLRYPIISGEQEGEVTLQ
FT                   KPGSGSMRMDCSSGFGAAMVVTCSFAMQATAILLKRLSHLT"
FT   gene            complement(537901..538272)
FT                   /locus_tag="IL0513"
FT   CDS_pept        complement(537901..538272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0513"
FT                   /product="SufE-like protein probably involved in Fe-S
FT                   center assembly"
FT                   /db_xref="EnsemblGenomes-Gn:IL0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81356"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R072"
FT                   /protein_id="AAV81356.1"
FT                   /translation="MASWEQLFRHLVQQAKSLPEYPAECRDDDHLVGGCEAKVWLWLDT
FT                   SDVEAVVIRFDSESRIVRGLLALLQQRLDGCPVAEIAAFDIDAFYRAEGLDNALSPSRS
FT                   NGLYQVAKTLKLRVVQHRT"
FT   gene            538397..539146
FT                   /locus_tag="IL0514"
FT   CDS_pept        538397..539146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0514"
FT                   /product="Electron transfer flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81357"
FT                   /db_xref="GOA:Q5R071"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R071"
FT                   /protein_id="AAV81357.1"
FT                   /translation="MKILVAVKRVIDYNVKVRVKPDQSDVDLANVKMALNPFCEIAVEE
FT                   AVRLKEAGTADEVVVVSIGPKAVQEQLRTALALGADRAIQVETDDMPDSLSAAKILKGV
FT                   VEKEGPDMVILGKQSIDSDNNQTGQMLGALTGMPQGTFASKVEVGDGFVNVTREIDGGL
FT                   QTVKLTLPAVVTTDLRLNEPRYASLPNIMKAKRKPLETTTPDELGVEVKRTIKLLKVET
FT                   PAERSAGVKVADVDELVDKLKNEAKVL"
FT   gene            539143..540072
FT                   /locus_tag="IL0515"
FT   CDS_pept        539143..540072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0515"
FT                   /product="Electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81358"
FT                   /db_xref="GOA:Q5R070"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R070"
FT                   /protein_id="AAV81358.1"
FT                   /translation="MSILVVAEHDNNAVDPSTLKTLAAAQKIGGDIEVLVAGKGCSTVA
FT                   ENVAKADGVKKVFLADNEAYEHQLAENISELVADLGKNYSHILAPATTTGKNFMPRVAA
FT                   LLDVAQVSDIISVESDDTFKRPIYAGNAIATVQSEDKIKVITVRATAFDAVAEEGGSGD
FT                   VENIDSVFNNDKSEFVEEQLAESERPDLTSAEIVISGGRGMQNGENFHLLEDVADKLGA
FT                   AVGASRAAVDAGFVPNDMQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKD
FT                   EEAPIFQVADYGLVADLFDVLPELNSKI"
FT   gene            540272..542152
FT                   /locus_tag="IL0516"
FT   CDS_pept        540272..542152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0516"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81359"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R069"
FT                   /protein_id="AAV81359.1"
FT                   /translation="MLKKLPLATAIALSFAASGQAADFEVGDYEIKFDSILSYGAAWRM
FT                   EDQANHLIHPGNMAGGTAGSSVGDDGNLNFDKGDLVSSVFKGVHDLSIDGGSHGAFIRF
FT                   NYWYDHVVSEENMPHGHAGNNYYPDTKLNDDIFDDYSQGKGIELLDAFVYANFDLGSMP
FT                   ASVRLGRQVLSWGESTFIFNGINDINPLDVNAARRPGAEIKEALLPVGMFSTSIGLTNS
FT                   LNLEAFYQYEWDNTKLDGCGTYFSSVDIIGGSGCGKVTLNPQLVQGDPDSYLSDFESVQ
FT                   AGAYIGSNPTLEASDSGQWGANLRYYSLDLGAEFGVYYLNLHNNTPIISAYNWIEDPRA
FT                   SQQGVSPLDLGFTWSSPNGYPIDGPRLVLEYPEDTEVYGFSFSTNLGLWSVSGEYSYRD
FT                   GVPVQINTTEILTTGLRPNVPSTFSNRFNNTAFGGDGLAHGYDRLDVSQTQLSFVRFVD
FT                   RLWGSDRMTFVGEVAMNNVHDMPGLQEQRYGRLPLYGKCLTQADMSPLIGAAEQAGLSG
FT                   VAQQFQSQVGNCEGFATSTAWGYRTRFQFEYSNVWQGWGLNPTIQFNHDVNGYSTNSNF
FT                   IEGRKSLGLNLVADYLSTYKVSLGYTMYSDEELDPLSDRDYASVSFSYAF"
FT   gene            542305..544320
FT                   /locus_tag="IL0517"
FT   CDS_pept        542305..544320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0517"
FT                   /product="Acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81360"
FT                   /db_xref="GOA:Q5R068"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R068"
FT                   /protein_id="AAV81360.1"
FT                   /translation="MKKWIITAAALMLSGTAAAQEKLQLEDIFTLEYASSPTIHPSGEW
FT                   TVFVRQSMDINNDRKVGRLWASLPDGDIRPLTGSQGSESQPVWSPSGDRLAYVSTETGS
FT                   PQVHIYWVDSGDSAAVTQLTQAPSGLSWSPDGSQIAFSMFTPKSQPAPVSLPGKPEGAD
FT                   WTAAPKYIDKGNYRYDGGGYAKDGHQQIYVIPATGGSPRQLTDEEFNHGGQLSWSPDSK
FT                   HIFFSANRRDDAFRQPVNSEIYRLTLSTKEITAITERDGPDGSPKVSPNGEKIAFTGYD
FT                   DTKMSFQASNLYVMDLDGSDVELLTGDLDHSVTGFEWDRDSEGVYFTYDNNGVGQLART
FT                   DLDGDHTQLTNRVGGLSYARPYGGGDFSVAKGDRIAFTISNPMRPAELALWDDGDVQQL
FT                   TRLNEDALAHKQLAKVEEINYKSSVDGIDLQGWIAYPPGFDKDKDYPLMLEIHGGPHTN
FT                   YGPRFAAEIQLFAAAGYVVLYTNPRGSTSYGSDFANEIHHNYPSHDYNDLMDGVDAVIN
FT                   KGFIDKDELYVTGGSGGGVLTAWIVGHTDRFKAAVVAKPVINWYSFVLTADMYNFFYQY
FT                   WFPGLPWENMEHYMKYSPISYVGNVTTPTMLLTGENDYRTPMSETEQYYQALKLKGVDT
FT                   AMVRIQDSGHGIYARPSNLMNKVAYILHWFEKYRDE"
FT   gene            544394..545083
FT                   /gene="siaB"
FT                   /locus_tag="IL0518"
FT   CDS_pept        544394..545083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="siaB"
FT                   /locus_tag="IL0518"
FT                   /product="CMP-sialic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81361"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R083"
FT                   /protein_id="AAV81361.1"
FT                   /translation="MNVALITARGGSKGLPGKNIALLNGKPLIVWTILAAQKAASVDAV
FT                   YVSTEDQAIADISQQAGAQVIPRPAELAQDDTSSEPVIAHAINYLKKQSLNLNSVTLLQ
FT                   PTSPLRSAQHIDEAYRIYADSDASCVLSVIEPVHSAAKAYKLNSDGSLSGLLSLDAPYM
FT                   RRQDLPRTVHPNGAIYIFSTAAFEAGGGIPRQNVYPYIMSEEASVDIDRASDLQLAEQI
FT                   MEKTQHG"
FT   gene            545076..546134
FT                   /gene="siaC"
FT                   /locus_tag="IL0519"
FT   CDS_pept        545076..546134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="siaC"
FT                   /locus_tag="IL0519"
FT                   /product="Sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81362"
FT                   /db_xref="GOA:Q5R082"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R082"
FT                   /protein_id="AAV81362.1"
FT                   /translation="MANTPEKHPVMKIGSREIGYDHDPVVVAEIGINHEGSLETAYEMV
FT                   DAAVSAGAEIIKHQTHVVEDEMSADAKKVIPGNADVSIYEIMERCALNEEDETKLKEYV
FT                   ESKGAIFISTPFSRAAAERLERMGVEAYKIGSGECNNYPLLELVASYKKPIILSTGMND
FT                   IPSIAKAVDIFRKHGVQYALLHCTNVYPTPDNLIRLGAMNQLQDAFDDAVVGLSDHSID
FT                   NLACLGAVAVGASILERHFTDHKQRTGPDINCSMDTEECRSLIQESKRMKAMRGGQKGA
FT                   VAEEQVTIDFAYASVVTIKPIKKGETFSQDNLWVKRPGTGQFLADDYENLMGKTAAQDI
FT                   ENDVQLRSEDVQ"
FT   gene            546134..547273
FT                   /gene="siaA"
FT                   /locus_tag="IL0520"
FT   CDS_pept        546134..547273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="siaA"
FT                   /locus_tag="IL0520"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="sialic acid capsule biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81363"
FT                   /db_xref="GOA:Q5R081"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R081"
FT                   /protein_id="AAV81363.1"
FT                   /translation="MKKKVLFVTGTRADFGKLKSLIEVTDKADEFEVQLFITGMHMMSR
FT                   YGMTSIEVERLKIASSYKYINQTKNDTMDVVLAKTITGLSDYIHENNPDVIVVHGDRVE
FT                   AMAGAIVGSLNNILVAHIEGGEVSGTIDELIRHSISKMAHTHFVSNSEAQERLVQLGEA
FT                   KSSIFTIGSPDLDVMNSPNLPSLETVKEKYDIAFKDYSVFMYHPVTTELESLESNIKST
FT                   VDAMLESDENFVVVYPNNDHGTDTILAELKRCENHPRFRIYPSIRFEYFLVLLKNANMI
FT                   IGNSSAGVREAPFYGIPTINLGSRQQSRATAESILNVEEQTPAILEAIKTFKTKRFEPS
FT                   SEFGDGNSAEGFISTLRSEAFWAISKQKVFVDWDKREKS"
FT   gene            547260..548318
FT                   /gene="siaD"
FT                   /locus_tag="IL0521"
FT                   /note="predicted sialyltransferase; inactive fragment"
FT   gene            548349..548999
FT                   /gene="ung"
FT                   /locus_tag="IL0522"
FT   CDS_pept        548349..548999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="IL0522"
FT                   /product="Uracil-DNA-glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81364"
FT                   /db_xref="GOA:Q5R080"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R080"
FT                   /protein_id="AAV81364.1"
FT                   /translation="MPWSTLLAEEKQKPYFQQLWQRVEQARQETVVYPPKEDVFNALKL
FT                   TDPENIKVVILGQDPYHGPGQAHGLSFSVPEGVKFPPSLRNMFKAIAIDYPDTVLPQHG
FT                   DLTSWAEQGVLLLNTVLTVEQGNAHSHASWGWETFTDTVISKVSDATDHVVFLLWGSHA
FT                   QKKIPLIDGNKHCILTAPHPSPLSAHRGFFDANHFRKTNDYLQQHGRQPIRWV"
FT   gene            complement(549011..549877)
FT                   /gene="nhaR"
FT                   /locus_tag="IL0523"
FT   CDS_pept        complement(549011..549877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="IL0523"
FT                   /product="Possible transcriptional activator of LysR
FT                   family"
FT                   /note="similar to NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:IL0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81365"
FT                   /db_xref="GOA:Q5R079"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R079"
FT                   /protein_id="AAV81365.1"
FT                   /translation="MNYKHLYYFWHVAENGHLTQTAQKLHVSQSALSAQIKQLEEWLGT
FT                   PLFERTGRKLVLTQAGYIARQYADRIFHEGENLVNQLKQGMDGSDLVVRIGHASTMSRN
FT                   FVEAFIHELVHQQDVQYRLHSMTPDQLFNELADHQIDIALANTSVRGSDKQLWQSRLLA
FT                   RQPVSVIGPPGRDIEQLTDVALRNNNWVLPPENMPLRAAFDMLSAEYNWQPRVLAEADD
FT                   MAMLRLLARDTGALAVIPDVVVRDELTSGQLKRYLTLPNVFEHFYAITLKRPFEHPMVA
FT                   KLLQRFV"
FT   gene            549990..551315
FT                   /locus_tag="IL0524"
FT   CDS_pept        549990..551315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0524"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 5 (chain
FT                   L) related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0524"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81366"
FT                   /db_xref="GOA:Q5R078"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R078"
FT                   /protein_id="AAV81366.1"
FT                   /translation="MAEWLTLSGIRPVLLVLVAVLAWVVTRYAFRNFRLDPRRRSFVTK
FT                   LVGCLIAVFILIVSNNLIVFFAAWMAISLQLHSLLMFYPERDRAVLAAHKKFILARCSE
FT                   TFLGTAFIIMYLTTGSLQLDTVLQQFGTAPTHLSQHIAALCLVMAALIKCAQLPLHGWL
FT                   IQVVEAPTPVSALLHAGIINLGGFLLLATVPLWSNSAPAVWLLCLVSAASCCFAALIMA
FT                   TRISIKVRLAWSTSAQMGLMLLEIGLGYYDLALLHLVAHSVYKAYAFLSVSEVAIIKQP
FT                   QARSLWRIGVVFIAFQGIIAAACWWFLGNPKWLPSALLAMALTTLWMNLHQKLLRIAVS
FT                   ALTVVVYLLLGALAHQVIEPQPPFSSVWLEPAVTLMFNVFAFTYWLVHHTPSHRLSQRW
FT                   FITLNAGLYLDEWLTRLVLWLWPSHPIHYYQRQGRIQREKHS"
FT   gene            551312..553585
FT                   /locus_tag="IL0525"
FT   CDS_pept        551312..553585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0525"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81367"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R077"
FT                   /protein_id="AAV81367.1"
FT                   /translation="MSTANRLATIAGQVSKAIAPQWPLSQWIAVNPFWHYRQQPVAGVA
FT                   AHWRYSAGTRLLMSPDFYWQQWQQNRIDAALVTNKMVNELEQRSLLKAQLPQWRNLSRL
FT                   VDKYTRRRRKMRWNDEVVLQISQTCGLFMQFPTRFQQAGKDSSLYQHWLTISRADRGIE
FT                   TLMDEAELTELFAQLPDDPHKLIQVCHDNFLSDASDYALRCYSQALISDLWGWAAAFSY
FT                   QDARQDSQWVFELLCIRLAWEYILWQLAERTNTKVYQQLQQALSAQVENCEGQVAHIEQ
FT                   HNSLLWQWQAAYERSQLNRLQFKSDTVEESNAPDVQAVFCIDVRSERYRRALEQAGKSL
FT                   GSYVQSKGFAGFFGVPLAIQRKGRDVPHVPGLLQPAYYIKAPARKQSVGSLLSNMFNAP
FT                   VSMFSGVEALGLSKLKSLLTGVPGQLATANNAYIADGSICEHNGEASMESLVGICQQAL
FT                   AGMQFTRFARHIVLVGHGSHHSNNAQRAGLNCGACGGQTGALSARVLVRLLNNQNIREH
FT                   LREQGVAIPDATQFHSAMHETVTDKVIWLSNTVPDSVKQVFRAATEKLTQACGESEKDR
FT                   KTRSGHWAELRPEWGLADNNVLFFGQADRLTSADTIGSNFLHDYNSINDPDGELLAQLM
FT                   SAPGLVANWINWQYYCSVTEPKQLGSGNKLLHNRVANDIGVFEGNGGDLRQGLAWQSVH
FT                   NGSDFVHRPMRLQVIVEADEATIQRALAKAVAFNELFEQQWINLHRLNARGELCPVTTP
FT                   VTAK"
FT   gene            553582..553779
FT                   /locus_tag="IL0526"
FT   CDS_pept        553582..553779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0526"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81368"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R076"
FT                   /protein_id="AAV81368.1"
FT                   /translation="MTATTCHTLKAFYDCVRSRPFNQPFALRYNDGSIDHGLNSEEAAK
FT                   ESLRAHHNPYLEQPVVVEWG"
FT   gene            553919..554188
FT                   /locus_tag="IL0527"
FT   CDS_pept        553919..554188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0527"
FT                   /product="Transcriptional regulator, Cro/CI/xre family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81369"
FT                   /db_xref="GOA:Q5R075"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R075"
FT                   /protein_id="AAV81369.1"
FT                   /translation="MLLEAKNTKVIGKVAKVVRQQQKLDQTTAGAFAGCGINFVSQFEN
FT                   GKPTVQLEKALNVLNALGIKVYLDIPDSASGDKLTELTGRLNHE"
FT   gene            554181..554387
FT                   /locus_tag="IL0528"
FT   misc_feature    554181..554387
FT                   /locus_tag="IL0528"
FT                   /note="disrupted HipA-like protein"
FT   gene            554614..555858
FT                   /locus_tag="IL0529"
FT   CDS_pept        554614..555858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0529"
FT                   /product="Predicted ATPase, AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81370"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R090"
FT                   /protein_id="AAV81370.1"
FT                   /translation="MNKPLLERYTKESLLDALEDTPVILIHGSRQCGKTTLAKSVGEVL
FT                   GYAYITFDDENQLGAAKADPVGFVKSLPEKTILDEIQRVPELFLSIKESVDANRVPGRF
FT                   ILTGSANVLLLPQLSDSLAGRMEIIHLRPLAQCEITGQKPNFLASLFSESLFSAVTNKK
FT                   TASLGSSLADILVQGGYPAAIQRKAAKRRNAWYRGYITTILQRDIKDLANIRNVNLLPK
FT                   LLSLAASQTGRLFNSSELASPFSVSRPTVREYLALLEQIFLIEELSPWHSNRISRLIKT
FT                   PKLHLSDTGLASSLLGVNADELWKDKELLGQLLETFIYQELRKHASWHDEDLKFYHFRN
FT                   KDKVEVDIIIEKGRLKAGIEVKAAATVKQSDFKGLIRLKDACKGDFAGGIVFYDGEQVL
FT                   PFGDKLYAVPISHLT"
FT   gene            complement(555862..557253)
FT                   /locus_tag="IL0530"
FT   CDS_pept        complement(555862..557253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0530"
FT                   /product="Predicted exonuclease of the beta-lactamase fold"
FT                   /note="involved in RNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:IL0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81371"
FT                   /db_xref="GOA:Q5R089"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R089"
FT                   /protein_id="AAV81371.1"
FT                   /translation="MDVIHHGAFEGVTGSCHELFLDSDHSLLVDCGLFQGAETSGSGAN
FT                   SNAQEIDFDISKVQALVVTHCHIDHVGRLPWLLIAGFVGPIYCTKATALLLPLVIEDAL
FT                   KIGLTRNAQIIDAVIARLHRQLRPTAYDKWIELPTEFASERFKLRFRQAGHILGSAYVE
FT                   IENVSTHYRVVFSGDLGCKNTPLLPDPTPLERADFLLLESTYGDKNHESRIDRSQRLKA
FT                   VVERCVENKGVILIPAFSIGRTQELLYELEDIIHTAREQEAETGEVNKVWHKMTVILDS
FT                   PLAVQFTKQYRTMKNLWDEEARKRLSDDRHPLNFDRLLTVDEHSEHERIVNLLQSSGDP
FT                   CIVIAASGMCTGGRMLNYLKALLPDPRTDVLFVGYQAAGTPGRDIQQYGPDGGYVELDH
FT                   ERVWIKAGIYTLGGYSAHADQQELLDFIDATEEPVKRIRLIHGEADARLALAAKIRERY
FT                   GVSVT"
FT   gene            complement(557286..558110)
FT                   /locus_tag="IL0531"
FT   CDS_pept        complement(557286..558110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0531"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /note="acid tolerance protein; similar to SatE"
FT                   /db_xref="EnsemblGenomes-Gn:IL0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81372"
FT                   /db_xref="GOA:Q5R088"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R088"
FT                   /protein_id="AAV81372.1"
FT                   /translation="MVVTPLIVLLVSVLGYANLNSTELGKLKLNRLVPSRLAITLFISG
FT                   TVILFGAVFATFLLLLLWGLITLVVSGSLSSAWVAMQTLTGSPGGVEPDKSSVLLLFTI
FT                   GLVISFLSVTKFQSKADANWKQNNSKFLIHKLVDDELELFLLRALEMDDFIPHNGDESP
FT                   DKRMLVRVVLSNRKVYIGNLIRCDITRGVCSNIVLVPMHSGYQDESTLELQLTEHYEKH
FT                   YSAELSSDATELQIKDFLNQYSLTIPVHHLVTASLFDLTAYQKFLTEKLNSM"
FT   gene            complement(558131..558316)
FT                   /locus_tag="IL0532"
FT   CDS_pept        complement(558131..558316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0532"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R087"
FT                   /protein_id="AAV81373.1"
FT                   /translation="MTVPVKQPTVVIDNNGMLSVNLANEKVRQAIIGRIDENNDAVLRE
FT                   LQKKINQKRKEQELTA"
FT   gene            558642..560129
FT                   /locus_tag="IL0533"
FT   CDS_pept        558642..560129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0533"
FT                   /product="Uncharacterized protein containing Fic domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81374"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R086"
FT                   /protein_id="AAV81374.1"
FT                   /translation="MAELYFSTTTEQSRELTRREKKGELKRLYRGVYTDASYEELTSLV
FT                   LRDWAKIVNYLLPNAIAAYRTAHELRPVEGTVFVADAVAARRTIDIASILTIYIWPGST
FT                   SDLVEPFLPEMKRSAPARQYLENLTVSRSKVKKSLGQSWVEERLCIELKRTNNEDSLNQ
FT                   IRDQARVFANRQGFETEFEKLNAIISALLTTHSGESILKTEVGMASAKQEPFDVHRIAL
FT                   FKDLANYLKRCQLPKLPYEYNKSGWNHLAFFESYFSNYIEGTEFEIDEAEQIVFQRSEI
FT                   NNRHADSHDVLSIYDQVVDYQGMSITPETPDELIKSLQRRHFEFLFERPDKNPGRFKSK
FT                   VNKAGSSTFVSPDDVVGTLTQAFSIYKSVPEGLARAIFLQFLVSECHPFDDGNGRLSRI
FT                   MMNAELHAAGEYKLIVPTVHRDSYLNGLRKATRDRNFKTLVKVFYQLQRYTASIDWADY
FT                   GEARDTIEAHKAHLLPDEGIADFNRQIRQYRFTPPVT"
FT   gene            560467..562932
FT                   /locus_tag="IL0534"
FT   CDS_pept        560467..562932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0534"
FT                   /product="Predicted membrane associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81375"
FT                   /db_xref="GOA:Q5R085"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R085"
FT                   /protein_id="AAV81375.1"
FT                   /translation="MSCAAVGEFMAHLIISDEHIHADQIVMLREFIELYGLENDQEKIF
FT                   KVLEGKGEERLPQLYKELEQLSKKEQEILIENSAAIVGFNRHFAKQEKQVIATLCKAAN
FT                   IEPSELIAAVNDIIENSTRAFNDRLASPEIQDKYSTVSLKVRRFFSRGAKREYLTTKIK
FT                   ESELSGPEYGNAIKKTGEIAEKDCQLVEAELSKIFSALESTRNEFQSVIKENSIDRNKA
FT                   SEDEVNFHTFLVDLNDRLDKQAKESNEELKDLVDKKRRAKNAFTIALMGRTKAGKSTLH
FT                   YVMTGEGKEFIGVGAERTTRFNRVYEWENLKLIDTPGIGAAEAGGRSDEEIALSVVDTA
FT                   DVICYVVTSDSVQEVEFKFLSQIRNSNKPVFVLLNYKENIESPPPQYKKFVKSPLHWFS
FT                   RDDEKNIQGTVNRIKRGIESYYDGNSVTIVPVHLMAAKMAMDDRCKADKTAFRSGSRVD
FT                   NFFNEIRENVIELGQLRKSQTLLDNTACRLCRMLSVVREKQESSVKVAKDIENKQQKLL
FT                   KLIDKQVKKNKSAFIRELKLTMESEHGSAKDFASENYKGKKKDIERNWKKEAERIDQQL
FT                   KEKLEVKLKDSAAVVQEAVNEAMEDIAIGFDAIREADFDEQSTFNTSRLMSALGALMST
FT                   GGGAALIIIGSMSTPAGWVAAGFVVVGIFAGFCSGLVKSKERKRKEAIDAILKQANKNL
FT                   DDLEQSYTEQVDKLFEEFHEKASRQLSRVLSRVSEQYRNSANLLTPYCNSLNNAINELN
FT                   QQFAVRIIEFARDEQLPEERIGELKVTRDLGKKTEIETSLRISEQGIQRAEKALREKLT
FT                   VKTLAKGVQ"
FT   gene            562929..564596
FT                   /locus_tag="IL0535"
FT   CDS_pept        562929..564596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0535"
FT                   /product="Protein containing N-terminal predicted GTPase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81376"
FT                   /db_xref="GOA:Q5R084"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040576"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R084"
FT                   /protein_id="AAV81376.1"
FT                   /translation="MNFSEKAERITSLKTQVFEVLNEYPGYENLRNKLSSELDEKEQDS
FT                   KLRLVFAGQYSSGKSSIISALTDNKSIKIDSDIATDKSEDYEWRSVTLTDTPGISAGRP
FT                   DHDKVTHQRIQHADILVYVVTYSLFDNVLIEDFKRLAIDYNYKHKMVLVVNKMYSEEGE
FT                   YDQLCETYLKNLEQQIGKETIQLMPVAFVSSGNALEEDADFHPYGHMDDLVKLLDDMIE
FT                   KNQSLAGVEAVAQIIATHIEDELATKVEGTTKEEQLLLQRIERVISQIKKDAESALREE
FT                   ASRIKALAKSMGSENALNVGTSETLEEDVQASSELLNTEAHNAFDNLTARFDELDKELD
FT                   SELSELNDSNLAEQFFMRFEENSSENSLGETPDIGDAADFAVANQLSALLGRGSGAVAS
FT                   KAMGAKAGAGLLKASGASGSSVHQTVLQVGKALGVKFQPWQAVNIAKNIGNVAKVLGPI
FT                   MAALPIIFEGIDIYNEEKREKKIAEARRNIREQFQDAGDQITQQMKDSAGEFITAKYGQ
FT                   LLEEISKLRRARINEAQNLETCGQKLKSLSNSLREVLV"
FT   gene            complement(564661..565941)
FT                   /locus_tag="IL0536"
FT   CDS_pept        complement(564661..565941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0536"
FT                   /product="Predicted C-terminal GTPase domain fused to
FT                   uncharaterized conserved domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81377"
FT                   /db_xref="GOA:Q5R096"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R096"
FT                   /protein_id="AAV81377.1"
FT                   /translation="MNNHPVETLCKTHYADILPLVEYLKVDKDLQRSIGIAAREAQQQT
FT                   GNTANYFVKEQHAEQLINDLRDAGSNSLKSVFTEPSYYSEIVYDVGLKLKADVSKTNLA
FT                   KENEDLIIGKLFADAVAEMSEEEKSELLLEFGYETTKIPAALSVMGTQLGLRSLGFSTY
FT                   RMAVIIANYIARALLNRGLTFGGNILVTRTIGVALGPVGWFASGLWLAFDLAGPAYRKT
FT                   IPAVVQIAMLRQLAEKRVNIGIVGEGSCGKDSLIRETFGVDTNNVSAVPGSTSKAEAYA
FT                   LNEAATVMNYAGFHDSEHEVNENTADYLIHTDVFVWVVDIQRGITGTELETFEKLKRYN
FT                   RPVVLCINKVDTPKNDADKEALINSINERLELNSGKSSLIKAVFETAFDPDPRLMEKAI
FT                   GGDEVLGFLRNFLSEKLGKDSDCLDLA"
FT   gene            566156..567769
FT                   /locus_tag="IL0537"
FT   CDS_pept        566156..567769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0537"
FT                   /product="Possible regulatory protein containing AAA-type
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81378"
FT                   /db_xref="GOA:Q5R095"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R095"
FT                   /protein_id="AAV81378.1"
FT                   /translation="MKRDYEHLEANLSCLVSRYSEDPEQAKQVFSSLFHEFLTGEIGKQ
FT                   LKHSLKERYESITPPSDEASKLFNVLSKKSDEKLIELMSELSAAERGREYGELGLTHLS
FT                   AQLRRPLVLHLCDALFKPENSKLLDELVNYLIQSGMRSLDSNMALRWEWTEELNDRAKE
FT                   FLAKLQLAVAKDGVPDLDMNKEGPVMICGPTGSGKTLIAKLLADSLFESKLISLNIAAV
FT                   TDSVLESRIRGHTKGAFTGASQQVKPIFASAHNGVLVFDELQSASRQSQTQLLDLLHSI
FT                   SDKVQVAPMGSHESSLYQVRTLFLVNEPLNELLNSNELRLDFLHRMRQIVTFPSLHERL
FT                   NQKTKNLKLLPALISLMKLSFILNYSSDGHFSDISRAQLFDIIWNLKLEDEAEAQLRHY
FT                   SWPGNLREFERLFTDLFHEQLLLDRKSNTIKLIKRSFFRDFALATEQRQAEAKGLGDEN
FT                   RLSEAESSDLNEVEQLKVKLVSDALRENNFVLKDTYEALKNYDVGLGHHKALKLFLLGY
FT                   TAHFPEGIRHWINEKHVQNA"
FT   gene            568049..569215
FT                   /gene="ugd"
FT                   /locus_tag="IL0538"
FT   CDS_pept        568049..569215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="IL0538"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81379"
FT                   /db_xref="GOA:Q5R094"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R094"
FT                   /protein_id="AAV81379.1"
FT                   /translation="MKIAVAGTGYVGLSNAVLFAQHNQVTAVDIDQEKVEKINKKQSPI
FT                   VDKEIQHFLQEKPLNLSATTDAHAAYKNADFVVIATPTDYDPQTNYFNTKTVESVISQV
FT                   IEANPNAVMVIKSTIPVGYTQSLKEKFGTNNILFSPEFLREGKALYDNLHPSRIIVGER
FT                   SERSETFANLLKQGAEKQNIDTLFTDSTEAEAIKLFANTYLAMRVAYFNELDTYAEVHG
FT                   LDTKQIIEGVCLDPRIGSHYNNPSFGYGGYCLPKDTKQLLANYDNVPQTLIKSIVDANR
FT                   TRKDFIADQIIAKQPKVVGVYRLVMKSGSDNFRASAIQGIMKRIKAKGIEVVVYEPELK
FT                   EERFYNSRVINNLTEFKAVSEIILSNRLADDLKDVQEKVYTRDLFNND"
FT   gene            569231..570241
FT                   /locus_tag="IL0539"
FT   CDS_pept        569231..570241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0539"
FT                   /product="Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81380"
FT                   /db_xref="GOA:Q5R093"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R093"
FT                   /protein_id="AAV81380.1"
FT                   /translation="MTQENQQNPNNQPPAPYGPGQYPPNYYNGPYPQDDEIDLRELFGI
FT                   IWDGKWIIIAITFVFAVGSVIYSLSLPNIYKAEATLAPTEEAQGQGLGGELGGLANLAG
FT                   ISVGSGKVDKVTMAMEILQSRQFIKNFVQKHNILPEIMAVKEWNESSGELVFNEEVYNP
FT                   NANKWVRKTESSKQPAPTSWVYVNVFKNGLLVEKDEETPGLVNLSVSHRSPIIAHRWAE
FT                   WLIQDINDHMRQRDIKEAQSSMEYLQNELGETNLSSMQQVFYQLIEKQIQTIMLANVRP
FT                   EYVFQVLDPAVVPEQKSAPSRALICIVGTFLGGFLSLLVVFIRHLIRSSKSKADS"
FT   gene            570306..572102
FT                   /locus_tag="IL0540"
FT   CDS_pept        570306..572102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0540"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:IL0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81381"
FT                   /db_xref="GOA:Q5R092"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R092"
FT                   /protein_id="AAV81381.1"
FT                   /translation="MFKRLKALFKLLTPEQRKRLIGLQFLVVLMAFAEVAGVAAIGPFM
FT                   ALVGDISLLQGEGKLAQLYTVSGFENPEDFLFWLGIAVLIALSGAAAVSMFTTWRLSLY
FT                   AAQVGAEISTRLYKHYMQQSWLFHASGSSSQLTNRIAQEAGRVTNVVIQPLMQMNAKGV
FT                   LALVMATAIFIFNPTVALAGLLIFGLAYVALYKTVRKQLGKNGRAISEANQQRFKLMNE
FT                   GFGGIKDTLLLGRQAEFNERFEKSSHKLGRAQGVTRGLAQVPRYAMELIAFGAVIFLVL
FT                   YLLSAYDGNLGNILPVLSVYALAGFKLLPAFQQMYTSLAQVKGNIASFDSIEEDLTASQ
FT                   EIEDIKPASSAGKLSPKKLIKLDNISFGYPDKEEKALVEFTLDIPVNQVIGLVGASGSG
FT                   KSTAIDVLLGLIEPQSGSLIVDGEEIKGGKKRAWQNNVGFVPQAIFLADSSIRENIAFG
FT                   IPPEEIDESRVTSAVKMAHLDELLKRLPEGLSTRVGERGIQLSGGQRQRIGIARALYDD
FT                   AEVLVLDEATSALDGITEKLVMDAIHDFSGKKTIIMIAHRLTTVKQCDSIYILENGRVL
FT                   DKGHYDDLVSRNKTFQEMAHHS"
FT   gene            572120..573178
FT                   /gene="rffG"
FT                   /locus_tag="IL0541"
FT   CDS_pept        572120..573178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffG"
FT                   /locus_tag="IL0541"
FT                   /product="DTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81382"
FT                   /db_xref="GOA:Q5R091"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R091"
FT                   /protein_id="AAV81382.1"
FT                   /translation="MKILVTGGAGFIGSAVIRHLIKNTSHIVINIDKLTYAGNVESLLP
FT                   VSDSENYVFEQVDICNAPEVKRVYIEHKPDAVMHLAAESHVDRSIEGPSEFIQTNIVGT
FT                   YTLLEATRSYWSNLSEEMKSTFRFHHISTDEVYGDLGDPTELFTETTAYAPSSPYSASK
FT                   ASSDHLVRAWHRTYGLPVIITNCSNNYGPYHFPEKLIPHIILNALSGKELPVYGDGKQI
FT                   RDWLYVEDHARALVKVVTEGKVGETYNVGGHNEKQNIEVVNTICELLDELKPSASGKPY
FT                   KEQITFVKDRPGHDKRYAIDASKIEDELGWTPEESFETGLRKTVEWYLNNKNWWQRVLS
FT                   GDYQLNRIGESI"
FT   gene            573175..574053
FT                   /gene="rffH"
FT                   /locus_tag="IL0542"
FT   CDS_pept        573175..574053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rffH"
FT                   /locus_tag="IL0542"
FT                   /product="DTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81383"
FT                   /db_xref="GOA:Q5QUW8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW8"
FT                   /protein_id="AAV81383.1"
FT                   /translation="MKGIILAGGSGTRLYPITMGVSKQLLPIYDKPMIYYPLSVLMLAG
FT                   IREVLIISTPEDLPNFKKLLGDGSKFGIELSYAEQPSPDGLAQAFIIGEEFIGDDTVCL
FT                   VLGDNIYYGHGFRPKLLDAVKRTETDGGATVFGYQVKDPERFGVVEFDNDNKVLSIEEK
FT                   PAEPKSDFAVTGLYFYDNDVVEISKNVTPSARGELEITDVNKAYLENGSLNVELLRRGF
FT                   AWLDTGTHESLLEAAQFVETIERRQGYKIACLEEIGFNQKWLSESQLLKNANLLKKNGY
FT                   GQYLLDLIRSK"
FT   gene            574314..574871
FT                   /locus_tag="IL0543"
FT   CDS_pept        574314..574871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0543"
FT                   /product="Acetyltransferase, isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81384"
FT                   /db_xref="GOA:Q5QUW7"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW7"
FT                   /protein_id="AAV81384.1"
FT                   /translation="MAYLTENELKKKGFKHLGKNVRISEDARIYNPELISIADNTRIDD
FT                   FCVISGLVSFGRNVHIAPQCLVAGGEKGITFSDFSGLAYQCQVFAQSDDYSGRTLTNPT
FT                   VSADFKAEKKAPIVLGRHVIVGAGSLIFPGVTVAEGCSVGALSLVNRSTDSWGIYAGNP
FT                   AKRVKEREKSLLELEQSYLSKD"
FT   gene            574881..575606
FT                   /locus_tag="IL0544"
FT   CDS_pept        574881..575606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0544"
FT                   /product="3-oxoacyl-(acyl carrier protein) reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:IL0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81385"
FT                   /db_xref="GOA:Q5QUW6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW6"
FT                   /protein_id="AAV81385.1"
FT                   /translation="MNDKAKVALVTGGSKGIGLEISRLLVGKGVKVISLTRTTYKPIQS
FT                   RLFEEFNVDLSNDDSGERVLEYLRMNEVNEISYLVNNAGVTKDSLIEKMSIGDWDTVLA
FT                   SNLKSAFLITKSLLPLLRESDTPSIVNVSSIIGNVGNIGQSNYSASKGALISLTKTWAK
FT                   EFNRKDHKIRVNSVSPGFIATDMLRGVPERFLNRITEQTPLGRLGMASDVADAVVFLLS
FT                   DEARFINGADVPVDGGLVW"
FT   gene            575633..576775
FT                   /gene="wecE"
FT                   /locus_tag="IL0545"
FT   CDS_pept        575633..576775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecE"
FT                   /locus_tag="IL0545"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme"
FT                   /note="involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0545"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81386"
FT                   /db_xref="GOA:Q5QUW5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW5"
FT                   /protein_id="AAV81386.1"
FT                   /translation="MIPFNKPPLTGNEVQYITEALKGNKISGDGPFGKRCQQWFEENLP
FT                   TQKALLTPSCTAALELAAILIDVQSGDEIIMPSYTFVSTANAFVLRGAKIVFVDIRPDT
FT                   MNIDETKIEAAITDRTKAIVPVHYAGVSCEMDAIMDIAGRYSLYVIEDAAQGVMSSYKE
FT                   RPLGTIGHLGAFSFHETKNYTSGGEGGLLIINDARFTERAEVIREKGTNRSQFFRGQVD
FT                   KYTWVDIGSSYLPSEMQAAYLWAQLEKANEINDARLRTWKSYYDSFRKLIQEGFIELPI
FT                   IPDYCIHNAHMFYIKVKNLQVRTELLEFLKNKNILGAFHYIPLHSTPVGKDWGRFSEDE
FT                   VYTTSESERLLRLPIFFGIKDEEVSLVVKEVSNFFKEPHA"
FT   gene            576768..577904
FT                   /locus_tag="IL0546"
FT   CDS_pept        576768..577904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0546"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81387"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW4"
FT                   /protein_id="AAV81387.1"
FT                   /translation="MLKEKNLYKGKNLFFISNRDKFFKLQADSLVNKAGVRKDSIIAIV
FT                   FEVDKKVEITKVEGIEYVDFNVSDLNFMIEAKSFTFMSLNNWNAPIAETLINKDKRVLQ
FT                   KLYIFITDDEVERWKINYEKNNCLTEDIGSHISKSCILVLQCVKNFIAPVPYFKELILK
FT                   VLDRKDIEFINCSIIFEILPFNQSQLLRDSTGRDESYLKSNKKRVLVGTKSYKLIPFFK
FT                   VFKDFNRYQKNSGEAVELLVFQSLSNRFLIDAFLLFRKLLRLKDSNVTYLSEMPPHLYS
FT                   SLIGSCDYILLQDRGGASTARVFAKWGAGALLIKNGSPNYYFFKDVYKIDFISFDEKLK
FT                   ISERIRHEDLDLLCNSYRIIEEEKRSIEVYGKLYDEKR"
FT   gene            577888..578409
FT                   /locus_tag="IL0547"
FT   CDS_pept        577888..578409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0547"
FT                   /product="Acetyltransferase, isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81388"
FT                   /db_xref="GOA:Q5QWT9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWT9"
FT                   /protein_id="AAV81388.1"
FT                   /translation="MMKSVKKALLSLRKKLVRFYWTHRVRSRASASGVDLRVNSKSIVT
FT                   SKTVLGNNVNFNGMQVAGGGKVIIGSNFHSGPECLMISQNHNFNSGEAIPYDSTYIFKD
FT                   IIIKDNVWLGSRVIVLGGVTVGEGAIIQAGSCVVSDIPDYAVAGGHPAKVFSYRDIDHY
FT                   KKLKAAGKFH"
FT   gene            578422..579612
FT                   /locus_tag="IL0548"
FT   CDS_pept        578422..579612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0548"
FT                   /product="Predicted nucleoside-diphosphate sugar
FT                   epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:IL0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81389"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU2"
FT                   /protein_id="AAV81389.1"
FT                   /translation="MQNTLSLIGRTEPLFISDILVNEDKISELVQSSSFLVIGSAGSIG
FT                   QAVTKEIFKRNPKKLHAVDISENNLVELVRDLRSSIGYIEGDFQTFALDIGSLEYTAFI
FT                   KKDGQYDYVLNLSALKHVRSEKDPYTLMRMIETNIFNTVKTLEQSKEAGARKYFCVSTD
FT                   KAANPVNMMGASKRIMEMFLMQGSESIEISTARFANVAFSDGSLLHGFNQRIQKKQPIV
FT                   APNDIKRYFVTPQESGELCLMSCLFGENRDIFFPKLSEALHLITFSEIAEKYLRSIGYE
FT                   PYPCSSEDEARELIKTLPEQGKWPCLFTSSDTTGEKDFEEFFTDNEVLDMERFSNIGVI
FT                   KNDAIYDEKLLEHFSKAINELRTSHSWTKEDIVKLFHEMIPAFGHKEMGKYLDSKM"
FT   gene            579625..580767
FT                   /locus_tag="IL0549"
FT   CDS_pept        579625..580767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0549"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme"
FT                   /note="involved in regulation of cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81390"
FT                   /db_xref="GOA:Q5QWU1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU1"
FT                   /protein_id="AAV81390.1"
FT                   /translation="MSHHLSEFIRSLYKTKDFIPLHAPTFGDQEKSNVLDTIETTFVSS
FT                   VGKYVDEFEREIERFTESPKAVATVNGTAALHTALYMAGVKQGDLVITQALTFVATCNA
FT                   IHHMGAAPVFVDASRETLGLCPVALESFLEYNAKLDGERCIHKESRQVIRAAVPMHTFG
FT                   HAVHLDEIQRICKKWHITLVEDAAESLGSYYKGKHTGTIGEFAALSFNGNKIITTGGGG
FT                   MVLCASDVDGRCTKHITTTAKVPHPYEFYHDEPGFNYRMPNLNAALGCAQMQRLPLFLE
FT                   QKRQLANDYRAFFKGSNYEFVDEPNHSHSNFWLNAVLCEDKGARNALLEEQNSAGIMCR
FT                   PIWQLMHKLPMFAECLRGDLEVSEDIEARLVNIPSSPICR"
FT   gene            580778..581941
FT                   /locus_tag="IL0550"
FT   CDS_pept        580778..581941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0550"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81391"
FT                   /db_xref="GOA:Q5QWU0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU0"
FT                   /protein_id="AAV81391.1"
FT                   /translation="MKKVAVFTGTRAEYGLLYWLLKDIQDADDLKLQLLVSGSHLSPEF
FT                   GHTADQIEADGFEISEKIEMLLSSDSAVGSVKSLGLGIIGYADALERQQPDILVVLGDR
FT                   YEALGVTQAAMLMRVPVLHIHGGEITEGAYDDAIRHAISKLSLLHATSTESYRKRVIQL
FT                   GEAPERVITVGAIGLDHLKRSEFMSRQELSESLKFSLDGDFAIVTYHPVTLANEPAEEA
FT                   FENITEVLDTYPWLKVIITYPNADEGGRKIIPLIEAYAAKHKERVIVVPSLGQRRYLSA
FT                   VKHATVVIGNSSSGIIEVPSFNVPTVNIGARQFGRLAAESVVNCSPSEVGIRKALEQAI
FT                   DMFKSNALSSVVNPYGKGNASAKILNLIRKADLTTIKTFHDLDSEQG"
FT   gene            581947..583020
FT                   /locus_tag="IL0551"
FT   CDS_pept        581947..583020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0551"
FT                   /product="Sialic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81392"
FT                   /db_xref="GOA:Q5QWT8"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWT8"
FT                   /protein_id="AAV81392.1"
FT                   /translation="MTLIIAEAGVNHNGDAKLARDLVTSAHKAGADIVKFQTFKAKNIV
FT                   TEKATQANYQKKNLGREESQLAMLQRLELSHELHYELVDYCNELGIEFLSTAFDDESLN
FT                   FLVNDLGLKRLKLPSGEITNAPLVLKHAQTGCDLIVSTGMATMAEIESVLGVIAYGYLN
FT                   PHAKQATRADFETAYASESGQQILREKVTVLHCTTEYPAPMEEINLNAMNTIGTTFRLQ
FT                   IGYSDHSRGITIPIAAVAKGATIIEKHFTLDRNLEGPDHKASLEPDELAEMVTAIRDVE
FT                   KAMGDGVKRPTVSEVNNKNIARKSLVTVNPLKKGQVITADDIAVKRPGGGRSPYDYWKI
FT                   IGQQCDRDYQSGDTLID"
FT   gene            583013..583654
FT                   /locus_tag="IL0552"
FT   CDS_pept        583013..583654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0552"
FT                   /product="Acetyltransferase, isoleucine patch superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81393"
FT                   /db_xref="GOA:Q5QWT7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWT7"
FT                   /protein_id="AAV81393.1"
FT                   /translation="MTKRYLVLGGGGHARVIIDILASYNIPIEAIVAPELGRMQEFKGL
FT                   KHLRKDEEVRHYNADEVSLVNALGSLPGQYNLREGLFKRFKKAGYQFLTVVSEAAIISQ
FT                   YAVLEEGVQVLPGAILNACNVGENSIVNTGAIVEHDVTIGKHCHIAPGATICGNVTLGD
FT                   NVHIGAGATVIQGIDIGDSAVVGAGSIVSKNLFARDRHYPAKSFIKKGSQ"
FT   gene            583656..584711
FT                   /locus_tag="IL0553"
FT   CDS_pept        583656..584711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0553"
FT                   /product="Nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /note="involved in lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81394"
FT                   /db_xref="GOA:Q5QWU3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU3"
FT                   /protein_id="AAV81394.1"
FT                   /translation="MSYDWRNAVVGPSVSVKDTLEKLDKEALRIVLVCDDSMKLLGVVT
FT                   DGDIRRALLKGMGLECDVHKIMNPSPTTITNNTSRKDAVALMQSKSILATPILEEGKLI
FT                   GLETLQQAKSRKQYSNPVFIMAGGFGTRLRPLTDDTPKPMLKVGERPILETLILNFIKA
FT                   GFSKFYISTHYLPHVIRNHFGDGSKWGVNITYVHEETPLGTGGALGLLPDDTPEHPLIM
FT                   VNGDVLTNVDFERVLDFHVQNAALATMCVREYDYQIPYGVIVGDGERIISMEEKPIQRF
FT                   FVNAGIYVINPEVFKTVDKNRHIDMPTLLQKYLDANKEVLMFPIHEYWLDIGRMDDFER
FT                   AQADIKGLSFE"
FT   gene            584704..585414
FT                   /locus_tag="IL0554"
FT   CDS_pept        584704..585414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0554"
FT                   /product="CMP-N-acetylneuraminic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81395"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU9"
FT                   /protein_id="AAV81395.1"
FT                   /translation="MNDMNSSETLIIIPARGGSKRLPRKNVKPLAGKPLICWTIEAAIK
FT                   ANLDAKIIVTSDDDEILGLADTYKSKGVYKRKRPDNLATDTASTVDAIIDVIESEKELG
FT                   NNPQTIILLQPTSPIRNEDDIRNAFLLYNDTEAHNYRNTVVSVCEVEHPTAWVGWVDEN
FT                   MSFTGTELLNKRSQDYEKEYRLNGAVYVASVEHIFKEKSLFSQKLKASVMPRTRSIDID
FT                   EEVDFKVCEGLLSG"
FT   gene            585407..586435
FT                   /locus_tag="IL0555"
FT   CDS_pept        585407..586435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0555"
FT                   /product="UDP-glucose:glucosyl LPS a
FT                   1,2-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0555"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81396"
FT                   /db_xref="GOA:Q5QWU8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU8"
FT                   /protein_id="AAV81396.1"
FT                   /translation="MVDNLFVVESPLQALVALELSLRFKDARNGIVYRFVEGREQNNEQ
FT                   IENVISKGEWSFRKKVLFDSSSGLSSHRSIVRELNYFNKTFPESIKQLFIGEFRAQWMH
FT                   FMRVAVAPSLTVLMDDGAATLMVKREFIDKGIYYPTALWAHGSFMKRLVKRHMYSRFLR
FT                   NNELQSHLYFASAFIKTEALYPIDFSAVKKLFKSSEKGAREKAVFFFGSKYSEVGIVSR
FT                   EYELAFLERVKRFYSLYDCDLVYCAHRDESDEKLNVLRNTLKFKVVMPETPAEIFLLEN
FT                   NQRILEVSGAYTSVLNNAKVLLPDVLVRAFQLAPEEISVEHRKNIELVYKHFNREDIKL
FT                   VL"
FT   gene            586498..587760
FT                   /gene="wecC"
FT                   /locus_tag="IL0556"
FT   CDS_pept        586498..587760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecC"
FT                   /locus_tag="IL0556"
FT                   /product="UDP-N-acetyl-D-mannosaminuronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81397"
FT                   /db_xref="GOA:Q5QWU7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU7"
FT                   /protein_id="AAV81397.1"
FT                   /translation="MKDKICVIGMGYVGLPLAVAFAEKYSVVGFDINFSRVQELEAGQD
FT                   STLEVSSKELQAVKDLLKFTNNAADIRDANIYIVTVPTPIDRSNKPDLSPLEKASETVG
FT                   SVLKAKDIVIYESTVYPGVTEEVCVPVLEKVSKLSYNQDFFCGYSPERINPGDKQHTVK
FT                   NILKVTSGSTPETAERVDALYSSIITAGTHLASSIKVAEASKVIENTQRDVNIALINEL
FT                   AMIFNEMGINTDEVIEAAATKWNFIKLKPGLVGGHCIGVDPYYLTYKAEELGYKPNLIL
FT                   SSRQINNGMGKYVADATIKELIDKEKLVKNANVLILGYSFKENCPDVRNTRVVDVVENL
FT                   YKYGVNVHIHDPWVAKPTSTDGLTFVTEVSSKSNFYDAIILAVNHDCFSSYTENDFAKL
FT                   VRGKFILIDVKSVKNFSTWKL"
FT   gene            587814..588626
FT                   /locus_tag="IL0557"
FT   CDS_pept        587814..588626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0557"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81398"
FT                   /db_xref="GOA:Q5QWU6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU6"
FT                   /protein_id="AAV81398.1"
FT                   /translation="MSLVSVIIPVKDRVLPLKRAIESVKKQSHRNIEVIIVENNSKSPP
FT                   KIKAAIEDMGDPALKFFSLSSCDNANVARNYGISKASGDYLAILDSDDEFFPTHIEDCL
FT                   KLLTESCCDFVFGSIYLDDGASKIARYSRNLTFGESGIEYLFGKNAGWAPTPTYFLRKE
FT                   VTTNVVWDENLRRHQDFDFFIRVVSKYRVIAKKEPSVVVHWKKGEKRTYDSSSMRIFYD
FT                   KWRSKMGLIEKISYSKNKVRIAILNRDMHNLAFFTLEYFKAKICAYFK"
FT   gene            589135..590256
FT                   /locus_tag="IL0558"
FT   CDS_pept        589135..590256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0558"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81399"
FT                   /db_xref="GOA:Q5QWU5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU5"
FT                   /protein_id="AAV81399.1"
FT                   /translation="MVILHIIAGLEKGGAESTLKRLCLNGTEHEHVVVSLSTLGSVGLE
FT                   LQKAGVKVYCLDIRPSITSVAAIFRLYKIIKLRKPSVVQTWMYHADLVGGIVSRVAGVK
FT                   KIYWGVHHTYLIKGQSKRVTIFISRINSVLSHFIPTKIVYCANSARVAQEKIGYNKKSG
FT                   IVIFNGYDTSKFKRDLKLRSVYREKLGLKETDFVIGHVGRYDSLKDYPNLINAIRKVKY
FT                   KVGGLKVILVGAGLSKDNRELLNVISESTLISKFHLLGPSDDIPGIMNAIDVFVLSSSS
FT                   EAFPNVLNEAMACGTPCVSTDVGDASAIVGMTGWLSAAGDSSALAEKIYAAYKEFSENK
FT                   ANWEERQYSCRERIVTNFSSQSMVSNYTLLWQS"
FT   gene            590345..591355
FT                   /gene="galE"
FT                   /locus_tag="IL0559"
FT   CDS_pept        590345..591355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="IL0559"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81400"
FT                   /db_xref="GOA:Q5QWU4"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWU4"
FT                   /protein_id="AAV81400.1"
FT                   /translation="MILVTGGAGYIGTHCCVELIESGYDIVVLDNLKNSTLEGLRQVER
FT                   IVNKRVRFVEGDVRDLGLLEKLFGEFKFNAVLHLAGLKSVNESLSHPVEYYENNVTGSL
FT                   SLLKVMEKFGCKCIVFSSSATVYGHPECVPISENSTLSTINPYGSSKLMVENILRDLSS
FT                   STLGWSIGILRYFNPVGAHESGLIGELPLGVPNNLMPYIAQVALGKLEKLTVFGNDYNT
FT                   KDGTGVRDYIHVVDLAKGHVEALRELFGKEDLFIANLGTGVGYSVLELIKNFEKISGRK
FT                   VPYEVGNRRRGDVAACYADPSYAKSRFGWSAEFDIDRMCHDTWRWMVKSNKTSVD"
FT   gene            591406..592443
FT                   /locus_tag="IL0560"
FT   CDS_pept        591406..592443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0560"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81401"
FT                   /db_xref="GOA:Q5QWV6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV6"
FT                   /protein_id="AAV81401.1"
FT                   /translation="MLIYYFTFIFLFILGLGYQHLNLGKDSKVALIGCVILALLFIYGF
FT                   RFEVGVDWFNYIRVYERDVANALTFTTPELGYKYLNVLSGALGSGIHGVVFVATLMLLV
FT                   FSFLAPMRLGINPFYFMALVAPYHLVVAGMNLTSQSIAISIFIYAVTFLMQKRKVTYAF
FT                   LILFAALFHFSAILLLSFLFIDFRKSYLIPPLLFIFLPVVGAAFFFYGHYFESEMENAG
FT                   VILRVGFLFPVALLILAHKKKWLKLDKIRFRLCLVTVLIGPMLLAASLLSSTLADRFSY
FT                   YFIPLAALLVMEQVIHSKRRPSDLMTYASPIMFLTAVTAFVAWHVASSYIPKYQFQHLF
FT                   FAAAS"
FT   gene            592743..593366
FT                   /locus_tag="IL0561"
FT   CDS_pept        592743..593366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0561"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV5"
FT                   /protein_id="AAV81402.1"
FT                   /translation="MLLDYRNSSVQAIFQNYADYRFYRRFCNHAKVYWVPGSGGVSRKI
FT                   GASENSFVAIQRDSKLSLVAKSIQECASLIQEVKAGDSLSFTLVGCSIRNELAKAQLPN
FT                   FENVGRYAQDDIFIDGRSFIQPEGYGEGIPHTLVDAMCSGMKVFIKKQCFLRYGLHKLH
FT                   CKFSCIGNGWGELGATANASKEVSLESVNESYISIISSMNKLKK"
FT   gene            593363..594289
FT                   /locus_tag="IL0562"
FT   CDS_pept        593363..594289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0562"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81403"
FT                   /db_xref="GOA:Q5QWV4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV4"
FT                   /protein_id="AAV81403.1"
FT                   /translation="MKVLLTGSTGFLGAHLNKYFLGKGLSTVTPVRKPGNGNEQTTNIR
FT                   LSALSDLTTKILVSENVGIFVHCAGVAHKKNVSADDFFRVNTELTLLLARRAAMAGVKR
FT                   FIFFSSIGVNGASSDSPFNACDSGAPYDAYTESKYDAEEGLKAVSQETGLEVVIIRPPL
FT                   IYGVNAPGNFAKFVKLANIPIPKPLGSIKNKRSFVSVNNLCDFTYLCLTHPGAANETFL
FT                   VSDGEDLSTSEFLRKISKAMDKPAMLIPFPVNVMKRLAGVVGKKELIDKLVVNLQVNIE
FT                   KNKVLLGWEPKVSVDEALRNALSQEKA"
FT   gene            594312..594863
FT                   /locus_tag="IL0563"
FT   CDS_pept        594312..594863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0563"
FT                   /product="Sugar transferase"
FT                   /note="involved in lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81404"
FT                   /db_xref="GOA:Q5QWV3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV3"
FT                   /protein_id="AAV81404.1"
FT                   /translation="MLLRAFDLAFSFVGLVTGLPILILLTLIGLFDTGSPIFRQERVGK
FT                   NKKPFVLVKFRTMKKDTASVASHLASSASITKFGHFLRRTKLDELPQLWNVLKGEMSLV
FT                   GPRPGLFNQEELTQAREAKGVFNVRPGITGLAQVNEIDMSTPQLLAETDAKMISTLNIK
FT                   NYFQYILMTVTGKGSGDRVK"
FT   gene            594860..595915
FT                   /locus_tag="IL0564"
FT   CDS_pept        594860..595915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0564"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81405"
FT                   /db_xref="GOA:Q5QWV2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV2"
FT                   /protein_id="AAV81405.1"
FT                   /translation="MKVLVTGTAGFIGFYTALKLLKQGHTVVGLDSINDYYDVNLKYGR
FT                   LQESGIKQSNIEYGATVQSGLYPDYSFVQLKLEDKPALDALFEQEQFDAVCNLAAQAGV
FT                   RYSLENPNAYIDSNIVGFMNVLEACRHNGVKNLSYASSSSVYGLNEQMPFSTSHSVNHP
FT                   VSLYAATKKSNELMAHTYAHLYGMQCTGLRFFTVYGPWGRPDMAPFIFTKAALKGDTIK
FT                   VFNNGKMKRDFTYIDDIVEGVVRVIENPCKASSEWSGKQPDPSSSSAPYKIYNIGNSQP
FT                   IELMTFIEAVENAAGVEIPKDFQPIQPGDVVATYADVSELESDMGYRPSTPVTEGMKRT
FT                   VDWYRNFYGMA"
FT   gene            596038..598800
FT                   /locus_tag="IL0565"
FT   CDS_pept        596038..598800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0565"
FT                   /product="Polysaccharide biosynthesis/export protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81406"
FT                   /db_xref="GOA:Q5QWV1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV1"
FT                   /protein_id="AAV81406.1"
FT                   /translation="MNKNALNATQFSVSTVLFAAVFALVTSMFSVNAAAQAMPSQEQLE
FT                   QLQSLPRAQQEALARQYGIDPSAIDQFNAAQRDGDSSAKQEVDVVSERSGNGDTGQTSS
FT                   SFMSENLQKEFNRGRSELKPFGYDIFSGEPNTFAPVAHAPIPANYIISVGDVIHVEMFG
FT                   KQDESFKLTVNRDGSIVLPDVGEMKVAGMTYSLMQEMIHHEVQERLIGYKAAVTMGELR
FT                   SIQVFIVGEAYKPGAYTVSSLATISQALYVAGGVSDIASLRSVRLMRGGKVASEFDLYD
FT                   LLLQGDASADKTLKSGDVIFIPARGDMVAVKGEVKRPALYELKGDETLEDALEFAGGAK
FT                   DSAYLQSAELRRIVKGKRLVSTVDLTAEKDLNRELSGGDALTVREVSQELDNSLMVVGA
FT                   VTRPGYYEWQDGMRINDILRDVRHDLLEQADLGYGLVVREQGPRRNVKVLQFDVADAIN
FT                   GVEGENLRLNERDQLVVFSRFETKAEERDSLSRYTLSEQEREYQQRQRQLDAYRDAYLN
FT                   DVVNTKLAGSSESPDAENEDKIVPLRELFTEKQEEEPTVKKELAMYSRQNLLEPIMQRI
FT                   QRQRTATGTAPFVSVAGEVMHPGIYPLVENATAEKLLAAAGGLKNGAYTEQAEITRWAI
FT                   GKDTANTDYLKIDLAEVINGEVDVPLQGRDRLNVLSIPEWQNTYEVTLRGEVRFPGTYS
FT                   IKRGETLSDVIKRAGGFTDHAFLEGVVFTREELQEQEQKRKEMLAQELQREIASNMITG
FT                   TGDANQSYDQMRTLLADLMSTPAVGRLIMDLPKVLSMNGSRDVQLKDGDTLHVPSRSDS
FT                   ISIMGEVQMATSYRFDSELTVDDYISRSGGTKEKADTDRIYIVKANGAIEPYKGGSSWF
FT                   GFGGGTDLGPGDAIVVPLDTTYTESLELWSEITNIIYNSAVAVAAISSI"
FT   gene            598965..599261
FT                   /locus_tag="IL0566"
FT   CDS_pept        598965..599261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0566"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81407"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV0"
FT                   /protein_id="AAV81407.1"
FT                   /translation="MKTLALSVVAALGLAAAPAMAQDGAAGANASESGYGGLSTEAWVF
FT                   AGVAAAATVAVVSDSSSNSAIDPTDPTDPTDPDPIVTVTGTGTNTYTITIPGQ"
FT   gene            599398..600108
FT                   /locus_tag="IL0567"
FT   CDS_pept        599398..600108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0567"
FT                   /product="WbfD-like uncharacterized domain involved in
FT                   polysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81408"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW3"
FT                   /protein_id="AAV81408.1"
FT                   /translation="MSRLLLIPIVLLLLSACTAVTDEVRATIEYAFEGGEDAELSQEKI
FT                   DSFPYTSLYAQWSDNPRSLIVLGYVNKPDDWHFITAEKETLVLRNGRVIRTQALNKNLL
FT                   AVSNLKDDPLRCIVTSQANCPTHWRRQYDIEMANKVVSREASSEFSVQDKQVLNLPIGP
FT                   VNTTYVVEKGEFTLSGQEFVNEFWLEDDGHVVKSRQTLFPGGDKLTLTQVTWIGRDYSA
FT                   SRNAREEQQGQEAQ"
FT   gene            600117..602984
FT                   /locus_tag="IL0568"
FT   CDS_pept        600117..602984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0568"
FT                   /product="Fusion of WbfC-and WbfB-like uncharacterized
FT                   domains involved in polysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:IL0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81409"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW2"
FT                   /protein_id="AAV81409.1"
FT                   /translation="MKLMLRNTLLISALFSLNAVAQQAKYEFEGPVRLQQVLNDAESEG
FT                   LLADAYWPLVRLVKTDDKAEIEQQRNQILAQLTELEQYWQSRRETEKAQSAALLKSQVK
FT                   SWQLGKQLWGQISIENARTELASNPLLPAGEYKLYVPERPDSVHVYGVVSTPGDYRYAS
FT                   GKTVADWLNSIDDSEGLGAAYNKSQAVRIRQNQQQTADWAYYKQSDAELLPGDILWLGF
FT                   EPNQLPPKFESLNADIRDLLMHFVANESERNSLNLPVHEVENNHATSSWHWSRRDLSPS
FT                   YGDYGSVGLLQTPTARMAEEGALAITYSDMEEYRRYTVNLQLLPWLETTAFYTEFPNRK
FT                   YSNVPDFSGDNVFADKGFDIKARLWEESYWVPEVSVGFRDFVGTGLFDAEYIVANKRFG
FT                   PLDVSLGVGFGRLGTRDDFTNPFCELSDEYCDRETGYGSGGGQLEYDRWFTGPAALFGG
FT                   VEYHTPWEPLSLKVEYEGNDYSDERAGVPIKVDSRWNFGANYQVTDYFDVQLSYERGNT
FT                   FMFNFSLRTNFGTLNQIKVTPDKTVPTPEKRKESLDDVNWSAMNLAMREQGAFSAARFA
FT                   AEDDEVTLFAYHLRYRDSSEAYDRAARIMAAELPDSVKTYNLVDMTLFDPNVNTRVNAD
FT                   KFKDRVLNKDPGKAVDETGDLFERMDSPDMPAEGDDSWMLNPRNQFSNRFGLKPFLDQS
FT                   FGNPETFYTYQLGVYAFGRRWLTDNVELFGELGFNIATNYDDFLFLDGGEDALPDVRTN
FT                   IRRYVQNDIWLDSAQVTYHKRLGQDWFAMAYAGYLERMFGGVGAEVLYKPVDSRWAFGL
FT                   RANRVRQRDFNGGSGFLDYEVTTGFASVYYQMPWLSDSLLQLDFGQFLAGDKGVNVTMQ
FT                   KRFDSGVIAGAYAAFTDVSSEEYGEGSFTKGFFISIPFDLMSIRPTRERVGFSWVPLSR
FT                   NGGQQLQRRTRLYDYTDDRAPFYSR"
FT   gene            603028..604932
FT                   /locus_tag="IL0569"
FT   CDS_pept        603028..604932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0569"
FT                   /product="Membrane-associated enzyme of
FT                   epimerase/dehydratase family, wbfY-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0569"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81410"
FT                   /db_xref="GOA:Q5QWW1"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW1"
FT                   /protein_id="AAV81410.1"
FT                   /translation="MQLPRNVKRGIGLGVDILSIAIAMVFSYLLSFEAVMPLRVSQWLL
FT                   LGAIVLCVTLLVFIRMGLYRAVVRYVGFKVLSLVFFTVLLSGALLVLGALWMGIALPVT
FT                   AVVNYVLVAFLLTGGSRLIVREGYQRAMSRQKDRVMIYGAGSAGRQLAQALANGDEFHP
FT                   VMFIDDDSGLQNTSVLGLKVTGPEGIACAVRELDVQRILLALPSTLRSRRRQILDSLEQ
FT                   LPVKVQTVPGMSDMVNGDMSIDQLQDVRVEDLLGRDPVTPAPQLMEKHITGQTVLVTGA
FT                   GGSIGSELCRQILQQRPKVLVLYELSEFALYAIERELTQICQHQGIGAEIIPVIGTVQR
FT                   RNRIETVLKTFAVDTVYHAAAYKHVPLVEYNMVEGVRNNVFGTWHTAEAAISAGVKQFV
FT                   LISTDKAVRPTNVMGTTKRLSELVLQGLAQRQRGTRFSMVRFGNVLGSSGSVVPLFKEQ
FT                   IEHGGPVTVTHPDITRFFMTIPEAAQLVIQAGTMGHSGSVFVLDMGDSVKIVDLARKMI
FT                   RLSGLEEKTEKNPHGDIAIEFSGLRPGEKLYEELLIGDNVEASDHPRILRANEQSLSWD
FT                   EMEKLLGLLDDACQRFAIDELRQLLLDAPTGYAPLDDHICDVIWNKHRTCSDDETDVA"
FT   gene            604952..606421
FT                   /gene="pgi"
FT                   /locus_tag="IL0570"
FT   CDS_pept        604952..606421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="IL0570"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0570"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81411"
FT                   /db_xref="GOA:Q5QWW0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWW0"
FT                   /protein_id="AAV81411.1"
FT                   /translation="MIKNGPYLALDTSYQKLSVDELLETAGKRLPEHFDDYRQQLCRGE
FT                   YRNISEDRPVTHVLSRSVHAVAKQSNRKTRFVDTVQKLRSGRRLGSTGKPITDVVNIGV
FT                   GGSDLGPQMGAFALREFANDAALHNLQVHFVSSMDGGQLYAVLPIVDPETTLFIISSKS
FT                   FGTVDTFANVDTVRKWIEPELTQEQWLENHVIGVSANAQGMTDYGIPPAQQFTFGDGVG
FT                   GRFSLWSALGLSIALTTGIRPFERMLEGAKAMDEHFLDAPLNENLPVLLALYGVYNREQ
FT                   LGINNLAILPYDGRLRMLPNYLQQLDMESNGKQYTAENEAIDYPTGPIIWGGFGPNGQH
FT                   AFFQHLHQGYDQFTADFVTVLKREAPGFSDATRSGLAEQQRLAVANCLAHRRLMSDGSE
FT                   NADSPSDHYPGGHPSNLLIMDELTPESFGALIAAYEHKVFTQGVIWGLNSFDQPGVEKG
FT                   KKIAMDVLRVLDGESDESFDESTDAVIQRMR"
FT   gene            606573..607208
FT                   /locus_tag="IL0571"
FT   CDS_pept        606573..607208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0571"
FT                   /product="Uncharacterized conserved protein"
FT                   /note="acid tolerance protein; similar to SatD"
FT                   /db_xref="EnsemblGenomes-Gn:IL0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV9"
FT                   /protein_id="AAV81412.1"
FT                   /translation="MKNSMIGVITGDIVNSRQIPVEEYDSMLYRLHQTLESFSERYQMH
FT                   FDVFRGDEFQLLLKRPEKVIYLATIIRLSLKSGSTNIDVRQSLSVGDSNELRDDVKSST
FT                   GEAFVLSGQNLNKMKSELLIFDSTIELLKHHLGSTIELLDAHLSSITKTEAYVLINYLG
FT                   DPEVSHAELAKEIGKSRPNTTKMLNSARYNSVLKYLYYAENLIIEARG"
FT   gene            607210..608013
FT                   /locus_tag="IL0572"
FT   CDS_pept        607210..608013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0572"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /note="acid tolerance protein; similar to SatE"
FT                   /db_xref="EnsemblGenomes-Gn:IL0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81413"
FT                   /db_xref="GOA:Q5QWV8"
FT                   /db_xref="InterPro:IPR021737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV8"
FT                   /protein_id="AAV81413.1"
FT                   /translation="MNDYLILMLLLLAHIAGDFYCQPDYLVGKKLSSSFRKRLYANAIH
FT                   AFIHAGLVVLLLLIPKMSWDDLLVTTAVIGVTHFIIDSLKSVAVIKWVDTWEENEQPEE
FT                   GSKPRKRNRAFYWFVLDQLAHLSVIILIWLGLFQPFSSIVEYLSVEYLVVVISYLLVLK
FT                   PTSVLVSLILKLCETREKKDRTLDEAGAVIGYIERLVILTLILVGQYTAIGFVIAAKSV
FT                   LRFGENKGKDTKLNEYVLLGTLASFAIVLFVGIATTEVLEILKCN"
FT   gene            608168..608902
FT                   /gene="cysQ"
FT                   /locus_tag="IL0573"
FT   CDS_pept        608168..608902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="IL0573"
FT                   /product="3'-Phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81414"
FT                   /db_xref="GOA:Q5QWV7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWV7"
FT                   /protein_id="AAV81414.1"
FT                   /translation="MLKEVKDIAHDAGAAIMDIYQSNDFDVQKKADDSPLTKADLAAHN
FT                   IICEGLRALDIQYPVISEESSDISWAQRKHWCRYWLVDPLDGTKEFIKRNDEFTVNIAL
FT                   IEKGVPILGVVYAPALDAMYTGERDRGAFLNDKAISVATQEPEALRVVGSRSHPSQETT
FT                   DWLDAQGKSYEMLAVGSSLKFCLVAEGKADIYPRLSPTSEWDTAAAHAVLSAAGGDVLT
FT                   LNGEPLLYNQKADYLNPHFIAR"
FT   CDS_pept        609005..610036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81415"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81415"
FT                   /db_xref="GOA:Q5QXA4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXA4"
FT                   /protein_id="AAV81415.1"
FT                   /translation="MAIVNRIALDLAKDFIQVLALDENEQEVFNKKLRSNKVLAKLATL
FT                   SRTDDCEVAVESCGMSHYWRRECEKLGYKTVALPPRFVKAYLQGEKNDANDARAIAEAA
FT                   SRPNRQTVRLKSIEQQDLALMVNQREGFVQTRTQFSNRLRGQLAEYGILLPKRVGTILQ
FT                   RVPEVLEDDSNALTLQSRDLINRLYQMLRAVDEEVKALDKHLATQAERNEDSQRLMTLP
FT                   GIGPITATSLLALIGDVSEFKRGRNLSEYLGLVPRQNSSGGKDRLGGITKKGNTKLRTL
FT                   LVHGARSALRVAQQRHDRLSLWAQDVAKRRGNNVAAVALANKHARIIWAMLKNKEDYRM
FT                   TAA"
FT   gene            610435..610788
FT                   /locus_tag="IL0575"
FT   CDS_pept        610435..610788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0575"
FT                   /product="Predicted secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0575"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81416"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW9"
FT                   /protein_id="AAV81416.1"
FT                   /translation="MKLLLAFATTALLAGCSTAQSATDTPVTMADINELIGKPEAQSID
FT                   SCKVLPVGKRACGGPAGYVVYSSETITDESKLLNAVHRYNEKAEKDAQTGYSTCQFIPE
FT                   PEPQLKAGVCWIP"
FT   gene            610854..611060
FT                   /locus_tag="IL0576"
FT   CDS_pept        610854..611060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0576"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0576"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW8"
FT                   /protein_id="AAV81417.1"
FT                   /translation="MDKIDRAYYPELDKLLWDTNTKYLTPKEALDIYETRWRFVEERQL
FT                   LKRERQLIDKLAKDAGGFLPSAA"
FT   gene            611067..611771
FT                   /locus_tag="IL0577"
FT   CDS_pept        611067..611771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0577"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81418"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW7"
FT                   /protein_id="AAV81418.1"
FT                   /translation="MSTYQRKHHQLIQRCLDNFNSHYLTEHAILFGGGTRIALELSEYR
FT                   ESVDIDFLCRDKKSFRAVREQVTNRTLGELVKEDFIYSRDISFDRYGVRTFLDVDGVRI
FT                   KLEFVAFDNYALEQGDDADLFNVPFIDRTSCFITKLLANADRWMQKPYKDIFDLIVMFE
FT                   NWGEIPPEAYAEAHTHYGVQVVNNGLKRALQNLRNNHIAYREEAEGMGIQREYFDNVVF
FT                   PGSERLLSKLLN"
FT   gene            611844..613313
FT                   /gene="guaB"
FT                   /locus_tag="IL0578"
FT   CDS_pept        611844..613313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="IL0578"
FT                   /product="IMP dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81419"
FT                   /db_xref="GOA:Q5QWW6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW6"
FT                   /protein_id="AAV81419.1"
FT                   /translation="MLRIAQEALTFDDVLLVPGHSEVLPHTADLRTQLTRGISLNIPLV
FT                   SAAMDTVTESALAIALAQEGGLGFIHKNMTAEQQAAHVRKVKKYESGMVSDPVTVRPTT
FT                   TIGEIKKLTAEHGFQGFPVVEGNGDLVGIVTGRDTRFEDDDSKEIRHVMTGNDRLVTVH
FT                   ETAESEEILQLMHKHRIEKILVVDDAHKLKGMITLKDFEKAENKPNACKDELGSLRVGA
FT                   AVGVGAGTEERIQLLVEAGVDVLLIDTSHGHSQGVLDRVKQTRKDYPELQIIAGNVATA
FT                   AGAKALVEAGVDAVKVGIGPGSICTTRIVTGCGVPQISAISDAVDAIKGSGVPIIADGG
FT                   IRFSGDIAKALAAGAHCVMVGSMLAGTEESPGEVELYQGRYYKSYRGMGSLGAMNQRNG
FT                   SSDRYFQKSDEADKLVPEGIEGRIAYKGPISAIIHQQMGGLRSAMGLTGCPTIDDMRTK
FT                   PQFVKVTAAGMGESHVHDVHITKEAPNYRSS"
FT   gene            613325..614902
FT                   /gene="guaA"
FT                   /locus_tag="IL0579"
FT   CDS_pept        613325..614902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="IL0579"
FT                   /product="GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81420"
FT                   /db_xref="GOA:Q5QWW5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWW5"
FT                   /protein_id="AAV81420.1"
FT                   /translation="MTRDIHDHRILILDFGSQYTQLIARRIREIGVYCELWAWDVDEAD
FT                   IREFAPKGIILSGGPESVAEEGSPRAPEYVFNAGVPVFGICYGMQTMAHQLGGSVQCSL
FT                   EREFGYAQIELVEQSPLFKAIEDAVSESGAPLLDVWMSHGDKVEMIPEGFHTVAKTSYC
FT                   PYAAMADEERQFYGVQFHPEVTHTRQGQRMLEHFVSDICGCEKQWTPAKIIDDAIERIR
FT                   EQVGSDKVILGLSGGVDSSVTAMLLHRAIGEQLTCVFVDNGLLRLNEAEQVMEMFGDHY
FT                   GLNILPIRAEDRFLDALAGENDPEKKRKIIGNTFIEIFDEEAGKLTEVDWLAQGTIYPD
FT                   VIESAGSKTGKAHVIKSHHNVGGLPEDMKLGLVEPLRELFKDEVRKIGLELGLPYNMLY
FT                   RHPFPGPGLGVRVLGEIKKEYCDLLRRADAIFIEELHNADWYNKVSQAFAVFLPVRSVG
FT                   VMGDQRKYDWVIAIRAVETIDFMTARWAHLPYELLEKVSNRIINEVNGISRVTYDISGK
FT                   PPATIEWE"
FT   gene            complement(615065..615589)
FT                   /locus_tag="IL0580"
FT   CDS_pept        complement(615065..615589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0580"
FT                   /product="Uncharacterized conserved secreted protein,
FT                   distantly related to OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWW4"
FT                   /protein_id="AAV81421.1"
FT                   /translation="MKKLILTTALLASGSLMFSAASKADDLNYVSGGFSDFYDSDFYVE
FT                   GSKTIAPNWVGEIQLQDMGDYSLRAGAKYFIDMGAGKQFNTFLKAGVSHYDFGNYDDTS
FT                   AYAGIGTMTKLSQQTTAIVDAGYDWGLDGFASVGARLRYAFTEQFSADAGFRGNFNSID
FT                   NEVHLGVTYHF"
FT   gene            complement(615778..616986)
FT                   /locus_tag="IL0581"
FT   CDS_pept        complement(615778..616986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0581"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81422"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX6"
FT                   /protein_id="AAV81422.1"
FT                   /translation="MGFIRFLLILTFVVLMIPTSFNAFAGSGKGEPETIRVATFNVSMD
FT                   ASNYLSDSELPQLDKSPVPEVLQQDHEQIRGIAEILQRVRPDIVLLNEFDYVDKEIGVN
FT                   VFQEKYLSIPQNGQKAIEYPYTYIAPVNTGVASPFDLNRDGTAQGTGIDAWGFGWYPGQ
FT                   YGMVILSKYPLLTDKARTFQHFLWKDMPGRHIPYVMNEQEQPTDEQWYSDEIMAQYPLS
FT                   SKSHWDVPVQVGDKVIHLLAAHPVPPAFDGPENSNGMRNYDEIRLLADYLTPGSDNYLY
FT                   DDNGVRGGLGADESFIVMGDMNAEAGSGGIDGAIEQLLQHPRVNDVKPQSRGGEQHSPD
FT                   KRGSQYHTAAWRKRVDYVLPSNDLVVKDAGVFWPVGDEAGSRLMQKRSASSDHRMVWLD
FT                   IVK"
FT   gene            617378..620539
FT                   /locus_tag="IL0582"
FT   CDS_pept        617378..620539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0582"
FT                   /product="Oar-like outer membrane protein protein, OmpA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81423"
FT                   /db_xref="GOA:Q5QWX5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX5"
FT                   /protein_id="AAV81423.1"
FT                   /translation="MFNSTFKRTAVAAAIAFGLSGAAIAQDTSSVVRGNVVTESGEVAA
FT                   NARVEIIHVPTGTRSVATTNESGAFSNSGLRVGGPYIIVIESSEGKKVYEDVYLSLGEP
FT                   LRINAQLESSDMERLQVTGTAILGGANSGSSSYFGEEDIANTPTFNRDLKEVARLNPYV
FT                   NLLSGSESPLSIGGANPRYNSIAIDGVGVNDDFGLNGNGYPTQRSPISLDAIEQVSVDV
FT                   APFDAAEGGFSGGRINAVTKSGTNEFHGSLTYERMSDAWAGDPENPAGDEVPLDFERDT
FT                   YSLALGGPIVKDKVFFFVNYEKSKEPAQIEFGPAGAGAANDSDVTQEQYQEVRDIAQGV
FT                   YGVDIGNWNTLKDTTNENLLVKLDWNINYDHRLAFTFNRTEGNNVRGQSNNPDSLALST
FT                   NWYDYQQNMDLYRLSWFSDWSADLSSEIYVSYKSVESISGLETKEFGDISVDMDSEGEI
FT                   SLSFGPDYNRHANSLETDNLKIGARFDYLVGDHEIEFGGEYDKTDVFNIFVRNSLGSWS
FT                   FSSIEDFANREASSFYYENAYTNNASDAAADFSLGQLNLYVQDNWYLNDSMELGLGLRY
FT                   ERYNTSDKPTLNENFVERYGYSNQENLDGLDIFLPRVDFKWFAADDLVVRAGAGRFSGG
FT                   RPNVWVSNSFSNDGYTLVQFDRGEVPANEYLNNVDITEVPEAVRNAMYAGDGDTNSIDP
FT                   NYEIPSDWIARVGVDYQFDIPGLGNNFNATAEVMRKWMTDNSQWKDISRCVSGETAAGV
FT                   SIYEPCDPDAPIGHYDLQLTNEDKNGKAWIYTASLSKQWDNGFNAYAAYTHQNIDEGNP
FT                   GTSSTATSNYEYNIVVDRNQPLIGTADYETEHTLKIALGYSHEFFDGYASKFNLFFQRR
FT                   SGTPFSHTMNLYCNRRNNDCDDDFGDQDTFVTGSYLPYIPAGANDANISPESTISYDDM
FT                   MAIFESVDLAQYAGGFAPKGARRAPWVNTLDFQFQQELPGLMDGHKGVFYVSINNLLNL
FT                   IDSSKGKSLRMNYTNNSIIDFNGLDDEGRYIYGAPYGGADTRNWDTFEAEESTWRIKMG
FT                   VQYKF"
FT   gene            620693..623890
FT                   /locus_tag="IL0583"
FT   CDS_pept        620693..623890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0583"
FT                   /product="Oar-like outer membrane protein protein, OmpA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81424"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX4"
FT                   /protein_id="AAV81424.1"
FT                   /translation="MFNATFKRTALAAAIAMGLSGAAIAQETSSSLRGVVTTESGQVVS
FT                   NATIQLRDERTGSTKTLTTNQQGTFSSRGLPVGGPYTIVAEGPGGRTQVVEDVYLTLGD
FT                   SQNVNISLVSQQDMERLSVTGSMTSNALYGSNSPAANFNLQDLQNAPASDRDLRDVVSI
FT                   DPRIYINETNSGAIQCGGANPRFNSLTVDGVRMNDNFGLNSSGYPTERMPFSYDAIEQV
FT                   AVEFAPFDVQYGGFTACNINAVTKTGDNEMFGGVFYDYTNDSLQGDELEGDSINVGDFS
FT                   EKRYGFNLGGAFIEDKLFFFTAYEKLEGSDTFDRGPEGSGAATEVVGVSQADVDRIAQI
FT                   AQDKYGYNPGGFPASLPVEDEKFLAKLDWYINDAHRASLTYNYNDGYSIAESDGDSDEL
FT                   EFSNHFYERGAKFTSYVGELYSDWSDNFSTEARIGYSELDARVNPLGGTDFGEVQIGVN
FT                   DATVYLGADDSRHANKLKYDTTFFKLKGTYLAGDHVISAGIEREEYDVFNLFVQEAQGE
FT                   YRFSSIDEFDAGTPIGSQNDDGSYDDTVIYESAAGTNNPQDAAAEFAYAVNTAYVQDEY
FT                   YYAPMDITFTYGLRYDWYTSDDMPVNNPLTEELYGFSNQQNMDGQDLLQPRFGFNWFVN
FT                   PDLEVRGGVGLYSGGNPNVWISNNYSNNGVTQYEAAFTGDYFLGGNTLFNIPHTGEGRP
FT                   IYDIPQELYDEVANASGQGPINTMDPNFELPKEWKYALGATYTLPDNYILMADFLYTDK
FT                   KDAAVIYNLGLEQVGTAPDGRPIFDELSTDGRDQGDDFMLTNVDGDSGSQTTVSLALSK
FT                   THDFGLDWTLGYAYNEAEDVNPMTSSVSFSNYTNLATANAQNPGVATSNYEIPHRFTFK
FT                   ANYTKEFFDGYDTTVTLFATRNKGRPFSYTMSDGPFGDIAYQGRSLLYVPTGLDDPNFA
FT                   VGTDRDGNPFETGAFFDFLEESGLSKYAGGIAPRNEFNSKWWTKVDLRVEQELPGFMDG
FT                   HKASAFFVIENLGNMLNDDWGVLYEARFPRAINIADVEINDAGQYQFNNFRDVSNVQSR
FT                   QGEPSLWSVRIGVEYKF"
FT   gene            623986..625374
FT                   /gene="nhaC"
FT                   /locus_tag="IL0584"
FT   CDS_pept        623986..625374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="IL0584"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81425"
FT                   /db_xref="GOA:Q5QWX3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX3"
FT                   /protein_id="AAV81425.1"
FT                   /translation="MELSWTSLLPSLLAIVFAIVTRKVLLALIGGIILANILLFWPAPE
FT                   NIAYGTLNSTWDTLIDPSNMLVWFFTLGIGALFGVLENGGTFKEFVLKLEKKQWIENKR
FT                   RARLMTWILGVVVFIESNVTIMISGTTSRPIYDRLGIAREKLAYIVDSTCAAICILIPL
FT                   NAWGAFNLTLITNQGVEQPLLVFIQSIAFNFYAIFAVLLALFVALFDWNIGPMKAFEKN
FT                   AVPDQVSKNTWGDGPDDEASFGKGTAVVMTSLISLVVMVPIILLVTGNGVLVDGNGTLS
FT                   VFVAIYVALGIAVAGTLMTQPAGLADIGKYLLKGAWNILPLAVILWLSIALGGLTRDLG
FT                   TGEFLAAALDGSVALWMLLPLIFVLSAITGFSIGSSWGTFAIMLPLAIPLAMTLGLPAA
FT                   PFIAAAISGGIFGDHASPISDTTIIASMASGVEHIDHVRTQLPYALLAGLAATVAYAIT
FT                   GMLI"
FT   gene            complement(625367..625819)
FT                   /locus_tag="IL0585"
FT   CDS_pept        complement(625367..625819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0585"
FT                   /product="Cytosine/adenosine deaminase putative"
FT                   /db_xref="EnsemblGenomes-Gn:IL0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81426"
FT                   /db_xref="GOA:Q5QWX2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX2"
FT                   /protein_id="AAV81426.1"
FT                   /translation="MQRALELAEQAQNADEVPVGAVLVMDDKIVGEGYNQVISLSDPSA
FT                   HAEAQAIRSAGQAIDNYRLVNATLYVTLEPCAMCAGLITHARVKRLVFGATDPRTGATG
FT                   TAIEVINHASMNHKVDVESGVLAEECGDILRRFFRARRKSAKANAK"
FT   gene            625911..627194
FT                   /locus_tag="IL0586"
FT   CDS_pept        625911..627194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0586"
FT                   /product="Metal-dependent hydrolase of the
FT                   aminoacylase-2/carboxypeptidase-Z family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81427"
FT                   /db_xref="GOA:Q5QWX1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX1"
FT                   /protein_id="AAV81427.1"
FT                   /translation="MKKLIISLMLASSFGYSAQAAAQQSPVKVSSDLEAQVIEWRRHIH
FT                   ANPELSNREFETAKMVAEHLRSLGMEVETGVAHTGVVGMLKGGKPGPTIALRADMDALP
FT                   VTEQTDVPFKSTVKSEYRGNEVGVMHACGHDTHVAMLMGAAEKLAEMKDELAGNVMFIF
FT                   QPAEEGAPEGEEGGAALMLEEGLFADNKPEKVFGIHVWAGFPTGHVGYRKGPLMASADR
FT                   FEIKVKGKQAHGSAPWTGVDPIVTSAQIINNAQTIISRQTNITKAPAVLSFGIVEGGVR
FT                   NNIIPDEVTLIGTIRNFDMDIRSDIHEKLKLTAEKTAEANGAEAHVHVDLGYPVTSNDA
FT                   DLVEQMLPITKAVAGANKVQEVPLVTGAEDFSYYALEVPGMFVFLGVTPPERDMANEPS
FT                   NHSPHFYADEDALKTGTELYVNWALESL"
FT   gene            627196..628563
FT                   /locus_tag="IL0587"
FT   CDS_pept        627196..628563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0587"
FT                   /product="Predicted soluble lytic transglycosylase fused to
FT                   an ABC-type amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81428"
FT                   /db_xref="GOA:Q5QWY4"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWY4"
FT                   /protein_id="AAV81428.1"
FT                   /translation="MPKSAVSLFAILLLAASVITACSPQTRPDAMSVVQERQVLRVGTL
FT                   INPTSYYFDHDREQGFEYDLAKRFADRLGVELEMVPRFDVNDLFTMLRRGEVDIVAAGL
FT                   DRTSTRAQLFRFSPPYDIISQKVVFKQGSRQRPRDLQQITDGEIVVVEGSSHHEFLKSL
FT                   GDSIPTLKWRATRDHDAVELLQMVISGEVDYTITDSTALDIQRRFHPDLSVAFTVKHDQ
FT                   DIAWALPQGKDDSLFAAVIEYFGEIRSSGRLAHIKEQHFGHVKQFNYVTTSLFIEAVEQ
FT                   VLPGYIETFKEHSGSLDWRLLAAISYQESLWNPRAVSPTGVRGMMMLTLPTAKAMGVKS
FT                   RLNAEQSIRGGARYLERMLNRVPARIPQPDRTWFAIAAYNIGFGHLEDARIITERQGGN
FT                   PDRWVDVKKRLPLLRQKQFYRHTRYGFARGDEPVTYVGNIRRFYDTLKYLDEQGRL"
FT   CDS_pept        complement(628889..629920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81429"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81429"
FT                   /db_xref="GOA:Q5QXA4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QXA4"
FT                   /protein_id="AAV81429.1"
FT                   /translation="MAIVNRIALDLAKDFIQVLALDENEQEVFNKKLRSNKVLAKLATL
FT                   SRTDDCEVAVESCGMSHYWRRECEKLGYKTVALPPRFVKAYLQGEKNDANDARAIAEAA
FT                   SRPNRQTVRLKSIEQQDLALMVNQREGFVQTRTQFSNRLRGQLAEYGILLPKRVGTILQ
FT                   RVPEVLEDDSNALTLQSRDLINRLYQMLRAVDEEVKALDKHLATQAERNEDSQRLMTLP
FT                   GIGPITATSLLALIGDVSEFKRGRNLSEYLGLVPRQNSSGGKDRLGGITKKGNTKLRTL
FT                   LVHGARSALRVAQQRHDRLSLWAQDVAKRRGNNVAAVALANKHARIIWAMLKNKEDYRM
FT                   TAA"
FT   gene            630041..632617
FT                   /locus_tag="IL0589"
FT   CDS_pept        630041..632617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0589"
FT                   /product="Predicted extracellular metal-dependent
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81430"
FT                   /db_xref="GOA:Q5QWY2"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY2"
FT                   /protein_id="AAV81430.1"
FT                   /translation="MKKTVAAVLMALAPVFALAQSLGDKIELSVNNQVIEATLAEPLSS
FT                   GNSYRLTFEDRYGDTQHLGFLHKRGDNQLISITHPDVGEVEIRRVNGKTYINQRNRTPS
FT                   EPLKPKSRTEPQQLEKQLQLAPAPRKAALTKANNAQITSLVTQFDNNVDVLFLYDERLL
FT                   GYADDKGYDLALRIEAAVSTSNSIFERSQLPVEMSVAGVSFFNPASTTSFPTEDPNAII
FT                   DELVDDQRVRRLMDRYQADVVHFIGAENPTVCGLAFVATDFNVSDNLVNRVSGAAGAGY
FT                   TALSCTGTGTVAHEVGHNFGLNHDRYTLADNASGGGGDQKDYHIPYGFIEDSGLFYTTM
FT                   SYGSVCRSEFGSGAVCRDEAVYSSPDIVDSDSGLPMGKAESQIDAADASTAAQRSTVVW
FT                   ANNASRTNVNAMAASRSGNSELTLSWPAVANADRYALAGGRCEQYESVSREALLDLQSF
FT                   SVNSVALGGIPNGSTDICIIAIEELTNGAVRWRFVSNSSFSGNFSNTNANYLLLNSNVM
FT                   GLVEAGDQASFTIELSDADTSNQSLQMAVPTTASGTSVSQDVGIATAGQWFDWVVSGSG
FT                   NTRMMTVTLKTDIEEIAASLDKDTIFNPFHLRLKVVNTAFNDFNISSGLWNDPSSMVGS
FT                   RPQAFLSSGDTVGELEVLDTQLSLFNVSNDVAVSVVNLDDDLVRDFSFNEVSGAVDGER
FT                   RFVIEGIAGIVDSEQTAILRIDFSDGSDSLRVALTVEPRAIAPTIVGFTATGTTVGQTV
FT                   RLAATVTDADLNLDPDSLRLFRVMESSEEEVTGFSFNDGAFSASLGQLAAGTYQYRLNV
FT                   NDTEGNTQSATARFTVAAADSGSSGGHAGWLVVLGLVAMGLRKRVA"
FT   gene            complement(632681..633178)
FT                   /gene="rfaH"
FT                   /locus_tag="IL0590"
FT   CDS_pept        complement(632681..633178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="IL0590"
FT                   /product="Transcription antiterminator RfaH"
FT                   /db_xref="EnsemblGenomes-Gn:IL0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81431"
FT                   /db_xref="GOA:Q5QWY1"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY1"
FT                   /protein_id="AAV81431.1"
FT                   /translation="MNELESDVWYIVRTKPKQEERAILNLENQGFGVFAPELTVKKVRR
FT                   GVRTSVVERMFPGYVFVKPDDIIEQFYKLRSTYGVAGVLRFGDNIPKVPQRWIDQMRGV
FT                   DQLTDEQAPQIGDTVEIQQGPFRGFLAKIVKLDGESRCFVMLEWMQKEVKANFSYKELQ
FT                   FQ"
FT   gene            633565..637452
FT                   /gene="purL"
FT                   /locus_tag="IL0591"
FT   CDS_pept        633565..637452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="IL0591"
FT                   /product="Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81432"
FT                   /db_xref="GOA:Q5QWY0"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWY0"
FT                   /protein_id="AAV81432.1"
FT                   /translation="MEIYRGAPALSAFKTTKQLEQLKQAGIPVKELYAEYQHFVDLHNE
FT                   LSDEHRSVLVQLLKYGPEMPAHEPQGALVLVTPRIGTISPWASKATDIAHNCGLKSIHR
FT                   VERGVAFYLQGDLSAEELKQAALLLHDRMTESVLYDMNDAQQLFRSQEPQPLSSVDILA
FT                   GGREALAQANISLGLALADDEIDYLVENFRKLDRNPNDIELYMFAQANSEHCRHKIFNA
FT                   DWTIDGAEQPKSLFKMIKNTFETTPDYVLSAYKDNAAVMEGHEAGRFYPQPDSMSYGYS
FT                   HEPVHILMKVETHNHPTAISPYPGAATGSGGEIRDEGATGVGSKPKAGLVGFSVSNLNI
FT                   PGFKQPWEENYGKPARIVSALDIMLEGPLGGAAFNNEFGRPALTGYFRTYEQTVDSHNG
FT                   RETRGYHKPIMIAGGLGNIREAHVQKGDIPVGAKLVVLGGPAMNIGLGGGAASSMASGE
FT                   STEDLDFASVQRENPEMERRCQEVIDRCWQLGADNPIAFIHDVGAGGLSNAMPELVSDG
FT                   GRGGRFELREIPNDEPGMTPLEIWCNESQERYVIAIAPENLARFEALCERERAEYAVIG
FT                   EATEELTILLNDAKFSNQPIDLSLDVLLGKPPKMHRDVARLQTEGTPLHLEAADLNDAA
FT                   DRLLRLPAIAEKTFLITIGDRSVTGLVARDQMVGPWQIPVADVAVTASSYDSYHGEAMA
FT                   MGERTPLALLNFGASARMAVAESLTNIAAADIGDLKRIKLSANWMCAAGHPGEDAGLYE
FT                   AVKAVGEELCPELGITIPVGKDSMSMKTQWQQDGEDKAVTAPMSLVITAFGRVNDIRST
FT                   LTPQLRTDKGQSHLVLIDLGKGQNRLGGSALAQVYQQLGQHTPDLDDTETFKAFFNTTQ
FT                   QLVTEGRLLAYHDRSDGGLFTTVAEMAFAGNCGAKVALDELGEDNLATLFNEELGAVIQ
FT                   VSDEQYQKVMDAYKTAGLGDCVKRIGEPTHEDAIVFTRDEQNVLAQSRTHWRTVWAETT
FT                   HHMQRLRDNPVCADEEFRLKQRADNPGLLADLTFDPSEDIAAPYIAKGVAPKVAILREQ
FT                   GVNSHYEMAAAFDRAGFEAVDVHMSDILAGRVSLEDMQALAACGGFSYGDVLGAGEGWA
FT                   KSILFNDRAREQFEAFFKRNDTLALGVCNGCQMLSTLKQLIPGTEHWPRFVTNRSERFE
FT                   ARFSLVEVQESKSIFLGDMAGSRMPIAVSHGEGRAEFANPQQQSQLEQNSQVALRYIDN
FT                   WGEVAEQYPANPNGSPKGITAVTSDDGRVTAMMPHPERVFRTVANSWHPDEWGEDSPWM
FT                   RMFRNARKHLG"
FT   gene            complement(637685..637966)
FT                   /locus_tag="IL0592"
FT   CDS_pept        complement(637685..637966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0592"
FT                   /product="Transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81433"
FT                   /db_xref="GOA:Q5QWX9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX9"
FT                   /protein_id="AAV81433.1"
FT                   /translation="MATTFRRFDAASYLNDAESVAAFVADALETEDAGYIANAIGIAAR
FT                   TKGMTELAQKTGLSREQLYRSFSEKGNPTLKSVLAVTKALGIKITAST"
FT   gene            complement(637941..638315)
FT                   /locus_tag="IL0593"
FT   CDS_pept        complement(637941..638315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0593"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81434"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX8"
FT                   /protein_id="AAV81434.1"
FT                   /translation="MLIYPSYLLKCILKTTMSLSIYESNKFHQWLSGIKDQTIKGRIIS
FT                   HINRLIEGSSCDVKPIGHGLSELRMHFGSGYRVYFYEDQGVLILLLAGGDKKSQSRDIK
FT                   RAHLLYEYWSNNNGNDFQKV"
FT   gene            complement(638472..639134)
FT                   /locus_tag="IL0594"
FT   CDS_pept        complement(638472..639134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0594"
FT                   /product="Possible cAMP phosphodiesterase,
FT                   metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:IL0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81435"
FT                   /db_xref="GOA:Q5QWX7"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWX7"
FT                   /protein_id="AAV81435.1"
FT                   /translation="MIDAGTGLNQLSLAQMHQVRHVFLTHSHMDHIAALPTFLSNQYGS
FT                   EHLPVTVYAQAHTLEKLQNNIFNGDIWPELSSMTEGPEPILKFRKIHPGECIELEGLEI
FT                   KAFAVEHSVPTVGYSVKNQGKHFVFAADTIAGKQLTEQLNRLGHIDTLMLECAFPDELL
FT                   HVAEKTKHMTPALLQSALNSLEQQPAELWVTHLKPSNEKALRATLAANPPHKNTVVL"
FT   gene            639289..639921
FT                   /locus_tag="IL0595"
FT   CDS_pept        639289..639921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0595"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81436"
FT                   /db_xref="GOA:Q5QWZ1"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ1"
FT                   /protein_id="AAV81436.1"
FT                   /translation="MENTPTKSSPVMPQLIILTLFWVGLQLVATWVKDDFSHVSQYISE
FT                   INATGSTAAGAFGWVGFIPLAMVSFGVLLTARPHLRVKGISHIGWSLLFFYPVAYLGAA
FT                   LAPCDLGCPTDGSSSQALHNVISMVSYFGFALGALLLTFTPKTTWPVRCAFVLLSVIIA
FT                   LGFVLMINPELAEVRGAIQRYIGVAQLVVFWLLLWLKPAEADGGSNE"
FT   gene            639914..642163
FT                   /locus_tag="IL0596"
FT   CDS_pept        639914..642163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0596"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81437"
FT                   /db_xref="GOA:Q5QWZ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ0"
FT                   /protein_id="AAV81437.1"
FT                   /translation="MSKSVRLSVEGMSCGSCASRVDKALNGLDGVEDASVNLASDSAEV
FT                   TYSEKLSVDDLVQAVKNAGYEAHEVVDRDKQMREQREQQAKEMRTLKGQLWLSTLLTLP
FT                   VFILAMGNHMVPVFSEWVHNSLGLQTSWWIQLVLTTLVLAVPGARFYKLGVPALFRGAP
FT                   DMNSLVALGATAAWGYSVVATVFPTWLPSESVNVYFEASAVIVTLILAGRFMEARAKSH
FT                   TSDAIQRLMSLQSKTARVVRDGDVTEVDIAELGKGDEIEVRPGERIALDGEVSSGDSYV
FT                   NEAMITGEAESVHKQKEDKVVGGTLNEKGTLRFKVTATGEGTVLAQIIRMVEQAQGSKL
FT                   PIQDTVNRITLWFVPAVMLVALLTFVVWYFAASESALTFALVNAVAVLIIACPCAMGLA
FT                   TPTSIMVGTGRGAEMGVLFRQGSALQALQQSKGVIFDKTGTLTEGKPTITEWMTLSEFD
FT                   EKEVLTLAASIEAKSEHPTAEALVNYAKEQDIKVSEPESFEAISGLGATGKVDSKTLYI
FT                   GTSELMRDNDIGLDAEPADAKTWSEGGRTPIYVAIDGKLAAVFTQDDPIKASAKELIKR
FT                   LHADGLKTAMVTGDAESTAKRIAKELGIDEVVANVKPDGKVDAVKRLKKQWGQVIFVGD
FT                   GINDAPALASADVGFAIGTGTDVAIESADVVLMSDNLTVVQQAFALSEATMRNIRQNLF
FT                   WAFAYNTALIPVAAGVLYPFFGILLSPMLAAGAMALSSVFVITNALRLKTVNLEK"
FT   gene            642184..642930
FT                   /gene="murI"
FT                   /locus_tag="IL0597"
FT   CDS_pept        642184..642930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="IL0597"
FT                   /product="Glutamate racemase"
FT                   /note="required for biosynthesis of D-glutamate and
FT                   peptidoglycan"
FT                   /db_xref="EnsemblGenomes-Gn:IL0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81438"
FT                   /db_xref="GOA:Q5QWY9"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY9"
FT                   /protein_id="AAV81438.1"
FT                   /translation="MKVGVFDSGVGGLTVARSLQQSGCFSELLYYGDTARVPYGSKDSN
FT                   TVTRYALEAVEFFNGADVDCLVVACNTVSVTALEQMQKFSNKPVYGVLEPGVMALEQLQ
FT                   GIDTSAQVLVIATRSTINSGAYQQQIQALGYNQVNAMATPLFVPIVEEELYDGPILQET
FT                   FKHYFGKLEKPDVVLLGCTHFPLIAESISAYFNGAKTIHSGEAMLAWLKQHLDLSAQFD
FT                   RTPLHIIATENVDAVKRTATRWGLKL"
FT   gene            643268..644956
FT                   /gene="sfcA"
FT                   /locus_tag="IL0598"
FT   CDS_pept        643268..644956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfcA"
FT                   /locus_tag="IL0598"
FT                   /product="Malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:IL0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81439"
FT                   /db_xref="GOA:Q5QWY8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR023667"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWY8"
FT                   /protein_id="AAV81439.1"
FT                   /translation="MPQTQRPLYIPYSGPNLLETPLLNKGSAFSKEERAAFNLTGLLPP
FT                   RYESIEEQAERAYMQYRSFETPINKHIYLRAIQDNNETLFYRLLTDHLEEMMPIIYTPT
FT                   VGDACEKFSDIYRSSRGLFISYSERDQIDDILRNATKQKVKVIVVTDGERILGLGDQGI
FT                   GGMGIPIGKLSLYTACGGISPAYTLPVMLDVGTNNEKLLEDPMYMGARHKRIEQDEYDE
FT                   FLDKFIKAVTRRWPGVMLQFEDFAQPNAMPLLRRYRDEVCCFNDDIQGTASVTVGTLLA
FT                   ACRQKGKKLSEQKVVFVGAGSAGCGIAEQIMIQMTAEGLTEEQAKRQIFMVDRFGLVMD
FT                   TMDGLRDFQQALAQKTSDLNAWEYSGEYPSLLDVMHCAEPDILIGVSGQAGLFTEQVIS
FT                   TMAKNVERPIIFPLSNPSKHVEAHPADVLKWSEGKAIVATGSPFGEVEYDGRIYPIAQC
FT                   NNSYIFPGIGLGVLSVKSERVSDEMLRVASKTLANASPSANGKGEALLPAFNDLTQLSK
FT                   DIAFAVGKVAQQEGLALEIDDDTLRERIDNNFWKPEYRFYKRVSI"
FT   gene            complement(644953..646104)
FT                   /locus_tag="IL0599"
FT   CDS_pept        complement(644953..646104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0599"
FT                   /product="Cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81440"
FT                   /db_xref="GOA:Q5QWY7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY7"
FT                   /protein_id="AAV81440.1"
FT                   /translation="MTKRPFSPQSLLAQGGSHSDNENGVIIPPVYTSTTYLRDDDNQYR
FT                   SGRVYSRADNPTYRPAEKLLAELENAADARLFASGMAAATAVFQALKPGDKVIAPKVMY
FT                   WALRKWLQTFGVDSGLDVRFVDTTNLNELRDAIAERQPTLIWLETPGNPLWTVTDIAAV
FT                   ADMARNCGSLLAIDSTVATPLLTKPLDLGADIVMHSATKYLNGHSDVISGALAAREDNA
FT                   FWQRLVAIRAQSGAVPGPQDAAQLLRGMRTLFLRVRESCQSALYIAEQLEQHPQVIEVL
FT                   YPGLKSFVGHEIAVKQMQGGFGGMLSIRLAGGEKAAIAVAAKTQLWHRATSLGGVESLI
FT                   EHRASIEGPDTPVPLDLLRLSVGIENADDLLNDLQQAIDLAHS"
FT   gene            646190..646639
FT                   /gene="azu"
FT                   /locus_tag="IL0600"
FT   CDS_pept        646190..646639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azu"
FT                   /locus_tag="IL0600"
FT                   /product="Azurin"
FT                   /db_xref="EnsemblGenomes-Gn:IL0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81441"
FT                   /db_xref="GOA:Q5QWY6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014068"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY6"
FT                   /protein_id="AAV81441.1"
FT                   /translation="MRYIISALLGSMLFVANAAQANECELSIDGNDNMRFDTKEMSVPA
FT                   SCDEVTVTLHHTGKLDKKVMGHNWVLSEAGDMQSVVQQGMSAGMDNNYVPDSDAVIAAT
FT                   DVIGGGEETSVTFSTEGMSADTDYKFFCTFPGHSAIMQGSFAIKE"
FT   gene            646727..647770
FT                   /locus_tag="IL0601"
FT   CDS_pept        646727..647770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0601"
FT                   /product="RND family efflux system membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81442"
FT                   /db_xref="GOA:Q5QWY5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWY5"
FT                   /protein_id="AAV81442.1"
FT                   /translation="MKFLLITLVFLFSLQSETSRAQQFGSREALVLAQQVTFERERNRV
FT                   EAVGTAEAVRSITIYPAVGDRVVAVNFNPGDKVEKDELLVELDARRQQVAVEQAQINLR
FT                   DAERTVERLRTSREQGAVPQSELDNAILLRDLARVELDNAKIELEDRFIRAPFTGIIGI
FT                   TDVEVGDRIDQQTAIATLDDRSTLLIDFRIPEAAVSLLQDGAELKVQPWRYSGKPVIAE
FT                   IIELDSRINATSRMYRARAKINNDSDDFLPGTSFRTAIELAGEEFASIPEAALSWGVNN
FT                   PFVWVVEDGKAHRIDVQIEQRLAGRVLVSGDIQRDDLLIVEGVQSLREGQPVTFDRATL
FT                   DTQEAVE"
FT   gene            647770..650877
FT                   /locus_tag="IL0602"
FT   CDS_pept        647770..650877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0602"
FT                   /product="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:IL0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81443"
FT                   /db_xref="GOA:Q5QWZ8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ8"
FT                   /protein_id="AAV81443.1"
FT                   /translation="MSDQQLNNHPDSNDLPSVSIRRPVLIVVLNVLIAIAGLAALMGVE
FT                   VRELPDVDRPVVGVSATLPGGAPETVDAEVTSILEGAAARVSGVESIQSSSEENSARIS
FT                   IEFRPGVDLDVVAAEVREAVNQVRRELPDDVEQINVQKADSDARSVLDIAVSSDSLTQE
FT                   ELTRRLETDLSPEFLAINGVADVRLNGDRERVLRVDLDPLKLVSFGLSVTDVADALRLA
FT                   PFDVPAGSLRSTDQRLIVRADATAITEDQVENIIVSGDTRIGDVAQAYFAPADANSFVR
FT                   LDGKPVVGLGVIRQAGSNTIEISDQALAVLERLRERFPDMEMRITNDDAQFIRKSVAEV
FT                   VTTLAITIVLVVATLWVFIGSFRATIIPAFSIPVALFGAIAAIWLMGFSINILTLLALV
FT                   LATGLIVDDAIVVTENIQRRRSMGLGSRAAAVLATREVFFAVVATTAVLVAVFVPIAFL
FT                   PSTAGRLFREFGGVLAAAVVISSFVALSLVPAFTARLPKSAGQNNRFAGIGNAFKRFYK
FT                   RTLHKALDFSWVVVVLSLLSAGGGALLYNEIDSELMPNEDRGAVRVFSRGPDGVGLKFM
FT                   DRQARKLEEVLLEYKESGDIESIYTVVGQWDPNLVFITANLKPWEERDISQQEIINNIR
FT                   EPLSQVPGAPGQAFGDNSLNLRGQGGGLEMAITGENYDEIFKVAREFTAIIKERMPDLG
FT                   NINVSYQPTQPQLRVKIDRRRAAELGVSLNDISATLRAAINGDDVADLNVGDQQIPVML
FT                   RTRNNLIQSPQDMQNLYVSSSSGDLVPISSVSEIIEEGVSAELERQAQRRAIEVDVQLP
FT                   DDMPMSDVVDQLRTIAGEVLPDSMGLVFLGEAATFEDTSQEIAMTYILAFLIVLLVLAA
FT                   QFESLNSAVVVMLTVPFGIAAAIYALFLTGTSLNIYSQIGLVMLIGLLAKNSVLLVEFA
FT                   DQLRDRGLEVREAIEEASLIRLRPIMMTLVSTVLGGLPLILSSGAGAEARNSIGWVVFG
FT                   GLGLATLFTLYLTPVLYLWLARFTKPRADEAARLESEMEAARESGH"
FT   gene            complement(650911..651366)
FT                   /locus_tag="IL0603"
FT   CDS_pept        complement(650911..651366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0603"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81444"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ7"
FT                   /protein_id="AAV81444.1"
FT                   /translation="MLKALQNFFQNNTAAEQASLNKAEGMTDDAFLSLVLMTEISLADG
FT                   TLSDEERQHLLHELEHEYDITDEQAENAIRKAVKTVKEAASLYEFTAQLKALAYEKRVE
FT                   LLESLWVVAYADGELDPYEESMLRKLADLLYISHADYIRTKLKVMDS"
FT   gene            complement(651375..652742)
FT                   /locus_tag="IL0604"
FT   CDS_pept        complement(651375..652742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0604"
FT                   /product="Signal transduction histidine kinase (contains
FT                   GAF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81445"
FT                   /db_xref="GOA:Q5QWZ6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ6"
FT                   /protein_id="AAV81445.1"
FT                   /translation="MNDALENILLDVSKSPDIDGGDLEKASELILASALKGLDITRVSI
FT                   WLLQSDKQAMRAAKLIDEKSPNAEVPVLYKNQLPSYFQALESERTIIANDARCHPATIE
FT                   LTNGYLEETGVYGLLDVPLRHKGEMIGVMCSESRRENRIWTPAEVAFVGMLADIYGRAV
FT                   SAAERERFEALLIQQNEQLESMVEERTQSLTKALDNFKQAQERLIETEKMAALGKLVAG
FT                   VAHEVNTPLGVSVTAVTHCEHRLKKLNQSFTDGSISRKHLQTFIDNTFEAYQLLSSNLE
FT                   RAATLIQNFKKTAVDQSSFELVKCQLNDYLHALVLSLNPMVKKKKVTITIHCNEDIVLK
FT                   TYQGALAQIVTNLVSNTNDHAFAEPDENHQIEIIATEEDSGVRFSFRDNGKGMDSETIK
FT                   DIFEPFFTTSRQTGGSGLGLSIVYNLVTRKLKGQISVQSTPGEGTEFSFFLPNLPK"
FT   gene            652892..656068
FT                   /locus_tag="IL0605"
FT   CDS_pept        652892..656068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0605"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /note="contains N-terminal TolB-like domain (diverged WD40
FT                   repeats) fused to C-terminal amidohydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81446"
FT                   /db_xref="GOA:Q5QWZ5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ5"
FT                   /protein_id="AAV81446.1"
FT                   /translation="MKRTTLTLAVASLLSFAPVSMAQEQTQGWDVSDPQGEFKTIDISV
FT                   NSGTWMNVDVSPDGEYIVFDLLGDIYRMPFGGGEAEKLIGGIAWHMQPVYSPNGRYIAF
FT                   TSDQGGGDNIWVMDADGNNVRAVTEETFRLLNSPAWSPDSEFLVARKHFTASRSLGAGE
FT                   VWMYHRSGGSGVQLTERPNDQKDLGEPAFSPDGKYIYFSQDDTPGKTFHYSKDSLEGIY
FT                   DIKRFERETGEIETLISGAGGAIRPTPSPDGRYLAYIKREDFDSVLYVLDLKTGEHKRV
FT                   YGKMERDMQETWAIHGVYPTMDWTPDSKQLVFWAGGHIQKLNIDDGSARIIPFKVETEK
FT                   KVQHALGFKQNVEADQFDVKMLRMAQVSPQGDAVIYEALGSLYQRSLPDGEPQRLTNSE
FT                   DFELYPQYSRDGEKVVFVRWNDEAQAKVIVRDISSGDEQVLNTGQGNFVEPTFSPNGKH
FT                   VVYRKVRGGYLISDKFGLENGIYRVAVSANAEPEQIAESGHLPQYGARNDRVYLMTPGD
FT                   KPTLSAIDLRTLEQRDLYQSELATEFRVSPDGKQLAFAERFKVFVTPLVERGSVINVGP
FT                   GDKQMPVHQLSVRAGENLSWTANSDQLYWTLGPELYHTSVAEAFNADTESDTLKVENGQ
FT                   NIGFEHDAMIPDTTVAFVGGQVITMNGDTVYKQGTVVVRNNKIVAVGPEAEVNVPSGAE
FT                   VIDTSGKTVMPGLFDAHAHGSQGQAEIIPQQNWGQYANLAFGVTSIHDPSNDTTEFFAA
FT                   SELQKAGRIAAPRLFSTGTILYGANGPGYTSHVDSLEDAKFHLERLKKVGAFSVKSYNQ
FT                   PRRNQRQQVVEAGRELEMMVVPEGGSLLQHNLTMIMDGHTTVEHSLPVANIYDDIRQLW
FT                   QQSDVAYTPTLGVAYGGIWGENYWYAETDVWKHPKLTQYVPMEFLVGKAMRREKAPHNH
FT                   YNHFNNAEVATELQDLGVEVLAGAHGQREGLAQHWEIWMMAQGGMEPLEALRTATIDPA
FT                   RVFGMDHALGSLQEGKLADIIVIDGNPLENIRDTDKVTHTMVNGVLYDATTMDRLLPEP
FT                   LKRKDFFWEE"
FT   gene            complement(656085..657020)
FT                   /locus_tag="IL0606"
FT   CDS_pept        complement(656085..657020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0606"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81447"
FT                   /db_xref="GOA:Q5QWZ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ4"
FT                   /protein_id="AAV81447.1"
FT                   /translation="MNTIKDIDLNLLVYLDVLLREKNVTRAAAQLNITQPAMSNGLKRL
FT                   RNLLNDPILVRTSEGMVPTQRALDMQEALRGVLYSVEEMIQPVREFDAPTSDQVFRIMA
FT                   SDYAASTLMPKLLEKLDEQAPHVSLDIMTPSDISFHDVENGKVDLAINRFEQLPQSFHQ
FT                   KNLWSDEFSCLIRKDHPLLQDYTLDNYLKAQHVWVSKTGFGVGVGMDPHDVQKLGWVDD
FT                   ALDKLGKRRKIKVFTRNYHVAMYLARQGLVATLPTRAAELYSQDSQLVMKAPPFEIPGL
FT                   TLTMIWSPLLQHDAGHRWFRQVVAETAAAS"
FT   gene            657167..658861
FT                   /gene="aceK"
FT                   /locus_tag="IL0607"
FT   CDS_pept        657167..658861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceK"
FT                   /locus_tag="IL0607"
FT                   /product="Isocitrate dehydrogenase kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81448"
FT                   /db_xref="GOA:Q5QWZ3"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWZ3"
FT                   /protein_id="AAV81448.1"
FT                   /translation="MTISPETLAKSILDGFHSHYRRFQVLTQGARERFLKRDWTAVVSA
FT                   ASERIHYYDHQVGTTAKKVERRVGTELDEGLWLATRQRYQQLLKFHPQAELAETFYNSV
FT                   FCRVFDRAYFNNDYIFVETVLANHIPVPVENECHSYFPVVDGLEGTLTRVFEDIGLGGE
FT                   FENFENDIEQLRDKFFERATETDIEAHNLRIDVLKSPFYRNKAAYIVGRVVTENNHYPF
FT                   IVPVLINSQGKLYVDAFITRSDRMATIFGFARSYFMVETEAPSALVRFLKDLMPHKTLA
FT                   ELYSSVGFHKQGKTEFYREFLHHLRRTDDQLSAAPGVKGMVMTVFTLPSFPYVFKVIKD
FT                   RLGGTKEFGRQTVIDRYRMVKRHDRVGRMADTLEFVDVALPLKRISADLLDEFKQTIAN
FT                   SISIEGDTLVIHQLFVERRMTPLNLYLEYANDEEVDAAMDDYGRALKEMMAANIFPGDM
FT                   LLKNFGVTRHKRVVFYDYDEVRYLTDMSFRRLPENDWEVSYAPDDVFPQQLAQFAVPQA
FT                   KYRNKLLKRHPELIDSAYWCRVQKNIRKGELTDVFPYDADLRFTRRF"
FT   gene            complement(658845..660182)
FT                   /gene="aceA"
FT                   /locus_tag="IL0608"
FT   CDS_pept        complement(658845..660182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceA"
FT                   /locus_tag="IL0608"
FT                   /product="Isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81449"
FT                   /db_xref="GOA:Q5QWZ2"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QWZ2"
FT                   /protein_id="AAV81449.1"
FT                   /translation="MTTQNLSFAQQVKELQKQWDTDPRWKGVERPYSAEDVVRLRGSVQ
FT                   PEYTYARNGADKLWQLIHGKAQEKFGKDYVNALGALTGGQAVQQVKAGLQAIYLSGWQV
FT                   AADNNSACSMYPDQSLYPVDSVPTVVERINNSFARADQIQWSKGVTPEDDNYVDYFAPI
FT                   VADAEAGFGGVLNAYELMKRMIQSGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKL
FT                   SAARLAADVAGTPTLIVARTDANAADLLTSDFDPNDKPFITGERTAEGFYRVKPGIEQA
FT                   ISRGLAYAPFADLIWCETAKPDLDEARQFAEAVHAKYPGKLLAYNCSPSFNWKRNLDDD
FT                   TIAKFQRELAAMGYKFQFITLAGVHNMWYHMFELAHDYARNDMSAYVKLQQQEFEAADK
FT                   GYTFVAHQQEVGTGYFDELTNVIQGGLSSVTALKGSTEEDQFKTSA"
FT   gene            complement(660213..661796)
FT                   /gene="aceB"
FT                   /locus_tag="IL0609"
FT   CDS_pept        complement(660213..661796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="IL0609"
FT                   /product="Malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81450"
FT                   /db_xref="GOA:Q5QX05"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX05"
FT                   /protein_id="AAV81450.1"
FT                   /translation="MNNLFNFSQPLDDDAKALFNDENQSFLAELVDTFQPRLESLLKKR
FT                   QQRQAQFDQGQLPDFDSATQNIREGNWRIAELPADLKKRRLEITGPVDRKMVINALNAN
FT                   VDCYMADFEDSQSPTWEGMVNGQINLRDANIGGMTYTDPDSGKHYEVGPDPALLIARVR
FT                   GLHLPEKHVQRNGQAIPGALMDFALYFLLNYQQRLQQGSGVYYYLPKLEHSDEAKWWAD
FT                   VFHFTEKKFSLKTSTIRATILIETLPAVFQMHEILHAMKDHIAALNCGRWDYIFSYIKT
FT                   LKEHPERVLPDRQVVSMDKPFLNAYSRLLVKTCHQRGALAMGGMAAFIPSKDPAKNEKI
FT                   LAKVHADKTMERDNGHDGTWIAHPGLADTVRAIFVDGIEGDNQLHVLRENDTSIDQTLL
FT                   LQPCEGERTEAGMRTNIRVSLQYISSWLNGKGCVPIYGLMEDAATAEISRTSIWQWIRH
FT                   GKTLSDNTPVTKELFRQYLQEEAEVVKNEVGKQRWNDEPFEQALKLLEEITTADELVDF
FT                   LTLPGYQQLK"
FT   gene            complement(662042..663667)
FT                   /gene="trg"
FT                   /locus_tag="IL0610"
FT   CDS_pept        complement(662042..663667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trg"
FT                   /locus_tag="IL0610"
FT                   /product="Methyl-accepting chemotaxis protein (contains
FT                   HAMP domain)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81451"
FT                   /db_xref="GOA:Q5QX04"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX04"
FT                   /protein_id="AAV81451.1"
FT                   /translation="MLRQISIGIRASIAFGLIGLLTLILGIFALNRIEIIDNGITTVSE
FT                   KQLPVLEEMSELNQEFLLVRIHSANVSSYVNDPQRLATYKQKLSDAITQLKESQRQYKS
FT                   MVQDPQAQKLLSEYEELDKEYWKLNEQFNKLVDAGLVDAIASIRENSILPLTDKITQQL
FT                   DKMYGAERSLINQAADNAHNVAENSILAVIVVLVVVIALLVLFAVVLTRSIVKPIGAAV
FT                   DFAESIAKRDLTQRIEIVGKDEPAQLLRQLERTQTELRNSITTISESSEQLASTSEELS
FT                   SVTEESTRTIQQQSEELEQAATAVNELTTAVETVAQDAQNASEASDEANQQAQQGNDRV
FT                   RKTVRAIEELSQEIGDSSGNVTELAEKVKSITKVLEVISGIAEQTNLLALNAAIEAARA
FT                   GESGRGFAVVADEVRSLAHKTQQSTVEIEDMVKAINESSDRSVATMDKSLERATKTLDV
FT                   AREAGEALQLITAAVSEINNHNTSIASAAEEQANVSRDVDKNLVSIRDLSNSTASGAEQ
FT                   TNASSRELSRLAVDLNELVKRFRI"
FT   gene            complement(663757..664917)
FT                   /gene="argE"
FT                   /locus_tag="IL0611"
FT   CDS_pept        complement(663757..664917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="IL0611"
FT                   /product="Acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81452"
FT                   /db_xref="GOA:Q5QX03"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX03"
FT                   /protein_id="AAV81452.1"
FT                   /translation="MSTPALPSFFSMYQQLIAQPSISSIDSKWDHSNQKVVNLLAEWLE
FT                   ILGFECEINELQSQPGKFNLLARRGGGSGGLLLSGHTDTVPYDASRWNFDPFKLTEQDN
FT                   RWYGLGSIDMKGFFAFVIQALSELDAAQQTKPVMILATADEETTMDGAREVSRFVNLKP
FT                   DYCVIGEPTDMRPVYAHKGHMSEVIRITGRSGHSSDPALGINAIELMHEVISALMKLKE
FT                   EFKHKYSDSSFSVPHPTMNFGHIHGGDNANRICGCCELHLDIRPLPGLSVDELYVHLHQ
FT                   ATENIQARYPGSIELISLHHPIPAFQQSTDSALVQLAEKISKTQAHAVNYCTEAPFLQE
FT                   LGCETLVMGPGSIRQAHQPDEYLLTESIKPTQEKLKSLLKSYCFSG"
FT   gene            665017..666042
FT                   /gene="argC"
FT                   /locus_tag="IL0612"
FT   CDS_pept        665017..666042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="IL0612"
FT                   /product="Acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81453"
FT                   /db_xref="GOA:Q5QX02"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QX02"
FT                   /protein_id="AAV81453.1"
FT                   /translation="MQYTAAQSQSVAIIGASGYVGVELTRLVQQHPALSLLGCYVSEHS
FT                   SDAGSLLSDLHPQYAHLVKLSLQGLSSQKKELIKSSADTVFLCTDHGVSVELAPEFLAA
FT                   GLKVIDLSGGFRLNATEDYPSFYGFEHQQDSWLQQAVYGLAEWYPQEIAAAQLVAVPGC
FT                   YPTAALMALLPVKQAGLLSCNKIIINAVSGVTGAGRKAALTSHGAELSLQAYGLFEHRH
FT                   TPEIAQQLQHEVLFTPHLAQFPRGILATVYAELNDDVSDADLDKAYQCYADQPLVRFEK
FT                   QARPAIKNVVQQPFVDIGWHRQGNQLIAFSAIDNLLKGAASQAIQCVNLQLGLALEEGL
FT                   L"
FT   gene            666039..666770
FT                   /gene="argB"
FT                   /locus_tag="IL0613"
FT   CDS_pept        666039..666770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="IL0613"
FT                   /product="Acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81454"
FT                   /db_xref="GOA:Q5QX01"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX01"
FT                   /protein_id="AAV81454.1"
FT                   /translation="MRVIKLGGSLLEQPDEMRALFASLSDTENNTVIVHGGGALAQQWL
FT                   STAGLKSEKHEGLRVSPEQHMPYIVGALAGCANKQLMSWAIAAGAWPIGLTLHEAGISC
FT                   RRQSAELGQVGTCELFESGLITNLLKCGYLPLISSIGFGKQGEWFNVNADDAAVAVAAN
FT                   LDADLLFLTDVDGVLDSEGRLIEQLDSRSIDELTKSGVIRYGMLVKVRSALNAAKRLRR
FT                   CVRIGSWNLISKTHSGTQISE"
FT   gene            666773..667723
FT                   /gene="argF"
FT                   /locus_tag="IL0614"
FT   CDS_pept        666773..667723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="IL0614"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81455"
FT                   /db_xref="GOA:Q5QX00"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX00"
FT                   /protein_id="AAV81455.1"
FT                   /translation="MMKHCLSGLELTPANTLQLLALAQEQKAHPEKYRQTLAGRSVVTL
FT                   FEKPSLRTRLSFDIGLQKLGGHAVYLNEQGKGMGVRESVADYARNLSCWADAIVARVMS
FT                   HHTLQELAQHASVPVVNSLCDRFHPCQALADFLTLQEHYGKVKGLKLVYLGDGNNVSHS
FT                   LMLTAAALGTDCTIICPRGYEPDAELVKKAKKQAEESGADIVVTHDIAAVAGADALYTD
FT                   TWVSMGDDKPLSEVRDTFQPYQINSQLVEHSGATSVLHCQPAHRGYEITSDVMDGPLSR
FT                   CFQQAENRLYAQNALLTLLLNPTAAALPEFMEKAS"
FT   gene            667720..668931
FT                   /gene="argG"
FT                   /locus_tag="IL0615"
FT   CDS_pept        667720..668931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="IL0615"
FT                   /product="Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81456"
FT                   /db_xref="GOA:Q5QWZ9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5QWZ9"
FT                   /protein_id="AAV81456.1"
FT                   /translation="MSNVKKVVLAYSGGLDTSAIVPWLKENYGCEVVAFVADVGQGAEE
FT                   LEGVEEKAKASGASECHVVDLKDEFVKNYVYPTLKTGAIYEGTYLLGTAMARPIIAKAQ
FT                   VEVARKVGADALSHGCTGKGNDQVRFESCYAALAPDLQVIAPWREWELSSRESLLGYLA
FT                   ERNIPCSASATKIYSRDANAWHISHEGGELEDPWCEPTEKVWTMTASPEQAPDKPEYLC
FT                   VTVENGEIVAVNNQALSPFECLSVLNDVAAKHGVGRVDIVENRLVGMKSRGCYETPGGT
FT                   VMMAALQAIDELVLDKVSRSWKTQLSEQFAQLLYDGRWFTPLQQSVMAAAQSLCATASG
FT                   EVVLKLYKGSVTAVQKRSPHSLYSEDFATFGADEVYNQAHAEGFIRLFSLPSRIAALQK
FT                   QQKG"
FT   gene            668935..670797
FT                   /gene="argH"
FT                   /locus_tag="IL0616"
FT   CDS_pept        668935..670797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="IL0616"
FT                   /product="Argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81457"
FT                   /db_xref="GOA:Q5QX11"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR011244"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX11"
FT                   /protein_id="AAV81457.1"
FT                   /translation="MALWGGRFAAGPDAAFQQFNDSLPFDYVLAEQDITGSKAWANALQ
FT                   KVGVLSAEECEQLQQALEELLGEVRSDPAAVAVGGDEDIHSFVEAALIAKVGDLAKKLH
FT                   TGRSRNDQVATDLRLWCRQQSEVLQQALQQTQQALLGLAEREQGTVIPGYTHLQRAQPV
FT                   LLAHWCLAYVEMLQRDSERLEDAVTRLNKSPLGCGALAGTAYPVDREAIASELGFSQAT
FT                   RNSLDSVSDRDFVVELLSTASLSMLHLSRLAEDLIFYNSGEAGFIELADNVTSGSSLMP
FT                   QKKNPDALELVRGKSGRVVGSLTGLMMTLKSLPLAYNKDMQEDKEGLFDAFTTWQASLA
FT                   MVTSSLHGLTVNHDVCRKAAQGGYANATELADYLVSKGVPFRQAHHNVGELVQQAIQAQ
FT                   KPLEDMPLEAFQAVVPVIEPDVYEWLTLDALLEKRCALGGTSPQRVNEALKSAQQQQKI
FT                   RIRDANLGDIGAILDLVQHWAGAGENLPRAKDDIVHSINEFAVTEVDGKVMGCASLYIY
FT                   TTGLAEIRSLGVHPHTEVRGQGRMLVSYLLKKARLLQLNRVIVLTRVPDFFEQQGFSHC
FT                   SKDSLPEKVMKDCELCPRLANCDELAMDFHLQPPDERLIFSTAL"
FT   gene            complement(670781..671632)
FT                   /locus_tag="IL0617"
FT   CDS_pept        complement(670781..671632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0617"
FT                   /product="Zn-dependent hydrolases, glyoxylase family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81458"
FT                   /db_xref="GOA:Q5QX10"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX10"
FT                   /protein_id="AAV81458.1"
FT                   /translation="MRKLLLSCVLTTLSVLALPAAAYQSEEVIVEHNEVADNIYMLTGA
FT                   GGNMLMSSGDDGVFLVDDQYTQVAEKIAAKIKELSGEEVRYILNTHFHGDHVGSNSWFA
FT                   NNQNSTIYAHDHVRERLSQDSDFNAAGLPAITFDSTLTFHLNNDTVRVFYLPAGHTDGD
FT                   SAVWFEDANVLHPGDLFFNERFPFIDLKSGGDVDGYIANVEELLNRINDDTVIIPGHGP
FT                   LANKQDYQGFLTMLKETKAEVDTMKQQGMTLDEAKTKGLSDKWDGWSWSFINEERWITT
FT                   LY"
FT   gene            671832..673403
FT                   /locus_tag="IL0618"
FT   CDS_pept        671832..673403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0618"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81459"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX09"
FT                   /protein_id="AAV81459.1"
FT                   /translation="MKFNTLFKISAVSTALFLAGCGGDINVTPTVNNGGGADGGNGGDG
FT                   GNAVACASYGDVEGTYDGQDCTYDENFASATIEIDEDITFEELPDGGVHVFEGALQVGV
FT                   DCDTTTSCEINQNGPVMTVEPGATLAFTSGEAIIQIARGAQLNAVGTFDKPITFTSANA
FT                   FDRLNVSGDAPRYADWGGIIINGNGITNQCTDAQRDGGTCNVESEGIVSYYGGNDNTDS
FT                   SGSMKYAKIWYAGSGPRDGGDGDDLNSLTLNAVGSGSSYEFIHIHQGYDDGIEFFGGKA
FT                   DVKNVVFTDTQDDSMDIDAGWQGRAQFLFIKHGTVTVDGNTNYMGNGGFEADGEKNNGP
FT                   DYSQAPTSAPTIANVTIITTDGKSVRDNDPSIATKFDDNFQGQMYNVLKVKENGTADDG
FT                   CIFFTSDGEAGVDNGELDFYSSVLACTNNFVNTGDNTFADGETYSAWYPNGGVNEILDG
FT                   SATVLNDDGISTDMTSSITISANDLTSLNDDFFTPVDFIGALSDDDTSSEWYQWVETAV
FT                   AAADAD"
FT   gene            673477..676182
FT                   /locus_tag="IL0619"
FT   CDS_pept        673477..676182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0619"
FT                   /product="Outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81460"
FT                   /db_xref="GOA:Q5QX08"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX08"
FT                   /protein_id="AAV81460.1"
FT                   /translation="MKNQYKLKPVALAVGLGLFASAPAALAQQADEADVERESTIEEVV
FT                   TTGSRLQGSAAAVVQERKNQAFVADILGAEQLSRSGDSDAASALRRVTGLTLVDGKFIY
FT                   VRGLGERYSSARINGASIPSPDLTRNVIPLDIIPSTIIESMAVQKVFSPSMPAAFGGGN
FT                   IDIRTRSLPDDFVFSVEAGVGMNSNADEGYTYNRDDSGIPAGIKDAIGRYQGDFSLRNI
FT                   VNTDGLTGSGNSAGNQARAINASLAKQLPRDMVLKKESLDPNMDFKATLGNSFDESFFG
FT                   GTIGVLAAASYDNDWDVSERKNAVISNNATADCSTSLATVEDISKSCYNTFEETTVTTE
FT                   TERLNGFFTAGYELDTHSVSYTKIYLEDSEDESEFGIKQSPNGSNLKTIVGTGIANREH
FT                   EFKYEERVLNVDQFRGQHTLMDYWGIGFDWQYTESKAETDIPTEVSYRFDDIYDTEGNF
FT                   SETRVTGDDNRAIFQFVDMEDNVKSYGGNLSLPLAFSGIELELKAGYDFVDKARYYSTS
FT                   RFSLDNASGSRLSVLDDLDDVLGVTGYLTDDVIDDNDFRISFREPGAPNADDYLAAQKI
FT                   DAYYGEFDAIFDNTWRVSGGVRYEDFKQVSLATSSLIFSEQDLNNYFNPERVLESTIAE
FT                   DDLYTALSLTYMASDNYQLRFGYGETVVRPDLRETVPVAYYDPITDIRTFGRAGLESSD
FT                   LRNYDARFEYYADNGDNYTIAAFYKDIENPIESVLQVGDEDYTLSYVNGESAEVYGVEL
FT                   EWLHDLGYLANGFFTSGNLTWSDSEASIDPALAGNLTNRTKRMTGHSEYVANFQLNYDS
FT                   ANGEHATSLVYNVFGERILAAGIGGREDAYEQPFHSLDLVYNYYPSFNSKIGLKVKNLL
FT                   GEDQEVTQSDILVRSKEVGTVVSLSYSYEF"
FT   CDS_pept        complement(676210..677223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81461"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81461"
FT                   /db_xref="GOA:Q5R062"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R062"
FT                   /protein_id="AAV81461.1"
FT                   /translation="MTAYVGIDVSKKKLDVGFYSDKLGKNGQRKKKTKVFKNDRQAFSQ
FT                   LESWLKQQTQHKAQNIAIGIEATGIYHEALIYTLHEQGFKLFIANPGRAKKYFESLGVT
FT                   HKTDKSDSLLLARFTEDKAHKGDITWWEPESPEARHLKLLLRRLNALQKDVLRERNRLE
FT                   ACANTDTSPRVVKSIEDMIAVLNEEIKALLKEIDDHIDGHPQLKKNRELLESIDGVGPT
FT                   VSRELTSLFSVKRFSSAKEAAAYLGLIPRLQESGSHKGMTRLSKIGPSAIRALLYLPAV
FT                   VASRCNPDIAYQKQRLLAQGKTKMQALGAAMRKLVQICFGVIKHQEEYRPQTSLSV"
FT   gene            complement(677654..678541)
FT                   /gene="aefA"
FT                   /locus_tag="IL0621"
FT   CDS_pept        complement(677654..678541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aefA"
FT                   /locus_tag="IL0621"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:IL0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81462"
FT                   /db_xref="GOA:Q5QX06"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX06"
FT                   /protein_id="AAV81462.1"
FT                   /translation="MQMSWTDISSGLNRIWNVELWKTGDAQIYLSQVIIAITLIIVGVI
FT                   VIRWIGSSLVKRALKSGHASQNTIYAFRKLFSFLAYVLIVLIALPVAGIPITIFAVLGG
FT                   ALAIGVGFGAQNLLNNLISGMILIAERPIRIGDIVELENERGRIEEIGNRCVRIKRFDG
FT                   VHVLVPNSYFLEQRVVNWTLISTEIRSTVTVGVAYGSPIDRVRELMMEAASQHEKIVQR
FT                   LPFEVFFDDFGDNSLTFNLLFWTEVEAPMDIRRVQSDIRFKLDKLFAENDIVIAFPQRD
FT                   VHLDTLKPLEIKMK"
FT   gene            678622..680235
FT                   /locus_tag="IL0622"
FT   CDS_pept        678622..680235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0622"
FT                   /product="ATPase component of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:IL0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81463"
FT                   /db_xref="GOA:Q5QX19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX19"
FT                   /protein_id="AAV81463.1"
FT                   /translation="MILDVDYVISAANITMQFGAKPLFENISVKFGNGNRYGLIGANGC
FT                   GKSTFMRILSGEQEPSAGNVSLEPNIRIGKLRQDQFAYEDYSVVDAVIMGHEELWAVKE
FT                   ERDRIYSSGEMSEEDGMRVADLETEFAEMDGYTAESRAGELLLGLGIPVEQHFGLMSAL
FT                   APGVKIRVLLAQVLFSEPDIMLLDEPTNNLDINTIRWLEGVLAEKQSTMIIISHDRHFL
FT                   NTVCTHMADIDYGELRVYPGNYDEYMFAATQAREQLMSDNAKKKEKIAELQSFVSRFSA
FT                   NASKAKQATSRQKQMEKIQLDEVKASSRVNPYIRFTQEKKLYRLALETENVRKSFEDEA
FT                   VLKGLSTSIEVGEKVAIIGANGIGKTTLLKCLMGEYTPDSGSIKWSENAAIGYYAQDHA
FT                   HWFKQDMTVYEWMYQWKKPGDDEQAIRGVLGRMLFSSDDIQKPVSILSGGEKGRMIFGK
FT                   LILQRPNILVMDEPTNHLDMESIESLNLALEQFEGTLLFVSHDREFVSTLATRIIEITD
FT                   KGLRDFAGSYDEYLAQLAAA"
FT   gene            complement(680232..680897)
FT                   /locus_tag="IL0623"
FT   CDS_pept        complement(680232..680897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0623"
FT                   /product="Glutathione S-transferase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81464"
FT                   /db_xref="GOA:Q5QX18"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX18"
FT                   /protein_id="AAV81464.1"
FT                   /translation="MIELYTSATPNGYKATVTLEEMGLDYNLHHVQLQENEQKRPEFLK
FT                   MNPNGRIPVIVDKNNDDFAVFESGAIMLYLAETYDKLNPKDPKERSRMIQWLMFQMGGI
FT                   GPMMGQANVFYRYFPEKLPSAIERYQNESRRLFEVLNTRLGESEYLAGDNFSLADIANW
FT                   CWVRTHDWSGVSLDGLENLKRWMNTISERPACQRGVTKPERMGDPDELVKSAQKMVQR"
FT   gene            complement(681006..681656)
FT                   /locus_tag="IL0624"
FT   CDS_pept        complement(681006..681656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0624"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81465"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX17"
FT                   /protein_id="AAV81465.1"
FT                   /translation="MSVKFEDRPLEKVREETIDQLVMNYGHGELSEEAFERRLDQAMDA
FT                   TEHSQLSDLVEDLELKPDTSYDSMKEQKFSPHYGEGRIQPTEKVISILSSNERCGVWTV
FT                   PREITIYSLLGSVELDFTDAVFQHPDVTIKIIGGLSSLEVFVPEEITISTNVFSVLGST
FT                   ENKAPSMGNLKQAPHIRIEGFQLLGSVEVKVKRTIKEKFVAFANSLKGTFQSR"
FT   gene            681888..683468
FT                   /locus_tag="IL0625"
FT   CDS_pept        681888..683468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0625"
FT                   /product="Conserved protein containing metal-dependent
FT                   amidohydrolase family domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81466"
FT                   /db_xref="GOA:Q5QX16"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX16"
FT                   /protein_id="AAV81466.1"
FT                   /translation="MSKLPFVVDAHTHLFNARYVPLQGILESWGIWKIPAKLISKLAYS
FT                   LTASSTLKERLESFSVTSKKGATEKICNEFAHLVCIEIEHYLLEEGNSDPELAEAYQEQ
FT                   FINSELYSVLKEIHQYYGDSESAQELELDYIKTKWTFKAETQVQDKISGWFSGIHKMIE
FT                   RMLRKSLEFLEDAADKIDFVLNMLRSEVGIFKRLEGYYDNFSERYVFFHYMMDMAYPFD
FT                   DNPKYDFYDQQLERMTALENFSEGIVLGFSAFDPLRFVSQSSSDRVLRDAIERSLEHGK
FT                   AGFKFYPPMGYKPADNEANVERVVDYFLDFCVEYSIPVFTHCTPEGFQAYKGSGLNSDP
FT                   DYWEQALKKNKQRETMRLCFGHAGGGKRKMNGRWVKGWLSDTEDEWNDQNNYARKVVEL
FT                   CRRYEHVYCDLSYLHEIVESKKAQESLAKRLEIELTREATADKPFKLADKIMYGSDWHM
FT                   VSMVNDIERYFGQIKAIFEMQKMQLFADRFYFKNALKYVDLEAYIARAENVFSQDYIAR
FT                   LKEIRTHLM"
FT   gene            complement(683537..684532)
FT                   /locus_tag="IL0626"
FT   CDS_pept        complement(683537..684532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0626"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81467"
FT                   /db_xref="GOA:Q5QX15"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX15"
FT                   /protein_id="AAV81467.1"
FT                   /translation="MNHPIVGLIAAVVLAIGVVELHLWLPAIQSVSPLLISIGVGILVS
FT                   HILPARCKEPLAPGLNIAKGSILRVAIVLYGFNITLQALSQVGIYGLFSAVTMVSVILF
FT                   VGIWAGTKLFKLDKEQAILVAVGSAICGAAAVAAMEPIIKAKPHKVITAISTVVVFGTL
FT                   SMLLMPLVFQFFDINEAQYGLWVGVSVHEVAQVVVAGDSVSSNAAHMAVLEKMLRVVLL
FT                   VPVLLTFAVWMRQKSKGSDKESGDNKVSVPWFAFLFIGAIIINSLNWIPDDVTTAFTAA
FT                   ATYLLCIAMTALGMLTHISVIKQGGAKAFALAALLFVSLFITGYLLAQFA"
FT   gene            684630..685502
FT                   /locus_tag="IL0627"
FT   CDS_pept        684630..685502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0627"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81468"
FT                   /db_xref="GOA:Q5QX14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX14"
FT                   /protein_id="AAV81468.1"
FT                   /translation="MINLRQLQVFKTIAETSGFTAASVQLNMTTSAVSINLKDIEQQLG
FT                   TRLVMRERGRKHRSHKVELTVAGMWLYERAQKMLSLSDSTERYFEQLHSNRRETLNIGA
FT                   SQTVGNYWLPAYINVLKQQRSELKINVYIGNTDEILSRVESFQDEIGLVEGPSSRDDLL
FT                   TKPFKEDSMTLVAPPDDNGKALEVQPWLIREKGSATRRLTEKLWAKLGIKPANVIELNT
FT                   NESIIHSVASGIGVAYVPSITTPLMLEAGLVRALPTEGTHHRTLYYVTHRDLSFSMAWI
FT                   ERVIAEKAL"
FT   gene            685670..686125
FT                   /locus_tag="IL0628"
FT   CDS_pept        685670..686125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0628"
FT                   /product="Transcription elongation factor greA/greB family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81469"
FT                   /db_xref="GOA:Q5QX13"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX13"
FT                   /protein_id="AAV81469.1"
FT                   /translation="MLFPLDNLMFSSVGDKAVLKRAFRFCKTSVCPSNPIFQEAGQQML
FT                   IDPVELSILLNRLEFSESKEALIEKRIRVGASAVLRNVKTMEQVKVRLVPPELADTDNY
FT                   LVSFISPLGSTLLGLRVGDIATVIVKDISIKWEVLTVNQNRPASDNA"
FT   gene            686333..686722
FT                   /gene="rnk"
FT                   /locus_tag="IL0629"
FT   CDS_pept        686333..686722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="IL0629"
FT                   /product="Transcription elongation factor family protein"
FT                   /note="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81470"
FT                   /db_xref="GOA:Q5QX12"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX12"
FT                   /protein_id="AAV81470.1"
FT                   /translation="MGENMNTRPNIVISCVDMAVIEHHLDETRLPREFLDELEVELARA
FT                   KIVEPNVMPANVACLNRQVTFKVLETGKVFTKTLTAPDQVDKYDDSLSVFAPLGAALIG
FT                   LSVGQSIQWKTNRGLQSVEIVHVAS"
FT   gene            686838..688049
FT                   /locus_tag="IL0630"
FT   CDS_pept        686838..688049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0630"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /note="proline aminopeptidase P II"
FT                   /db_xref="EnsemblGenomes-Gn:IL0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81471"
FT                   /db_xref="GOA:Q5QX27"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX27"
FT                   /protein_id="AAV81471.1"
FT                   /translation="MAHGVGIAKLDEALGALEDMTEGVKPITLEEYQQRVAKAQQLMQE
FT                   KGISAMYLNAGTNLEYFTGLKWYPSERLVGAVIPVKGNVTLIAPAFEVGSLTQAMILPM
FT                   DTVLWDEHESPYERLLNFLAEHFSDGYKLALDESTPYSVVAKLEERKPAETMCDAKVIT
FT                   AACRMHKSPAELALIQTAMDMTMAVHRATGAMLHEGVTASEVRGFINEAHRKVGASGSF
FT                   FCIVLFGKGTSYPHGVNYEQKLEKNDWVLIDTGCKLHGYHSDITRTYPFGNATEEQQTF
FT                   WQYERDLQQAVFDAAHIGKTCESVDDAVRVKLSELGLKADYQLPGVPHRTGHGIGMDLH
FT                   EWPYLVGGDKTELAPGMCFSNEPMVINPEKFGVRLEDHFYMSEEGAFWFTEPSRSVDDP
FT                   FNLL"
FT   gene            complement(688506..688913)
FT                   /gene="soxR_1"
FT                   /locus_tag="IL0631"
FT   CDS_pept        complement(688506..688913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxR_1"
FT                   /locus_tag="IL0631"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81472"
FT                   /db_xref="GOA:Q5QX26"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX26"
FT                   /protein_id="AAV81472.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            689009..689905
FT                   /locus_tag="IL0632"
FT   CDS_pept        689009..689905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0632"
FT                   /product="Co/Zn/Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:IL0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81473"
FT                   /db_xref="GOA:Q5QX25"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX25"
FT                   /protein_id="AAV81473.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TTKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITAGALVAWTGSNYPDLIIGTI
FT                   AGGIVLNGARRILALKG"
FT   gene            689909..690421
FT                   /locus_tag="IL0633"
FT   CDS_pept        689909..690421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0633"
FT                   /product="Lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81474"
FT                   /db_xref="GOA:Q5QX24"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX24"
FT                   /protein_id="AAV81474.1"
FT                   /translation="MLIIGKKLSPYALLSISGLLATSDQAVKWLVQQSMAYGEYVSVTP
FT                   FFNWVHLWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIAYSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLFVSSSLLGKKANTN
FT                   AESDGSD"
FT   CDS_pept        690443..691732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="Il-IS_2, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AAV81475"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81475"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX23"
FT                   /protein_id="AAV81475.1"
FT                   /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQG
FT                   EFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHE
FT                   YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRY
FT                   RCILTNIEERTLLDLLATRRQDVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQA
FT                   RIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIME
FT                   TWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGN
FT                   WREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTA
FT                   KVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
FT   gene            complement(691843..692280)
FT                   /locus_tag="IL0635"
FT   CDS_pept        complement(691843..692280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0635"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX22"
FT                   /protein_id="AAV81476.1"
FT                   /translation="MAAIFKTPASRKWVVLGIKAAITALALLPQLRERQQNTGCLRSES
FT                   DFPNAMSASPLGLLLLDERGYVITSYQIRHHITDDSAIDSEGIKRAASTAKAYGAVLTF
FT                   DKGVYANGLSIEPDVVESVRAALEEVGVRLFNQSFSSRTAQ"
FT   gene            complement(692320..692796)
FT                   /locus_tag="IL0636"
FT   CDS_pept        complement(692320..692796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0636"
FT                   /product="RadC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81477"
FT                   /db_xref="GOA:Q5QX21"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX21"
FT                   /protein_id="AAV81477.1"
FT                   /translation="MHTLDKGCYSSANNEAERDVFHRASQILEERHLRGQEPYNPNVIK
FT                   DFLTYKLAHYEREVFSIIFLDEKGHFIEYRELFYGTINAASVYPREVVRAALETKASSL
FT                   VLSHNHPSGEAEPSNADIRLTERLQKALAVIDVEVKDHIVVGKECVSFSERGLL"
FT   gene            692945..693517
FT                   /locus_tag="IL0637"
FT   CDS_pept        692945..693517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0637"
FT                   /product="prophage maintenance system killer protein
FT                   Doc-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81478"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX20"
FT                   /protein_id="AAV81478.1"
FT                   /translation="MYNPFTFDAKHIELIHNHFHDDPYYIKRDALESAVKQASNEIWNN
FT                   PTYGAFEAAGVYAYQLIRSNAFGRQSGDTALVCALLFLRLYGHGFVCTQQYLYNFVERH
FT                   ADPETMAICLSGAYAGAESYVESLHLQRPHVPMDIADIALDEDMAVSLTSAIKMAYDVN
FT                   GDYGACQKIKKPRLSGRRKRWVRLADL"
FT   gene            complement(693564..694022)
FT                   /locus_tag="IL0638"
FT   CDS_pept        complement(693564..694022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0638"
FT                   /product="RadC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81479"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX33"
FT                   /protein_id="AAV81479.1"
FT                   /translation="MHKQITSDKSAEFNSERELLDKAYLLIQSRFKQGEGFTEPSMVKE
FT                   FVQGSYQQCSTEVAGLLLLDSQHRLIDNVEFEEGEELAASMVYREVLKVNAAAVIVSYF
FT                   SPSKELNHSDKEHELSTLKSALNLIDVSLLDCMLVTDEVVSLAERGLL"
FT   gene            694156..694362
FT                   /gene="alpA"
FT                   /locus_tag="IL0639"
FT   CDS_pept        694156..694362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alpA"
FT                   /locus_tag="IL0639"
FT                   /product="prophage CP4-57 regulatory protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81480"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX32"
FT                   /protein_id="AAV81480.1"
FT                   /translation="MRFLRINEVRERIGLGRTSIYKMVNEGTFPKPVRVLGKKVAWVDS
FT                   EVDEWMLERIAEQRSDTISAVNC"
FT   gene            694516..694719
FT                   /locus_tag="IL0640"
FT   CDS_pept        694516..694719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0640"
FT                   /product="Predicted transcriptional regulator"
FT                   /note="similar to AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:IL0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81481"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX31"
FT                   /protein_id="AAV81481.1"
FT                   /translation="MKLMKVKEVMHVTSLARPTIYKYMAKGQFPKPVSLGGRAVAWVAD
FT                   EIDDWIMQCIAERDAESDIEAD"
FT   gene            complement(694889..695863)
FT                   /locus_tag="IL0641"
FT   CDS_pept        complement(694889..695863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0641"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX30"
FT                   /protein_id="AAV81482.1"
FT                   /translation="MKLADNKSYDISKALNARLKGQYHSAICYEGSFSERTLIRAKQGE
FT                   PVRAKSVKAIAKALDCEPEDLLNQNDVCWLSTRNASLTNPAAINIHASLSEFIDGVIAA
FT                   AGILSYKLDQSDLEISIDFKATSLSLELCQLESGIKNYWSVKAGYPDDTGITYIESNDS
FT                   AELQLELAVERLRMSVTDNVTINGIKQFSYCHKPGWLVVFHKFKPNDFESYVGEQHFLN
FT                   AEDFQATLNEWLQGNNITDVNGEEGGVAISVDKKELGWNVALFNRANFGPGGGVVEAAV
FT                   PPNFAKKLTTEIRSKDKSISCISNPECGSKLKFGPCKQSVSTY"
FT   gene            696103..698085
FT                   /gene="hsdM"
FT                   /locus_tag="IL0642"
FT   CDS_pept        696103..698085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="IL0642"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81483"
FT                   /db_xref="GOA:Q5QX29"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX29"
FT                   /protein_id="AAV81483.1"
FT                   /translation="MNTENYSQTASFIWSVADLLRGHFKQSQYGRVILPFTLLRRLECV
FT                   LAPNKQKVLEAAKQHQNKPDAVREQLLLRESQNDFYNASSLTLATLSDTQTAEDLISYV
FT                   QSFSSSAREIFEHFNFEEFVLKLAEADLLYQITQQFGSKIDLSTDNISNYGMGLIFEEL
FT                   IRKFAESSNETAGEHFTPRDCVHAATSLLMTGQEEVLSPNSIITIYDPTAGTGGFLSES
FT                   EEYIQSISEKVTVKLFGQELNSESYAICKADMMIKSQEVDNIKLGNTLSNDQLAHEKFK
FT                   YMLANPPFGVDWKASQRVVNDEHKVKGFDGRFGPGLPRVSDGSLLFLLHLVSKMRDTRN
FT                   GGSRIGIILNGSPLFTGSAGSGESEIRRYLLQNDLVEAIVALPSDMFFNTGISTYIWIL
FT                   SNAKKPERKGKLQLIDGSDAFAKMRKSLGSKRKYLTEENINELVRLYGAVEETKNSKVF
FT                   PNEAFGYRRVTIERPLRLNFQASEERVARLDDEKALQKLKAEDFSQLKQAIQQIDADTL
FT                   FINRDDFTRTLNAQLKVSDLNLTAAQLKAVLNALSERDSDADVCADKKGNPEADSGLRD
FT                   YENVPLTDDIYEYFERDVKPHVPDAWIDESKRDEQDGEIGIVGFEIPFNRHFYVFEPPR
FT                   PLEEIDADLKQCTDKIKQMIEELSA"
FT   gene            698082..699428
FT                   /gene="hsdS"
FT                   /locus_tag="IL0643"
FT   CDS_pept        698082..699428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="IL0643"
FT                   /product="Restriction endonuclease S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:IL0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81484"
FT                   /db_xref="GOA:Q5QX28"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QX28"
FT                   /protein_id="AAV81484.1"
FT                   /translation="MNKPIHESETRTVRDLKELLPERWKLIKLKLVCNIETGFAFPSEV
FT                   FGETGTPVIRITDIKNREINLSEIKRVDDLLLKSKPKRPSVNKGDIIMAMTGATIGKVG
FT                   YYNSDKPSYLNQRVCRFIPASIDRGYLWHTLNSEIYKKYIELEAFGGAQANISDSQLLN
FT                   FPAPLPELEAEQQKIAQFLDYETAKIDALIDEQKRLIELLKEKRQAVISHAVTKGLNPD
FT                   APMKDSGIEWLGEVPEHWEIKKLKFCSRMLSDKGKDNTNAISLENIENGTGAFIKTESN
FT                   FDQEGVLFEPLDILFGKLRPYLAKVYLAREHGSALGDILVFRANKDISPEFLFFRLISQ
FT                   EFIRQVDQSSYGSKMPRANPELIKSLQIAVPPIEEQVKVSDYLANLQFNKIMPSVINAS
FT                   SLVKLLEERRSALISAAVTGKIDVRDWQPPAGSDTVDSNASVQTERHYG"
FT   gene            699421..702597
FT                   /locus_tag="IL0644"
FT   CDS_pept        699421..702597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0644"
FT                   /product="Type I site-specific restriction-modification
FT                   system, R subunit (helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81485"
FT                   /db_xref="GOA:Q5QUX1"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUX1"
FT                   /protein_id="AAV81485.1"
FT                   /translation="MADTKERQFQTDILNSLEKDGWLIGSAANYDKANAVYTEDLIDFV
FT                   KDAYPDRWERFCKSNPGDPEKLLVHAAVKGMTRDGALHVLRHGFKAIGGTIKVCAFRPD
FT                   HGMNPDTERRYQANRLRVVEEVSYSPHAHEGDYNPRIDLVFFVNGIPTATMELKSEFKQ
FT                   TVEHAKRQYKFDRPVKDPVTRKPEPLLTFKRGALVHFAVSQDEVAMTTKLAGKETFFLP
FT                   FNLGKEDGAAGNPQSTSENSYATSYLWERLLNKDAWLKVIGRFMHLEVEEKENFDGRTQ
FT                   KKETLIFPRYHQWDVVNQLIDTTRREGPGSKYLIQHSAGSGKSNSIAWTAHQLSSLYAD
FT                   DGSKLFNSIVVVTDRTVLDSQLQNTIRQFEHADGVVRAITRDVGNKSKSEQLAEALQEQ
FT                   VRIIVVTIQTFPALYDAIDKYPALQAGNYAIIADEAHSSQTGASASKLKALLGSDRPEG
FT                   DDISAEELLDAAVQARMPNERISYYAFTATPKGKTLELFGRPDDPHSPISDDNKPKAFH
FT                   VYSMRQAIEEGFILDVLKNYTTYATAWKIAHPEGEDKEVDSKKARIKLAKWVRLHPYNI
FT                   NQRVEIIVEHFRENVRHLLNGQAKAMVVTGSRQEAVRYQLAMTSYIIEKGYQDVHALVA
FT                   FSGEVPADDYITESVTEYDKKLNPGLNGRKHDKALDSDDFNVMIVANKYQTGFDQPKLC
FT                   AMYVDKKLQGVECVQTLSRLNRTFPGKDQTFVLDFFNSEEDILESFKPYYTTAELDSVT
FT                   DPHILFDIMSKLDEEHIYEWSEVEKFAEAFYDPNAPASKLGYYCKPAKERFMARYNLAV
FT                   DTLKQAKDMLNQARVSGDKVSINKAEDSVKAAGEMVDQLDLFKKNLNSYVRMYEFLSQI
FT                   TPYNDHELESLCVYAKSLLPLLRVERLDDEDDVDISGMTLTHYRTTKKAEKELKLGEED
FT                   GGYLSSVKAVGSGKPHDPEKKKLQEIIDALNDLFGAEVGDEHKLRYAEGIAGRLREDDE
FT                   IMAQVNKHSENEVMHGLLPQRLLDRVVDSMDDHEKLSMEVLENPAVRDGFARLILKMLV
FT                   SSSTTEPKGI"
FT   gene            702600..703499
FT                   /locus_tag="IL0645"
FT   CDS_pept        702600..703499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0645"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81486"
FT                   /db_xref="GOA:Q5QUX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUX0"
FT                   /protein_id="AAV81486.1"
FT                   /translation="MSIGSSVTGFFEQIINPIKERLSSPLGSAFAAFWLAFNWHIIYYF
FT                   LMSNDSVDHKITFIKTTMYSIDSGLIFPLIWATGFCLVFPLLKNIANTVWSLSDNWSSQ
FT                   FSGFVLKNSTRLTKEEQEQHLALLEERTQEHQAAVDSYKREISELKGLLKKVDALKSHD
FT                   AKSNGSEMESERTEQADPDEVTSSELIQIIKSTDGSHRLKKYLAQQLLLNVDNQIHKKE
FT                   LQRYEAIIELLAKEHPHGWVITDITAPSNQRTSVHAVKADIEKMSMAGIAEVDDTREKS
FT                   KAFLSHDTVNFIVNSIDE"
FT   gene            complement(703511..704071)
FT                   /locus_tag="IL0646"
FT   CDS_pept        complement(703511..704071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0646"
FT                   /product="Integrase/recombinase, XerC/XerD family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81487"
FT                   /db_xref="GOA:Q5QUW9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUW9"
FT                   /protein_id="AAV81487.1"
FT                   /translation="MAEVQAVKNLDTVKLISYLLKRTYGQQIADVWDVGLNLALRISDL
FT                   LSIKFENIEHDRLLLVEGKTSKLATIKLNEKARAVIARIRSERPDHIYLFQSYRNQRSK
FT                   NTPAKPLSRRYVSRAFAAIGEEVGIDLGTHSMRKTRGYHLYKNTNDIARVMKMLRHSSE
FT                   AVTLRYIGITQEDVDRDFVELEL"
FT   gene            704320..705432
FT                   /locus_tag="IL0647"
FT   CDS_pept        704320..705432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0647"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81488"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QUX2"
FT                   /protein_id="AAV81488.1"
FT                   /translation="MSNSEAQVESEDENQDIDIEKAARIARSKAKLLENLNAGNFKQLT
FT                   TRVAHILNIFPESRNSDITLALRYWETYQHDVFDGEHIGKKDLFKLERQVDITRARAKI
FT                   QNEYKLFMAKDEIRRHRKKNEREMVESTINDQAATIKQTHVFSDESGKTQDFFVVGSIW
FT                   VLEAKQLVFLTQKIEQWKVDNGLQGKEIHFKRIKNGDFNRFKSLVDLISANSSYLSFKS
FT                   LTAKNSELKRSQAETLNKLHEIILHRGVVHEVESKRISGSSLVKVTLDDESSLDPVSLE
FT                   ELKHKVETKLAESAMNSVGLADITTVPSQRSIFIQIADLIASSIGRRLNNPDAETEKDK
FT                   IANYLIDSLQLNLSKLSSSSDITIRFNLGN"
FT   gene            705499..706716
FT                   /locus_tag="IL0648"
FT   CDS_pept        705499..706716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0648"
FT                   /product="Uncharacterized protein"
FT                   /note="contains a domain similar to RelA/SpoT specific
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:IL0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81489"
FT                   /db_xref="GOA:Q5R0A0"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A0"
FT                   /protein_id="AAV81489.1"
FT                   /translation="MDLNQFLSANNISQEDWDKSRLDKELLLDIEKDYKAYKGELHRAA
FT                   KFLAETLQPCEQVHSVRWRVKEPSHVLEKIVRKRAQGSEKYEKINVDNYKELITDLVGV
FT                   RVLHLFKSDWRGIHQFITDKWKPQEQVIAYTRKGDQDSSNENYSKNGIKVEVHEHGYRS
FT                   IHYIIATAPTNNQILSEIQVRTIFEEGWSEIDHKIRYPNFSDNELVAYFLTIFNRLSGS
FT                   ADEMGGFVRDLAKQISVNESKFNEAEQKKQEHLAKIEELAEKLSKEQQEKQDKSNSVAN
FT                   LQREIRELRESSIPLLTTSNILNAHAGVDILSPDQIQAAASAVKLGAEPLGEMDLASVM
FT                   SANHYIHETVTNTPLPDGLNQLADNHQSFINSVISGALPSDNLIISAPEVSQSKDSDDG
FT                   KTNNND"
FT   gene            706889..707068
FT                   /locus_tag="IL0649"
FT   CDS_pept        706889..707068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0649"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:IL0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R099"
FT                   /protein_id="AAV81490.1"
FT                   /translation="MSTASFDRSFDIQDSKSAVRLNEDLQSPRSVKVAKRDYANDDNKG
FT                   VLLLKQRFSGSQQR"
FT   gene            707089..707601
FT                   /locus_tag="IL0650"
FT   CDS_pept        707089..707601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0650"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:IL0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81491"
FT                   /db_xref="GOA:Q5R098"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R098"
FT                   /protein_id="AAV81491.1"
FT                   /translation="MNQLFSDFSCPPQHDVKRFLTNSAIRFEREDKARSYLILDDDNGD
FT                   LLGYFSITFKEITYPSEAVSNTANKRLGAVTDAEVDDKVRVRAYLIGQLAKNKAIEGNQ
FT                   INLEIILSEIYGVINEARELIGGRAVILECAQDDNLVALYERHGFKKIEMPPNHNGDIT
FT                   MYIVIRD"
FT   gene            complement(707635..708945)
FT                   /gene="intB"
FT                   /locus_tag="IL0651"
FT   CDS_pept        complement(707635..708945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="intB"
FT                   /locus_tag="IL0651"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81492"
FT                   /db_xref="GOA:Q5R097"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R097"
FT                   /protein_id="AAV81492.1"
FT                   /translation="MSDDKLIIATHKHVEHLKPSDRDEWYRVAGGTGLRLLVRKQGGKY
FT                   WRLKYRFNKKQKTLALGVFPNVTLKQAKDATIKAKAMLADGVDPGDTKSTNTNDNSLRF
FT                   YAAKWLEYQSQATARVWSEDHKARVWKRLENGILKKLGDKLITDVRKEDVRRLIENVEA
FT                   KGHHETAKRIADDTQRLFEYVVDQYSLEDDVDIRLLRPVKVISKPVVHREALDIKNLPF
FT                   FMQDLANYTQTGRELTALAIELLILTFVRSGELRGARWEEFDLDNKVWSIPAERMKMKR
FT                   PHEVPLSAKALDVIKRIKRITGHYELLFPSETKPDEPMSDNTMRQAMFKMGYFPKAKDT
FT                   KDGKIAKTYLKYQDNAHYPDGRLKEKAVPHGFRTMASSTLHESDQKFRSDAIERQLAHV
FT                   EQNKVKDAYSHKAEYWDERVEMMEWWGDFVNEQRETE"
FT   gene            complement(709110..709193)
FT                   /locus_tag="tRNA_Leu_1"
FT   tRNA            complement(709110..709193)
FT                   /locus_tag="tRNA_Leu_1"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon: TAA"
FT   gene            complement(709222..709292)
FT                   /locus_tag="tRNA_Cys_1"
FT   tRNA            complement(709222..709292)
FT                   /locus_tag="tRNA_Cys_1"
FT                   /product="tRNA-Cys"
FT                   /note="anticodon: GCA"
FT   gene            complement(709302..709374)
FT                   /locus_tag="tRNA_Gly_2"
FT   tRNA            complement(709302..709374)
FT                   /locus_tag="tRNA_Gly_2"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon: GCC"
FT   gene            complement(709471..710019)
FT                   /gene="pgsA"
FT                   /locus_tag="IL0652"
FT   CDS_pept        complement(709471..710019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="IL0652"
FT                   /product="Phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81493"
FT                   /db_xref="GOA:Q5R0A1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A1"
FT                   /protein_id="AAV81493.1"
FT                   /translation="MKWNIPNILTSFRIVLIPVFLVVFYLPMEDARFWAAFIFWLAAIT
FT                   DALDGYIARRFNQFTKFGEFLDPVADKAMVVAALVVIVEDYNSAFITIPALTMICRELI
FT                   VSALREWMAQSGHRAKVAVSNLGKWKTVAQMLALIGLLWNANVYIYWLSMFLFYSAFVL
FT                   TVWSMWEYLRGAKSELTRN"
FT   gene            complement(710043..711881)
FT                   /gene="uvrC"
FT                   /locus_tag="IL0653"
FT   CDS_pept        complement(710043..711881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="IL0653"
FT                   /product="Nuclease subunit of the excinuclease complex,
FT                   UvrC"
FT                   /db_xref="EnsemblGenomes-Gn:IL0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81494"
FT                   /db_xref="GOA:Q5R0A6"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5R0A6"
FT                   /protein_id="AAV81494.1"
FT                   /translation="MTEGNQQKQFDSDSFLRHLTHQPGVYRMYDESGDVIYVGKAKDLR
FT                   KRVSSYFREKVDRMKTQVLVKQIASMDVTVTNTEAEALILENSFIKKYRPRYNVLLRDD
FT                   KSYPYIILTSHQHPKLGFHRGARRAKGDYFGPFPNGSAVRESLNLLQKLFPIRQCDDSY
FT                   YRARTRPCLQYQLKRCLAPCVNVCTDDEYNEQVALAKQFLQGKNQQVIDELMNKMEQAS
FT                   TDLDFERAARFRDQIAALRKTQERNSVTGSQQELDVIGLARGNGMTTVQMLFIRDNHLQ
FT                   GSRSYFPKVPTDTPDDEVLRAFLLQFYLSDTAGRKIPREVVLPVDVQPDNVLAEVMSDA
FT                   LSQPVKLQSSVRGDKRQYQSLAQKNAVNALESRLNQQSTMNRRTQALQQVLEFGVPIQR
FT                   MECFDISHTMGQQTVASCVVFDQNGPKKSDYRRYNITGITPGDDYAAMSKALAKRYDNA
FT                   KEQGNIPDILFIDGGKGQLAQAENYFNDWGKEAPVLIGVAKGESRKPGLETLIMAGSHE
FT                   TIPLSKDASALHLIQHIRDESHRFAITGHRQKRAKVKKTSTLEQIDGVGAKRRQAILKN
FT                   LGGLQEVKNASIDKLASVPGISRSLAEKIYYSFRDE"
FT   gene            complement(711878..712528)
FT                   /gene="uvrY"
FT                   /locus_tag="IL0654"
FT   CDS_pept        complement(711878..712528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrY"
FT                   /locus_tag="IL0654"
FT                   /product="Response regulator, LuxR family (CheY, HTH
FT                   domains)"
FT                   /db_xref="EnsemblGenomes-Gn:IL0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81495"
FT                   /db_xref="GOA:Q5R0A5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A5"
FT                   /protein_id="AAV81495.1"
FT                   /translation="MNRIILAIPSPIISAGMASVLQQHFSDQILTVTGIADLRRACYEY
FT                   EDAVVVLCSRLGGAATVEHWRRLKRRHCDLKLIVWGSSQQDILDFQCGISVVDGYLLDS
FT                   CDSADLVQAIRSLKQGNVFVAAPVAAYLAQNPRSQQQKTMVDMLSERELQVAQMLSRGI
FT                   RVREISRHLCISSKTINTFRYRIFSKLGIDGDVQLSHLAIQSGLVDLIQFEGR"
FT   gene            complement(712737..713330)
FT                   /gene="alkA"
FT                   /locus_tag="IL0655"
FT   CDS_pept        complement(712737..713330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="IL0655"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81496"
FT                   /db_xref="GOA:Q5R0A4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A4"
FT                   /protein_id="AAV81496.1"
FT                   /translation="MKTTPAIVRQHLIDTQPGIDLLLLQLPERGLLAASETPVIEALPR
FT                   IIIRQMLSLKASATIIERAEQKAKALGVGRIAYIPAEELTGCGVSRSKAAAINSVAHCH
FT                   QTQPERIDAWSQMNSADLIKDVTQLKGIGPWTASILAMFHFAHEDLFPIQDSSLRKAMS
FT                   LLKDQDILIIPERAQPYRSYLACYLWDMLDQARL"
FT   gene            complement(713338..714132)
FT                   /locus_tag="IL0656"
FT   CDS_pept        complement(713338..714132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0656"
FT                   /product="TesB-like acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:IL0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81497"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A3"
FT                   /protein_id="AAV81497.1"
FT                   /translation="MNFHTAVEQIVADKNNQVIELPSGWAQGRAFFGGFSGALAAQFLL
FT                   KQFPIEYHLRSMSISFVAPAEPGEAELNYRILREGKSVIQVAVELQQQGQIMLSCLASL
FT                   GKGRSSTVTVVSETPPDLKTINDGPGLPEADIVPEFAKNFDYRITSGGMPFSGQPGRTF
FT                   GGWIRFREEQQPLTTATILALVDAWPPAVLPHLDSPAPASSLTWTIEFPDIPLQSFSSH
FT                   DWFQYEAFIEHAENGYGHSRAGLWSEKGELLAISRQTFTVFA"
FT   gene            complement(714162..715070)
FT                   /locus_tag="IL0657"
FT   CDS_pept        complement(714162..715070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0657"
FT                   /product="Uncharacterized conserved membrane protein,
FT                   containing N-terminal Zn-ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:IL0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81498"
FT                   /db_xref="GOA:Q5R0A2"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5R0A2"
FT                   /protein_id="AAV81498.1"
FT                   /translation="MESTVSNCKNCNTPLTGEYCHQCGQQDKQSIRSVFAVVGDLFGEL
FT                   GHWDSRFYRTLRGLFLKPGFLSSEFMKGRHASYVPPLRLYFFISLISFMVLTSQITFND
FT                   SQSKSEARQSETEISESDSNESTVRRGFELEFGDIPWLNEEQTRMLEQKLQHLKQNPQL
FT                   FTQKLISMTPQMMLLMLPFWALYLKVLYLFSNRYYLEHLTVALHTHAFLLLSLMLLSTL
FT                   GYITNPLIDNFGWTWLTLPSDWLGYILIGWMFTYLLLTQKSFYQQSWTLTVFKFLACVF
FT                   GYFLLLSASFVLMVIIGILKA"
FT   gene            complement(715193..715281)
FT                   /locus_tag="tRNA_Ser_1"
FT   tRNA            complement(715193..715281)
FT                   /locus_tag="tRNA_Ser_1"
FT                   /product="tRNA-Ser"
FT                   /note="anticodon: TGA"
FT   gene            715527..716195
FT                   /locus_tag="IL0658"
FT   CDS_pept        715527..716195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="IL0658"
FT                   /product="Integral membrane protein"
FT                   /note="interacts with FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:IL0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAV81499"
FT                   /db_xref="GOA:Q5R0A7"
FT                   /db_xref="InterPro:IPR006213"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB