(data stored in ACNUC8465 zone)

EMBL: AE017341

ID   AE017341; SV 1; linear; genomic DNA; STD; FUN; 2300533 BP.
XX
AC   AE017341;
XX
PR   Project:PRJNA13856;
XX
DT   10-JAN-2005 (Rel. 82, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 14)
XX
DE   Cryptococcus neoformans var. neoformans JEC21 chromosome 1, complete
DE   sequence.
XX
KW   .
XX
OS   Cryptococcus neoformans var. neoformans JEC21
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes;
OC   Tremellales; Cryptococcaceae; Cryptococcus;
OC   Cryptococcus neoformans species complex.
XX
RN   [1]
RP   1-2300533
RX   DOI; 10.1126/science.1103773.
RX   PUBMED; 15653466.
RA   Loftus B.J., Fung E., Roncaglia P., Rowley D., Amedeo P., Bruno D.,
RA   Vamathevan J., Miranda M., Anderson I.J., Fraser J.A., Allen J.E.,
RA   Bosdet I.E., Brent M.R., Chiu R., Doering T.L., Donlin M.J., D'Souza C.A.,
RA   Fox D.S., Grinberg V., Fu J., Fukushima M., Haas B.J., Huang J.C.,
RA   Janbon G., Jones S.J., Koo H.L., Krzywinski M.I., Kwon-Chung J.K.,
RA   Lengeler K.B., Maiti R., Marra M.A., Marra R.E., Mathewson C.A.,
RA   Mitchell T.G., Pertea M., Riggs F.R., Salzberg S.L., Schein J.E.,
RA   Shvartsbeyn A., Shin H., Shumway M., Specht C.A., Suh B.B., Tenney A.,
RA   Utterback T.R., Wickes B.L., Wortman J.R., Wye N.H., Kronstad J.W.,
RA   Lodge J.K., Heitman J., Davis R.W., Fraser C.M., Hyman R.W.;
RT   "The genome of the basidiomycetous yeast and human pathogen Cryptococcus
RT   neoformans";
RL   Science, e1252229 307(5713):1321-1324(2005).
XX
RN   [2]
RP   1-2300533
RA   Loftus B., Amedeo P., Roncaglia P., Vamathevan J., Utterback T.,
RA   Van Aken S., Fraser C.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2300533
RA   Janbon G., Paulet D., Chon C.C., Mornico D.;
RT   ;
RL   Submitted (17-NOV-2015) to the INSDC.
RL   Institut Pasteur, 25 rue du Dr Roux, Paris 75015, France
XX
DR   MD5; 86b80c48c65a6519374a072148347b4a.
DR   BioSample; SAMN03081418.
DR   EnsemblGenomes-Gn; CNA02110.
DR   EnsemblGenomes-Gn; CNA02190.
DR   EnsemblGenomes-Gn; CNA02200.
DR   EnsemblGenomes-Gn; CNA02280.
DR   EnsemblGenomes-Gn; CNA02320.
DR   EnsemblGenomes-Gn; CNA03230.
DR   EnsemblGenomes-Gn; CNA03260.
DR   EnsemblGenomes-Gn; CNA03270.
DR   EnsemblGenomes-Gn; CNA03920.
DR   EnsemblGenomes-Gn; CNA04440.
DR   EnsemblGenomes-Gn; CNA04450.
DR   EnsemblGenomes-Gn; CNA04530.
DR   EnsemblGenomes-Gn; CNA05190.
DR   EnsemblGenomes-Gn; CNA05640.
DR   EnsemblGenomes-Gn; CNA06720.
DR   EnsemblGenomes-Gn; CNA07160.
DR   EnsemblGenomes-Gn; CNA08020.
DR   EnsemblGenomes-Gn; CNA08300.
DR   EnsemblGenomes-Gn; EFCNEG00000000001.
DR   EnsemblGenomes-Gn; EFCNEG00000000008.
DR   EnsemblGenomes-Gn; EFCNEG00000000013.
DR   EnsemblGenomes-Gn; EFCNEG00000000014.
DR   EnsemblGenomes-Gn; EFCNEG00000000016.
DR   EnsemblGenomes-Gn; EFCNEG00000000029.
DR   EnsemblGenomes-Gn; EFCNEG00000000061.
DR   EnsemblGenomes-Gn; EFCNEG00000000063.
DR   EnsemblGenomes-Gn; EFCNEG00000000069.
DR   EnsemblGenomes-Gn; EFCNEG00000000074.
DR   EnsemblGenomes-Gn; EFCNEG00000000080.
DR   EnsemblGenomes-Gn; EFCNEG00000000081.
DR   EnsemblGenomes-Gn; EFCNEG00000000090.
DR   EnsemblGenomes-Gn; EFCNEG00000000106.
DR   EnsemblGenomes-Gn; EFCNEG00000000112.
DR   EnsemblGenomes-Gn; EFCNEG00000000115.
DR   EnsemblGenomes-Gn; EFCNEG00000000116.
DR   EnsemblGenomes-Gn; EFCNEG00000000128.
DR   EnsemblGenomes-Gn; EFCNEG00000000141.
DR   EnsemblGenomes-Gn; EFCNEG00000000145.
DR   EnsemblGenomes-Gn; EFCNEG00000000160.
DR   EnsemblGenomes-Gn; ENSRNA049543796.
DR   EnsemblGenomes-Gn; ENSRNA049543832.
DR   EnsemblGenomes-Gn; ENSRNA049543877.
DR   EnsemblGenomes-Gn; ENSRNA049543923.
DR   EnsemblGenomes-Gn; ENSRNA049543967.
DR   EnsemblGenomes-Gn; ENSRNA049544005.
DR   EnsemblGenomes-Gn; ENSRNA049544051.
DR   EnsemblGenomes-Gn; ENSRNA049544084.
DR   EnsemblGenomes-Gn; ENSRNA049544179.
DR   EnsemblGenomes-Gn; ENSRNA049544216.
DR   EnsemblGenomes-Gn; ENSRNA049544248.
DR   EnsemblGenomes-Gn; ENSRNA049544276.
DR   EnsemblGenomes-Gn; ENSRNA049544316.
DR   EnsemblGenomes-Gn; ENSRNA049544372.
DR   EnsemblGenomes-Gn; ENSRNA049544423.
DR   EnsemblGenomes-Gn; ENSRNA049544473.
DR   EnsemblGenomes-Gn; ENSRNA049544525.
DR   EnsemblGenomes-Gn; ENSRNA049544557.
DR   EnsemblGenomes-Tr; CNA02110.
DR   EnsemblGenomes-Tr; CNA02190.
DR   EnsemblGenomes-Tr; CNA02200.
DR   EnsemblGenomes-Tr; CNA02280.
DR   EnsemblGenomes-Tr; CNA02320.
DR   EnsemblGenomes-Tr; CNA03230.
DR   EnsemblGenomes-Tr; CNA03260.
DR   EnsemblGenomes-Tr; CNA03270.
DR   EnsemblGenomes-Tr; CNA03920.
DR   EnsemblGenomes-Tr; CNA04440.
DR   EnsemblGenomes-Tr; CNA04450.
DR   EnsemblGenomes-Tr; CNA04530.
DR   EnsemblGenomes-Tr; CNA05190.
DR   EnsemblGenomes-Tr; CNA05640.
DR   EnsemblGenomes-Tr; CNA06720.
DR   EnsemblGenomes-Tr; CNA07160.
DR   EnsemblGenomes-Tr; CNA08020.
DR   EnsemblGenomes-Tr; CNA08300.
DR   EnsemblGenomes-Tr; EFCNET00000000001.
DR   EnsemblGenomes-Tr; EFCNET00000000008.
DR   EnsemblGenomes-Tr; EFCNET00000000013.
DR   EnsemblGenomes-Tr; EFCNET00000000014.
DR   EnsemblGenomes-Tr; EFCNET00000000016.
DR   EnsemblGenomes-Tr; EFCNET00000000029.
DR   EnsemblGenomes-Tr; EFCNET00000000061.
DR   EnsemblGenomes-Tr; EFCNET00000000063.
DR   EnsemblGenomes-Tr; EFCNET00000000069.
DR   EnsemblGenomes-Tr; EFCNET00000000074.
DR   EnsemblGenomes-Tr; EFCNET00000000080.
DR   EnsemblGenomes-Tr; EFCNET00000000081.
DR   EnsemblGenomes-Tr; EFCNET00000000090.
DR   EnsemblGenomes-Tr; EFCNET00000000106.
DR   EnsemblGenomes-Tr; EFCNET00000000112.
DR   EnsemblGenomes-Tr; EFCNET00000000115.
DR   EnsemblGenomes-Tr; EFCNET00000000116.
DR   EnsemblGenomes-Tr; EFCNET00000000128.
DR   EnsemblGenomes-Tr; EFCNET00000000141.
DR   EnsemblGenomes-Tr; EFCNET00000000145.
DR   EnsemblGenomes-Tr; EFCNET00000000160.
DR   EuropePMC; PMC1287864; 16278457.
DR   EuropePMC; PMC1459680; 16682456.
DR   EuropePMC; PMC1865818; 17287323.
DR   EuropePMC; PMC2677675; 19436753.
DR   EuropePMC; PMC3520129; 15653466.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00213; snoR38.
DR   RFAM; RF00309; snosnR60_Z15.
XX
CC   This record represents the complete annotated sequence of the C.
CC   neoformans JEC21 genome. A small number of gaps exist which are
CC   represented by NNNNs within the final sequence. The genome has been
CC   annotated by TIGR and the annotation data is available for viewing
CC   and download from the TIGR database
CC   (http://www.tigr.org/tdb/e2k1/cna1/).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2300533
FT                   /organism="Cryptococcus neoformans var. neoformans JEC21"
FT                   /chromosome="1"
FT                   /strain="JEC21"
FT                   /variety="neoformans"
FT                   /serotype="D"
FT                   /mol_type="genomic DNA"
FT                   /note="MAT-alpha"
FT                   /db_xref="taxon:214684"
FT   gene            4839..6236
FT                   /locus_tag="CNA00010"
FT   mRNA            join(4839..5178,5241..5377,5453..5560,5646..5768,
FT                   5871..6078,6141..6236)
FT                   /locus_tag="CNA00010"
FT                   /product="expressed protein"
FT   CDS_pept        join(4914..5178,5241..5377,5453..5560,5646..5768,
FT                   5871..6059)
FT                   /codon_start=1
FT                   /locus_tag="CNA00010"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41410"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQA0"
FT                   /protein_id="AAW41410.2"
FT                   /translation="MKTYPLALDLWDSGSSVIIRSATGTRIASFPLDFISRGGDNSWSY
FT                   VLYVIGQLIIPESSRTGIIKDEHGRVLEPNESPSAGVFFFSQVADPDPQLAQTDVSFSS
FT                   GPEYFSSIKAPNPEGSISTRSDSKRSSVNQSRFYISLIARDGTCVVSGAHWESCTASHI
FT                   VPASRPDIYDCFYGDGGGLPMFRPSAGLLLRDDLHHAFDRLMFSFYQKDGVLYVHCFSM
FT                   AFQGASEYHGKAIPPNWFRAASRDLPDPVLVEWHYSQCLKARIRGFSVDML"
FT   gene            complement(6342..8374)
FT                   /locus_tag="CNA00020"
FT   mRNA            complement(join(6342..6730,6792..7128,7437..7501,
FT                   7562..7678,7748..7804,8103..8374))
FT                   /locus_tag="CNA00020"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(6520..6730,6792..7128,7437..7501,
FT                   7562..7678,7748..7804,8103..8278))
FT                   /codon_start=1
FT                   /locus_tag="CNA00020"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40616"
FT                   /db_xref="GOA:Q5KQ99"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ99"
FT                   /protein_id="AAW40616.1"
FT                   /translation="MSPAIPPFDSLPIDKSGPPYNAWGLYGSEDELGRLHLITQEAVKR
FT                   GRDTITEGISINLNLPMNFFPAHPSRKRLERQIVCSGHSNDDELSFNTQSSTQWDGLKH
FT                   YPYQHFPEEGQYRFYNGMTLEEASDSSITKLGIHNFAQKPITSCAHLLDIPLYLSRHSL
FT                   PPLSPFSASSTISLDILIACAEESKVNIQPGDILIVRTGFTDELLKLSEETRDQLRKRE
FT                   VNGSCGVAHGKEILKWHWEKGIAAVVADCPSYEAWPSQQLTAHQVFISGWGLPIGELFD
FT                   LAELAKKCEEIRRWTFFFTSMPLNVIGGIASPPNAQAIL"
FT   gene            9003..12963
FT                   /locus_tag="CNA00030"
FT   mRNA            join(9003..10557,10662..11183,11270..11936,11995..12174,
FT                   12324..12963)
FT                   /locus_tag="CNA00030"
FT                   /product="cation transporter, putative"
FT   CDS_pept        join(9208..10557,10662..11183,11270..11936,11995..12174,
FT                   12324..12574)
FT                   /codon_start=1
FT                   /locus_tag="CNA00030"
FT                   /product="cation transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40617"
FT                   /db_xref="GOA:Q5KQ98"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ98"
FT                   /protein_id="AAW40617.1"
FT                   /translation="MPNSSTQTVVAIDYAQTPSRHLHSDTHQIPNSRPSPILTHHTPAR
FT                   IAQPEFAELLTPLKFRRRKLQPRPDQQPTSLPLVAGPSRLGYYTLEGDLYRGSAYDPTQ
FT                   PPPANATAQVDDDAISLETGSTTSSTSNWSWGSGNFDRAMAVIGRVGEALGVRRGSAGS
FT                   SSSDSSAGSSDMESLKSQATAPRKGRKRRGSFMSGLSRQASRGGAEGVKAKHKREQLPK
FT                   RRQFTLLVPPPALPSGDVDIGIPSTIDPHVFAETEKLPGDRKGDKNYPPDRVITTPSLP
FT                   TVLDKIQSVRLSSGYSGIPSSVGNTPPQTPGAFPSSPTPNFASRVPVRRGGSAPGRSRK
FT                   SAGFVNPPVPLLPQTQSRLQCRSQSAASSRTATQSRLHTLRGAAESLSPIRPKSVSDLL
FT                   GLKFDAESMKEGTALMESKVGLELKGKSKSKGCWWLDVSCPTWEDLREIGELLSLHPLT
FT                   LEDVLQQDPREKLERFDKLGYYFLVIRALDENYFKYTPGSSISSPSVQSGNSNGKGGDT
FT                   QTPKSTPSEKELIDEKEGLSQGMDDRSGNNRNEDGNEQRQDIEGLEYKKSERRRRGWGM
FT                   GRAQGKMTGKMGEKVEIIEDRPGKEGLEGVGVGAVNVYLVVFADGIISFHFDDISKHTN
FT                   RVLDRVLTLANPDHGADWIAHGLLDSIVDAFFPIIRYVDGAIDDIDSLTIDPTTDPKKT
FT                   TAYLGLGLGNVMAGTDEDGSERFKQGGLGNGNEGKRDGLWRTPDHSATQHISVRKRLRA
FT                   SFPHFYPPPRVLRTFTYLRLFLLPTSSAVKRKHDQAPKTVFGRSTMLKNMTDMRKLVTG
FT                   LTRLLSAKGTVIGRLRKRAKEEGGTVEAYIGDVEDHILLLQNSLYHYEYILSHCQPAYL
FT                   SHLNVSYAFTKGRTDQAILALSVVAISILPMQFITGLFSINVHVPHNGWIHCPTDTLCE
FT                   PDGSMSPFNYFAAIVIGIALVACCMVSVIRWWRWDARKKFGRLRGIELPNAWDGFWGWE
FT                   "
FT   gene            complement(14271..15995)
FT                   /locus_tag="CNA00040"
FT   mRNA            complement(join(14271..14537,14599..14647,14705..14949,
FT                   15008..15078,15125..15131,15182..15290,15339..15995))
FT                   /locus_tag="CNA00040"
FT                   /product="calcium-binding protein, putative"
FT   CDS_pept        complement(join(14508..14537,14599..14647,14705..14949,
FT                   15008..15078,15125..15131,15182..15290,15339..15931))
FT                   /codon_start=1
FT                   /locus_tag="CNA00040"
FT                   /product="calcium-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40618"
FT                   /db_xref="GOA:Q5KQ97"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ97"
FT                   /protein_id="AAW40618.2"
FT                   /translation="MPQYISAPNPYGSVSAEARRRYEERYAKKRAEEAAKARAEAEAAN
FT                   QPEQPLQPVQQQQSPAPPPTLQPGYNQQYTNGSSQQHPGHPHQPQQAYSGPQHLHQNYA
FT                   RTPQQVTQNDPSVQPQAYHLAQSSTPPQQQQQQQWNNPTPQAQGLALGHPSQSQLPFQQ
FT                   QQPEQHPQQQQQWQQAHQHSVSPPASAEDQELQNMFRQFDSSQSGQLHAYDLQRLLAKD
FT                   ARMEAREDAVKMLMNIFDTDRSGSINFQEFEGLYRYIQDWHGIFRRFDRDNSGLIDRLE
FT                   LSNALQGFGFSLPPELVAKLVKRFTPPSTLGQTVAARPGISFDRFLLACVTVKHYTEAF
FT                   RRLDPENTGFITVAYNDYMDIVLDAPS"
FT   gene            16160..20462
FT                   /locus_tag="CNA00050"
FT   mRNA            join(16160..16485,16526..16655,16709..16970,17009..17166,
FT                   17205..17405,17444..18135,18186..18336,18409..18534,
FT                   18594..18723,18775..19000,19079..19184,19242..19351,
FT                   19407..20126,20196..20462)
FT                   /locus_tag="CNA00050"
FT                   /product="cell cycle arrest in response to
FT                   pheromone-related protein, putative"
FT   CDS_pept        join(16255..16485,16526..16655,16709..16970,17009..17166,
FT                   17205..17405,17444..18135,18186..18336,18409..18534,
FT                   18594..18723,18775..19000,19079..19184,19242..19351,
FT                   19407..20126,20196..20462)
FT                   /codon_start=1
FT                   /locus_tag="CNA00050"
FT                   /product="cell cycle arrest in response to
FT                   pheromone-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40619"
FT                   /db_xref="InterPro:IPR012486"
FT                   /db_xref="InterPro:IPR021819"
FT                   /db_xref="InterPro:IPR040185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ96"
FT                   /protein_id="AAW40619.2"
FT                   /translation="MASSKPVFGGMFDMMRRGNAQQQETAPPTPVGQGQPTVVTRPRAP
FT                   TMIMKRDGQEDGLLSGLPGGTFRSPMQEKKQKTPQYDFRYDDTDTLMNELEEFYPYVEM
FT                   ADIARNPEKFKGSFNGDWTEAPLSSRKAYIEVQLEQFESPNQHTRRLAQGRLLYLLQGC
FT                   FEETTSPEMQLHWVIENAKAVRAVDGVATIVYGLRDAARRYSISADDKPAPGSLPAGTV
FT                   PAQVDPYDDHSAELMDLLAMLYFIVEVLRTDDTFGDELMAMSPPLPLALFQMVSTLRDK
FT                   IPKGYPVKKVLLLLWKTLLACLGGMKEVQQAMALSREQAGLDPNTKYFTKASPIDIASW
FT                   HRDTATKYPTFAPPRCSAHPIPSEKLAESTRPIPPRPNYHSTEMPPAPPRPQPQPSAPA
FT                   TNNPSLPMPGTPAPSPPPSPAPPKKKQQFQTDPSRPFVFPYSRSSAAVPSSLVPFAISE
FT                   ADKLYHQHEYVSLGLLQMWQVREDYIREERGLGKSGLIGFTNGYDGEEEEDAEEVEAMM
FT                   REWKYEQEEMDCEERGDREGVKKAREKRMAAKRLRRVDIIHKNTLPILHSCVIALLKLL
FT                   LATVTSPSTGGGVNLQNANMPPGLHSPTQEMPPSDKPNAPPPTQEEIDIARHREITSKA
FT                   VSAILILLLKWFKASHVLKFHLLTQLLFDSNCLLLLLKMFGLTDISQVVTAHNEVESLN
FT                   FFNYCYLECGRQRPNDAADLRPSRHPSGPLPENAELSNDYSWRNFFSTINFLKVLQKVT
FT                   KHRSHRTYVMSSYKSWQILKRMLKVNQPMLQLQVLKLIKSQMPWCGRKWRQAAGNMKVI
FT                   TSIYLNCRPELRDDWLAGTDQDTELEDAVPQDTALRTLVQFYNLRHYIPPAPLSPDVSH
FT                   RRTSSFNPLYEDPVLQTQHPQFGHRARSDSTSGTSSESDVFPPRKSSSNNPASLPYNPD
FT                   EMIEFWLHEYEDVLVEVFGVEGGNEVLDEFGLSSEIAGLSFTSKSPSGVSDGEDIQTPG
FT                   PGNTDSRAWNRLSEIMRRGDEEEISDSESVVSVGELGSAARLGGQGADAVNDEEGISED
FT                   GEGLEESVPEGEKSRVGMGKGRRRSGAGENTWEHISPTLALLPRTPAERRRSSSSSTGS
FT                   PLRPVVPTVNSTINLGSLEGPDEVFEDEEIDTRGPMPIKMDTKDHEEREGGAVDEVEYT
FT                   YGE"
FT   gene            complement(18733..22794)
FT                   /locus_tag="CNA00060"
FT   mRNA            complement(join(18733..20106,20175..20531,20585..20944,
FT                   21003..21483,21547..21799,21849..22077,22129..22215,
FT                   22266..22459,22517..22794))
FT                   /locus_tag="CNA00060"
FT                   /product="methionine-tRNA ligase, putative"
FT   CDS_pept        complement(join(20633..20944,21003..21483,21547..21799,
FT                   21849..22077,22129..22215,22266..22459,22517..22709))
FT                   /codon_start=1
FT                   /locus_tag="CNA00060"
FT                   /product="methionine-tRNA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40620"
FT                   /db_xref="GOA:Q5KQ95"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ95"
FT                   /protein_id="AAW40620.1"
FT                   /translation="MVLRHLTRLSPCLRVSKSFAPISMRYSSSVPSNTPTTPSLFTPEG
FT                   DPANAKPFYVTTPIFYVNASPHVGHLHSLLLTDVLARFSRLRHPQRKVVFATGTDEHGL
FT                   KIQQAAKANGVGEQEFCDDVSQRFRKLAKLANASNTDFIRTTELRHVKAVEQFWNTLVA
FT                   SGDIYKGTHSGWYSISDESFYAVSQVTKSPEDGKMIAIETGNEVIWEEETNWKFRLGRH
FT                   KKVLEKWLSQPESVHPNTVRLDLLRQLSSLEDLSVSRPSSRVKWAIPVPGDPEQSIYVW
FT                   VDALINYITVLGYPDWEGKGESVGWPADVHVVGKDIIKFHALHWPSLLHSASLPAPKRI
FT                   IAHAHWTMSHTKMSKSRGNVVDPISAMTQWGEDGVRWYLMRVGGGLVDDADYNPAEVEV
FT                   HYRLLADQVGNLLSRISGAKVLKKAEREFDWGNEKTRDRGEDRDEELDGMMARMREEFE
FT                   GKMEVFGVSQACAGVMDVVMATNKLFTSLAPWSPSTPSSVPALTYAYHALRLSAILLQP
FT                   IIPAKAGEALDRLGVPAEERSWVDAEWPPSEEKVLRTEKMVERLKEASKKWKGKGHLFP
FT                   LPGKDA"
FT   gene            22943..24309
FT                   /locus_tag="CNA00070"
FT   mRNA            join(22943..23186,23239..23321,23375..23464,23606..23661,
FT                   23727..24211,24269..24309)
FT                   /locus_tag="CNA00070"
FT                   /product="proteolysis and peptidolysis-related protein,
FT                   putative"
FT   CDS_pept        join(22985..23186,23239..23321,23375..23464,23606..23661,
FT                   23727..24211,24269..24309)
FT                   /codon_start=1
FT                   /locus_tag="CNA00070"
FT                   /product="proteolysis and peptidolysis-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40621"
FT                   /db_xref="GOA:Q5KQ94"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ94"
FT                   /protein_id="AAW40621.1"
FT                   /translation="MNRQGAEAFAKLAQQLNRARMQASGGGGGGGRGGGQMPGGFKGFM
FT                   AGSGAIGTLVVGAIALNYSLFNVDGGHRAIKYSRLQGVKADIYPEGTHLVLPWFEHPVI
FT                   YDVRAKPRNIASLTGTKDLQMVNITCRVLSRPSVNDLPTIYRELGTDYDERVLPSIVNE
FT                   VLKSVVAQFNASQLITQREMVSRLVRENLTRRARRFNLILDDVSITHVAFSPEFTHAVE
FT                   AKQVAQQIAQRAAFLVDQAIQEKQSIIVKAQGEARSAELIGEAVKTNKGFLQLRKLEAA
FT                   REIAGTLAQSGNRVMLDAKSLLLDVTEDEVLNATLRK"
FT   gene            26489..27914
FT                   /locus_tag="CNA00075"
FT   mRNA            join(26489..26546,26647..27032,27094..27232,27296..27366,
FT                   27431..27914)
FT                   /locus_tag="CNA00075"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(26531..26546,26647..27032,27094..27232,27296..27366,
FT                   27431..27457)
FT                   /codon_start=1
FT                   /locus_tag="CNA00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHR2"
FT                   /protein_id="ALO60283.1"
FT                   /translation="MSGCYSTMLGAILTLNEWEQEEHIPKSWDHLENPPDVRFLSSRLD
FT                   PAVFRRMTMPDTFIFAAQHVLSRHKDKFEGKWWDLWCVIHPLASEDDPTEHLVLPAGAP
FT                   IDLQDLSSRFNLEGERLNAELLTMLTARNEATAVPTQLSETTQANLDSTLTDFTSSITT
FT                   TEYNGEGAPSISRYSDQSILGSPPDLVQDSKKHAATSSVRQRRQPTFCS"
FT   gene            28039..29480
FT                   /locus_tag="CNA00080"
FT   mRNA            join(28039..28891,28972..29480)
FT                   /locus_tag="CNA00080"
FT                   /product="expressed protein"
FT   CDS_pept        join(28562..28891,28972..29277)
FT                   /codon_start=1
FT                   /locus_tag="CNA00080"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41428"
FT                   /db_xref="GOA:Q5KQ93"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ93"
FT                   /protein_id="AAW41428.1"
FT                   /translation="MLNPRSLRFDTRQIDYTHHHHDYDYTLPKSTLISLIIGVGTFAVT
FT                   SILVVFSLRIYLRRRSLRRAQAMSGSGEDLREIMREYLDEGVKGNEGTKPEMWEVEMKY
FT                   EDEITQPLTLREPTSTRPHLAQPDISKAISIFIAFPAPYSSGPDDLPEIVLGTAIFHQS
FT                   TLSSTISRFSENEKTLSRNTSEEGSYVVKDKNTEKDGTNVVVQALEYV"
FT   gene            29947..31102
FT                   /locus_tag="CNA00090"
FT   mRNA            join(29947..30174,30262..30289,30383..30455,30665..31102)
FT                   /locus_tag="CNA00090"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(30054..30174,30262..30289,30383..30455,30665..30697)
FT                   /codon_start=1
FT                   /locus_tag="CNA00090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40622"
FT                   /db_xref="GOA:Q5KQ92"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR033871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ92"
FT                   /protein_id="AAW40622.2"
FT                   /translation="MASTILPLELVDRCIGSPIWVLMKNEREFTGTLMGFDDYVNMVLK
FT                   DVKEYEVTASGITETDLGDTLLNGNNIAMLIPGGKGPKA"
FT   gene            complement(31136..34454)
FT                   /locus_tag="CNA00100"
FT   mRNA            complement(join(31136..32790,32884..32991,33102..33161,
FT                   33258..33340,33423..34454))
FT                   /locus_tag="CNA00100"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(31375..32790,32884..32991,33102..33161,
FT                   33258..33340,33423..34233))
FT                   /codon_start=1
FT                   /locus_tag="CNA00100"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41411"
FT                   /db_xref="GOA:Q5KQ91"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ91"
FT                   /protein_id="AAW41411.2"
FT                   /translation="MRCDVCCVLWPMGWSSSWVCTNVCVSITTLSHAILVSTAMATLTP
FT                   GVSPTSCLAISSPRPPLSPISPDPSTIISPKYRAAKHKISMREVQPNYRRADGYGQGHH
FT                   HRKYQDQQRVDELDPDGVPAKADDEPRVCPVRTSPSPSPSPPSRPRSPLPSPSLKVQVR
FT                   PIRALPRLSDPTVQALGIPVSNYVFAPNPLGFQFNHSDLSRFRNGAHGRCGVDVDVDMD
FT                   VDDDGGGEEGDGKPMTMSEAVWRRWEQVGELAKGAGELFRYAYDRDGNDYRPDMTHVQA
FT                   IRLVIAASPRKMMTLAQIYQAIEERWPWHKAAGSTWKNSIRHNLSLNDCFINAERPTHE
FT                   GGSGKGGYWTVNDKLTGKTARKLKRSLRSELENEMENDAIEVDGRAGGLSHRHPYPQPN
FT                   AHATYFPSSFSPTHPHPHYPHSQTHNINDMYTTETLWDPPARPVRSVKRYRLSQPPLPP
FT                   SGSGAVSASYQPYFQLYPHSRPHQHPHEHELPHERRHEHTLERARPILANEYTRSPSPS
FT                   LYTHFPEYKRDPHLRLGISLSVPTFAHMQSHSRGALPHAPELMDQERDGDEQRDREQRV
FT                   RDSVTPFGVRVFAQERERGKEREEQRPISLVDLRQLDPSSSCPASVPSAPSSALSNFTS
FT                   APTSVSAPFPESATVLISTSTANKNKSSSEWTSHHTRTARVGTGRFWKWDLFGRSSGSA
FT                   GGERERERKKEDEREREWEGEQRGYYHPYPTPKTSGEIEREADYNDHEHYDHTQNHVHT
FT                   QNHVHTQNHVHTQNQNQKAKYVSRDIPFSLWTPPGQGAGQMGGREKGEDRDELQRAADG
FT                   VELLALAAAKIQG"
FT   gene            35826..38610
FT                   /locus_tag="CNA00110"
FT   mRNA            join(35826..36922,36974..37507,37572..37627,37684..38020,
FT                   38069..38217,38266..38610)
FT                   /locus_tag="CNA00110"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(35862..36922,36974..37507,37572..37627,37684..38020,
FT                   38069..38217,38266..38540)
FT                   /codon_start=1
FT                   /locus_tag="CNA00110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41429"
FT                   /db_xref="GOA:Q5KQ90"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ90"
FT                   /protein_id="AAW41429.1"
FT                   /translation="MAGYDARYGNPLDPMSGGRPSPPETSQQDAYEYSKHGSSSGYLGQ
FT                   LPLGADSAQAETASALRTLFGEGADVQALQEPPNQINTLAEGAAVAETGGVLGGDTTRS
FT                   DNEALAIDPSLSEQAAPAPKDSTETPDDRSRSPSSGNHHHHHPAVKRKATSRAGMLARG
FT                   GACEFCKRRKLKCSAELPACANCVKSGKECVYAQKKQRSRVKVLEDRLQELEKRLEQGQ
FT                   AGAASASGGDSGAHAASSVYTAPSLGSGGGSELTVEQTLVHNVDPSLLPPSEYDEAFIL
FT                   HDFDSFADMRKQETQLEPDLMTLADAAAADTPAAAAAETNDPWAKMSPEEIVKEIIKVA
FT                   TGGKGEGERIISHLVQTYMNSTVNTWHPLVIPPMDLVSRVSRTTPDPIHPTLLLSLIPA
FT                   LLPLSPIQSLRHPAIPLLLLPHARAHSVQAITQSDPRVLDTIIAGVSRAYSFFNEAKNI
FT                   DGWVDCVAATSLVRAAGLTKQGGVGERFVPEDRVPAERLAKRRREAGLRALMHKGAIVP
FT                   PPESWYQFGQRVNLFWTSYICDRAAAIGWGWPSSYNDEDITTPWPKDDYKSVQALLDDT
FT                   TIHTFLSPLAPAPAPATPDSDLCAQAKSITLLYHAQRLLDSPPELSTPEKTHRLLGLTE
FT                   GYMESLEKMRGPRMRAGKLSSVWMILYTTIAVLHSKDGFDKCDPDGADQVSITRVVAAA
FT                   DKVLELVSAVQNTGDTHLSSCDVISSVLFLHLARLMIQYTNRLRLRVQDSALVSTLRAK
FT                   TESFKRALIDQGERLVFAQVAAQMLENYHVGAEWKAGEWERADGGDWRGV"
FT   gene            complement(38569..39057)
FT                   /locus_tag="CNA00120"
FT   mRNA            complement(join(38569..38691,38736..38817,38864..39057))
FT                   /locus_tag="CNA00120"
FT                   /product="chaperone, putative"
FT   CDS_pept        complement(join(38666..38691,38736..38817,38864..39025))
FT                   /codon_start=1
FT                   /locus_tag="CNA00120"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41258"
FT                   /db_xref="GOA:P0CR96"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR96"
FT                   /protein_id="AAW41258.2"
FT                   /translation="MDFSQFNGAEQAHMSKVIEKKQMQDFMRLYSGLVEKCFNACAQDF
FT                   TSKALTTNETTCVQNCTDKFLKHSERVGARFAEHNAEQMQGAGQ"
FT   gene            39158..43081
FT                   /locus_tag="CNA00130"
FT   mRNA            join(39158..39919,39967..40051,40112..40542,40602..40740,
FT                   40807..40935,40989..41137,41197..41393,41466..41629,
FT                   41698..42298,42369..42537,42588..43081)
FT                   /locus_tag="CNA00130"
FT                   /product="expressed protein"
FT   CDS_pept        join(39176..39919,39967..40051,40112..40542,40602..40740,
FT                   40807..40935,40989..41137,41197..41393,41466..41629,
FT                   41698..42298,42369..42537,42588..42770)
FT                   /codon_start=1
FT                   /locus_tag="CNA00130"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40623"
FT                   /db_xref="GOA:Q5KQ88"
FT                   /db_xref="InterPro:IPR026705"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ88"
FT                   /protein_id="AAW40623.2"
FT                   /translation="MFKSLPQAIGLPFLSPAEDAQLKFKSSPAGIQRLAGPERIPPADT
FT                   AYWAQWYSLFPSPHDVPPIVRPPDLRHALQHNPANLATLTTHLAHRLFTLVPDPRFPPA
FT                   PDLCAHALSCLRVLGTVLAVVYEAEGDTPGDSFAATHLWARQKAPASSHSDTQFTLADS
FT                   DDDDAELDAGARAFKATLGHPPAPASPISDPLTQPPDDTPRPQQPDEYLPSLAERLFSC
FT                   AIDLLFCAGFTLPQSVNGEDEDDKINYVIWEKGVGSTIRIGSSPELDRNKTEVLRFLLI
FT                   LLSSPLYTPPSALHTTPNPPLFTLTHTLERRLVLSLLCSFLNTSLTRDPSSSAGGGIGI
FT                   VGGLGKLGGFGGLGLRGGEERKALVRVCMAVLLVALDYKMEARVGPAGALEGGYAGTVM
FT                   RGTGMGEGKEENAFRYFLSKLHRKEDFTFILDGILATLAEYHTSLTNGYLPGGVGVGKK
FT                   DIGCLLQTYILLWRLVDLNKRFKAHLLEQPGKTVDLVVYILVTCLELKDDPAQNGLLRL
FT                   LSYLLQTLSANEPFGKSLNQTIRIPVPARWGVTGSAVDFMIVSIYSIATTPGLNPLFPA
FT                   LTISIANISPYITNIGVQASARLLGLFKAFSAPNFLLGDEGHPRLVYYLLETFNSVLYY
FT                   QLNANPNLVYAILRSHNDFQTLATFTLMSGLRDIKRRKFLRAAAAEKNGRPGSAATTNP
FT                   SSTNSLFTRLGGGGGGGGRDNGITSDAEMIAEKAALLGLEPEEEDDVHLSGSQSQGQGE
FT                   GQGQGQGHASTPSEGDVPSLSTTPTPTPNTTTATATPDYASNPPPPSRSMSEKARGKMR
FT                   ATESTTSLATTNTHPGGGGGGGGGGGGGQEERVEDDEEEEELMKIAAAGVGPNGYVPTQ
FT                   EWVSSWQKGLPLDPVLVAISELLPKIRETQPLVGAPSEKVFNILKDVELADVLPPAPPI
FT                   TPRRFQWSPASCIWLTSLLWGDIYVAGLTSIGSWKDTQVRLFGIKQAPVRGRGAQVGRV
FT                   LKMMGVV"
FT   gene            complement(42985..45210)
FT                   /locus_tag="CNA00140"
FT   mRNA            complement(join(42985..44401,44490..44716,44784..45210))
FT                   /locus_tag="CNA00140"
FT                   /product="adenosylmethionine decarboxylase, putative"
FT   CDS_pept        complement(join(43545..44401,44490..44716,44784..45082))
FT                   /codon_start=1
FT                   /locus_tag="CNA00140"
FT                   /product="adenosylmethionine decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40624"
FT                   /db_xref="GOA:Q5KQ87"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ87"
FT                   /protein_id="AAW40624.1"
FT                   /translation="MTAELTPSIEEQALTSPGPFEGPEKLLEVWFAPSIEELPSAEEVE
FT                   GKVAGGLNARPAKENGEWQGLRKVPREVWEEMLDIVKCKVLSMVEGDDLDAYLLSESSL
FT                   FVAPHVLILKTCGTTLNLLGLYRIIEIAREYCGFNNVWRCFYSRKSFFFPERQQGPHRD
FT                   WRDEVQFLDSVFGTAGAAYTVGPMNRDHWLLYLTTPNSQPILPSDPKPCTLSLPAPSPS
FT                   SSIPTFSSSSTVTYQDTTLEILMTHLSPSARAPFFHDSDSFSSPSTTPGHVLGEAISHK
FT                   LGIDALFSKDETTLDSFGFDPCGYSANAVIGSGLPVSGKGGKEGGGYFTIHVTPEEGWS
FT                   YASFECNVPLPFSSSSSPGALAKRPDLQTLIRNVVNIFQPSRLSITLFVSTPPSSSGPG
FT                   SSEAEVKAWNSFGTDLLGNEFVRKDRIGYEFDGYDLVFACFEKKGWVESQLALGSETKK
FT                   SL"
FT   gene            complement(45276..46793)
FT                   /locus_tag="CNA00150"
FT   mRNA            complement(join(45276..45995,46151..46793))
FT                   /locus_tag="CNA00150"
FT                   /product="holocytochrome-c synthase, putative"
FT   CDS_pept        complement(join(45806..45995,46151..46776))
FT                   /codon_start=1
FT                   /locus_tag="CNA00150"
FT                   /product="holocytochrome-c synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40625"
FT                   /db_xref="GOA:Q5KQ86"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ86"
FT                   /protein_id="AAW40625.1"
FT                   /translation="MWPFSSSAAPSTAPAQAQQHPSAAASADQCPVDHTTRQAWLANNP
FT                   STPHPFHPPTSEGSSSSASAGLSQSRVISSIPRGSTPSSPSPAPPASASASASAAAGPS
FT                   SGPSSFTADAGSGHAQPQQDANGNWVYPSEQQFFNAMLRKKHNPHPQDMRTIVPIHNAV
FT                   NEKAWEEILKWECHWPSERCGGPRLVSFVGRPKERTPKAWVKTALGYTPPFDRHDWIVD
FT                   RCGTHVRYVIDFYTGRQTEGPGKMAFYLDVRPAVDDWEGIKTRVKGWWS"
FT   gene            complement(46995..48617)
FT                   /locus_tag="CNA00160"
FT   mRNA            complement(join(46995..47255,47320..47519,47589..48303,
FT                   48391..48424,48468..48617))
FT                   /locus_tag="CNA00160"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(46995..47255,47320..47519,47589..48424,
FT                   48468..48617))
FT                   /locus_tag="CNA00160"
FT   CDS_pept        complement(join(47087..47255,47320..47519,47589..48303,
FT                   48391..48407))
FT                   /codon_start=1
FT                   /locus_tag="CNA00160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIJ0"
FT                   /protein_id="ALO60284.1"
FT                   /translation="MYKKHKRMAFAELISTMLTRTPQPPPSTNTHARATQPRSSKIFNT
FT                   PDSDIVPSILYVDSSSTSSSHPTRGRTYSRTYEWYEAYQAEREKRRGSKGSTKSTSSGG
FT                   SARGRRSDELEVVDPQTISLHHTLPSVEDEIKISSAPILYLPPLLSPLPEHGHEHDHNH
FT                   DNHHDYEHSQVEVREVIGLDDSRQTLSESNEQVDPLRDFTTRLPHIDPASLALHQTLHH
FT                   FKPLSNAYASLPYDKAFNWSSLNLPKSTEREWYCVVFRSRRKPESANLSLYKADREAHE
FT                   EAVKNGGLIMYWYGVPDETGLNLATCIWQSRRHAIKAISGPKHISAMKQTKGAYETYSL
FT                   ERWVLSTEVGNREVKLRKWEGGEVGW"
FT   CDS_pept        complement(join(47087..47255,47320..47519,47589..48299))
FT                   /codon_start=1
FT                   /locus_tag="CNA00160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40626"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ85"
FT                   /protein_id="AAW40626.2"
FT                   /translation="MAFAELISTMLTRTPQPPPSTNTHARATQPRSSKIFNTPDSDIVP
FT                   SILYVDSSSTSSSHPTRGRTYSRTYEWYEAYQAEREKRRGSKGSTKSTSSGGSARGRRS
FT                   DELEVVDPQTISLHHTLPSVEDEIKISSAPILYLPPLLSPLPEHGHEHDHNHDNHHDYE
FT                   HSQVEVREVIGLDDSRQTLSESNEQVDPLRDFTTRLPHIDPASLALHQTLHHFKPLSNA
FT                   YASLPYDKAFNWSSLNLPKSTEREWYCVVFRSRRKPESANLSLYKADREAHEEAVKNGG
FT                   LIMYWYGVPDETGLNLATCIWQSRRHAIKAISGPKHISAMKQTKGAYETYSLERWVLST
FT                   EVGNREVKLRKWEGGEVGW"
FT   gene            50135..54254
FT                   /locus_tag="CNA00170"
FT   mRNA            join(50135..50304,50482..51090,51238..52229,52283..54254)
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT   mRNA            join(50135..50304,50482..51090,51238..52229,52283..53314,
FT                   53392..54254)
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT   mRNA            join(50135..50304,50482..51090,51238..51557,51618..52229,
FT                   52283..54254)
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT   CDS_pept        join(50923..51090,51238..52229,52283..53314,53392..53449)
FT                   /codon_start=1
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40628"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ84"
FT                   /protein_id="AAW40628.1"
FT                   /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATFG
FT                   NEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSKQV
FT                   AAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAVPAR
FT                   YVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHLLIVP
FT                   GQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAHQLSAR
FT                   RPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLGLHEGDG
FT                   VKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTSVPISQID
FT                   AMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDRMAKEAHEV
FT                   ELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQKLANSRWSA
FT                   RGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAKKWLPTASEMR
FT                   RSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTASQTFAGRPRAH
FT                   GDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSSYRPGYPSYAHTA
FT                   VGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRSRRFDAAHPYSSFAAAGH"
FT   CDS_pept        join(50923..51090,51238..52229,52283..53339)
FT                   /codon_start=1
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ82"
FT                   /protein_id="AAW40627.1"
FT                   /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATFG
FT                   NEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSKQV
FT                   AAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAVPAR
FT                   YVQLPERPITPHDTYRYPASHAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHLLIVP
FT                   GQFRAGTGGASDEEWGPAGREKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAHQLSAR
FT                   RPEYEVRDPWNVAWAHSVKPTATFVSFILDMIQRMTISPSALVAGIWFLAGLGLHEGDG
FT                   VKGTKLRQFLREQVSCEPEAVEKRVAMLGLILAGKWLDDNSFLTKSWTEVTSVPISQID
FT                   AMERLALADFNFSLYVPVPSWVDHVNKLFTALDLKRHRDEVDSIIHPILDRMAKEAHEV
FT                   ELTDPAAHAVQTYSKPVIDCRSSSDEIPAAADQATSRDWVSFASSYAHDQKLANSRWSA
FT                   RGSEDDVELERAERNVEMLLNDEDMDEVEQEVLEQDEDEEEFLEYDGAKKWLPTASEMR
FT                   RSTSGTDAREQKAFALQAPRQDSRVQVSAPTQVPVTSFVRARSTTPTASQTFAGRPRAH
FT                   GDWNAPTAANKRWHHAHNPFGFPVYLDPSCCQKIERKRTPINRHSSSYRPGYPSYAHTA
FT                   VGAQIEPGMSIMREPASAVSEFGFMGGGGASMCGPKRWATAARW"
FT   CDS_pept        join(50923..51090,51238..51557,51618..52229,52283..53339)
FT                   /codon_start=1
FT                   /locus_tag="CNA00170"
FT                   /product="expressed protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI15"
FT                   /protein_id="ALO60285.1"
FT                   /translation="MPYMYERPVGQQIKQRREEEARGRTEMELFKLLNGEQAGEVATFG
FT                   NEAPADGMEVDNALYGGHQPSSINDRLLPAGFDTTNYSSNADWMYDAEARAAAEYSKQV
FT                   AAQQAAIGTQQSKAYLFEREFPDPVNYHAQRSVWSPPRAEVPTWSNYEPAYRAPAVPAR
FT                   HAEHIYVAPPAPVEPSADAINGAFAFWYAQQVIHLLIVPGQFRAGTGGASDEEWGPAGR
FT                   EKDSYMRVGVLPPDYSRNWGRMGMTTPPSAPLAHQLSARRPEYEVRDPWNVAWAHSVKP
FT                   TATFVSFILDMIQRMTISPSALVAGIWFLAGLGLHEGDGVKGTKLRQFLREQVSCEPEA
FT                   VEKRVAMLGLILAGKWLDDNSFLTKSWTEVTSVPISQIDAMERLALADFNFSLYVPVPS
FT                   WVDHVNKLFTALDLKRHRDEVDSIIHPILDRMAKEAHEVELTDPAAHAVQTYSKPVIDC
FT                   RSSSDEIPAAADQATSRDWVSFASSYAHDQKLANSRWSARGSEDDVELERAERNVEMLL
FT                   NDEDMDEVEQEVLEQDEDEEEFLEYDGAKKWLPTASEMRRSTSGTDAREQKAFALQAPR
FT                   QDSRVQVSAPTQVPVTSFVRARSTTPTASQTFAGRPRAHGDWNAPTAANKRWHHAHNPF
FT                   GFPVYLDPSCCQKIERKRTPINRHSSSYRPGYPSYAHTAVGAQIEPGMSIMREPASAVS
FT                   EFGFMGGGGASMCGPKRWATAARW"
FT   gene            complement(54488..57404)
FT                   /locus_tag="CNA00180"
FT   mRNA            complement(join(54488..54792,54857..54923,54995..55064,
FT                   55163..55256,55316..55393,55463..55591,55646..55951,
FT                   56007..56348,56395..56644,56697..57090,57166..57404))
FT                   /locus_tag="CNA00180"
FT                   /product="calcium ion transporter, putative"
FT   mRNA            complement(join(54488..54792,54857..54923,54995..55064,
FT                   55163..55256,55316..55393,55463..55591,55646..55951,
FT                   56007..56348,56395..56644,56697..57404))
FT                   /locus_tag="CNA00180"
FT                   /product="calcium ion transporter, putative"
FT   CDS_pept        complement(join(54736..54792,54857..54923,54995..55064,
FT                   55163..55256,55316..55393,55463..55591,55646..55951,
FT                   56007..56348,56395..56644,56697..57090,57166..57178))
FT                   /codon_start=1
FT                   /locus_tag="CNA00180"
FT                   /product="calcium ion transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40631"
FT                   /db_xref="GOA:Q5KQ81"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ81"
FT                   /protein_id="AAW40631.1"
FT                   /translation="MFHQNTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVSSNLPTDTA
FT                   NTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNSLDPNPGLIR
FT                   RVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAKHSGGKDSISD
FT                   TAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELIVAILALIKCEL
FT                   QVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLLLIAVIAVLIPSA
FT                   FHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLFQMWTHATYYVDDA
FT                   VTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATVPPSARPGGGEVPAT
FT                   HGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTVLVGVTAEFLVDSING
FT                   MVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSISVAVGSSIQIALFVIP
FT                   VIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSNWMEGMVLMMLYIIIAVS
FT                   FWYYPGSTTATLLGCQDSSSVTG"
FT   CDS_pept        complement(join(54736..54792,54857..54923,54995..55064,
FT                   55163..55256,55316..55393,55463..55591,55646..55951,
FT                   56007..56348,56395..56644,56697..57124))
FT                   /codon_start=1
FT                   /locus_tag="CNA00180"
FT                   /product="calcium ion transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40630"
FT                   /db_xref="GOA:Q5KQ80"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ80"
FT                   /protein_id="AAW40630.1"
FT                   /translation="MSLPRRVSFPPDTQEDPPVSDSPLSSPKLPEYDPQSSSTTPIVSS
FT                   NLPTDTANTASAGPRRRQQPSRQVTLDARPPSAARRGTTESARTQHSRAGSRRTSNSLD
FT                   PNPGLIRRVTTVLFTPPKKIGKAPTYWGSIKAAITSTWLNILLVFIPIGWALYLAKHSG
FT                   GKDSISDTAVFCCTFIAIIPLAGLLGFATEEAALRLGQTLGGLLNATLGNAVELIVAIL
FT                   ALIKCELQVVQSSLVGSILSNILLVLGMCFFAGGVRFAEQAIKSTAAQLNASLLLIAVI
FT                   AVLIPSAFHFSISSSTSNTDASELANGEGADLLSMSHAVSILLLILYLGYLLFQMWTHA
FT                   TYYVDDAVTGSTQYPEAITNVSEKLKFRNFHRRKHDEEEGYSTATTVSEATVPPSARPG
FT                   GGEVPATHGPGTVASETGNRVEHESEEEEEEEETPQMNVVCTIALMVIDTVLVGVTAEF
FT                   LVDSINGMVESNPSLSAEWVGLILLPIVGNAAEHFTAVSVSVKDKLDLSISVAVGSSIQ
FT                   IALFVIPVIELLAWTIGKPMTLLFDPYESIVLFLSVLIVNQTLADGRSNWMEGMVLMML
FT                   YIIIAVSFWYYPGSTTATLLGCQDSSSVTG"
FT   gene            complement(57717..59788)
FT                   /locus_tag="CNA00190"
FT   mRNA            complement(join(57717..57851,57906..57959,58013..58383,
FT                   58448..58903,58964..59220,59286..59479,59673..59788))
FT                   /locus_tag="CNA00190"
FT                   /product="aminotransferase, putative"
FT   CDS_pept        complement(join(57786..57851,57906..57959,58013..58383,
FT                   58448..58903,58964..59220,59286..59464))
FT                   /codon_start=1
FT                   /locus_tag="CNA00190"
FT                   /product="aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40632"
FT                   /db_xref="GOA:Q5KQ79"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ79"
FT                   /protein_id="AAW40632.1"
FT                   /translation="MPRISVPAFAKTVSSRLNFTSTRTLLYTRRMSTTPNAVIPQAKRM
FT                   FDGATHKLDVWSIFTPANVPADCINLGQGFMNWAPPDWIRAESHESMDHDIMSNHYSHP
FT                   RGRPRLLKAISKHYSPQFENIVARGKDLTNEEILVTSGANCGMFAALTAHCEPGDEVIC
FT                   IEPYFDQYFASIHFQGAKPVFVPLHPPTGKGIKHGGDWTLNIDEFAAAFTPKTKAVIIN
FT                   TPHNPVGKVFTKEELEQIAKVCIEKNVLVLADEVYDCMVYDGNKHFRIATLPGMWERTL
FT                   TVGSGGKSFACTGWRVGWLIGPPQLTAATLAAHSRIVFCTNSPMQEAVAIGLEKAAEHK
FT                   FFEEQVAAYEERRDILCSYFDQIGLSYTKPEGSYFLLVDISPVKVPEGYPIVETCKGRG
FT                   KDFEFCWWLCQELKVVGIPPSEFYSEEHVNIGERFARFAFCKDPELLHAAGKRLLKLKE
FT                   YL"
FT   gene            60460..63456
FT                   /locus_tag="CNA00200"
FT   mRNA            join(60460..60849,60908..61342,61393..62031,62082..62197,
FT                   62245..62275,62331..62601,62662..62950,63014..63456)
FT                   /locus_tag="CNA00200"
FT                   /product="transcriptional activator, putative"
FT   CDS_pept        join(60562..60849,60908..61342,61393..62031,62082..62197,
FT                   62245..62275,62331..62601,62662..62950,63014..63152)
FT                   /codon_start=1
FT                   /locus_tag="CNA00200"
FT                   /product="transcriptional activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40636"
FT                   /db_xref="GOA:Q5KQ77"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ77"
FT                   /protein_id="AAW40636.2"
FT                   /translation="MSPQQRASSPDVLASPVTPGNVSTSTTNANSAATSSNNGAPQAVS
FT                   GSPANGNQTLSPGRKRRKVTRSRLGCLTCRKRRKLCDMAKPVCQACTRLKIQCSWPSES
FT                   ASKPPRSSSQRQSQTPAVSESPFVPPTDLDNMTHSISPYMSYGPTSTILPHSYTPSQAS
FT                   APSTAAAGPLSASNTLEDFTRIFGHIEEDRAGLQMNERNVRPYAIYSASAVPEVGLPPE
FT                   LNTEAEVMDWLNGSCSLDESMLQLWAADCLAVPTTQTFNAFDSLNNLLQPTPPSQDHVD
FT                   ASHPAPSHGPSDPQPPQPISRPESGRQSPSHFHSPSRRSDRGTPTSQPQTALLHYFHDS
FT                   LARLVSCTGDASSNAFEAFTKLSNMAAGQGSAGQGLHLSILAWAARHAVNRGLVKYEAA
FT                   SEKFSSQSATLVNNRMRDLFDGDGNERRSGAMPNHEKNREYMTLLASNLMLMQFKICRG
FT                   DVWGFDTVVRHLTVLVPFVFRTEKDFQAESMHHQFFENVLYHDVLGSFILNRAPMVPSS
FT                   LVSHYCSFNLEALNTLTGASLPLFSTMHRLAALVRQRRGRRGKGWSDEDLFDALQRAME
FT                   LEKDLTDEKKRLDALLIAKPHVKPHRYLHEAFRLTCLIQLHHDVLCEPPSSLHIRLLVR
FT                   QSLSLLETMIDQSLPGLCSAHWVIFQTALCCVAGGQDKAELDDRETVERIYDDILHEYG
FT                   FLNVERSRKIVHEVWARNQDGQLHMDWLDLLEEYDWEIFVV"
FT   gene            complement(64202..66562)
FT                   /locus_tag="CNA00210"
FT   mRNA            complement(join(64202..64539,64596..64698,64753..64921,
FT                   64982..65118,65191..65286,65340..65524,65598..65700,
FT                   65760..65909,65959..66133,66198..66562))
FT                   /locus_tag="CNA00210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(64305..64539,64596..64698,64753..64921,
FT                   64982..65118,65191..65286,65340..65524,65598..65700,
FT                   65760..65909,65959..66133,66198..66329))
FT                   /codon_start=1
FT                   /locus_tag="CNA00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40637"
FT                   /db_xref="GOA:Q5KQ74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ74"
FT                   /protein_id="AAW40637.1"
FT                   /translation="MTDISQYQDNKDYSGHFENDDVGTIEVPIRDQYEPAFIRKTTRKL
FT                   DFTLLPILTLMYLCSSLDKSNLGNAKTLGMINDIGGDTTGDKYALLNALYYVSYAPFMV
FT                   PLALLGKRTRMAKLLSICAICWGISATCFAAVRNFSGAYACRFLIGLGEAGFVPLIQVY
FT                   LSRFYTRRQLGTRVGIWLAMAPMGGFFNGIIAYGVAFIKSPHLESWQILFLIEGGATFL
FT                   IAIIAFIMLPEDIVRCRWLSQRQKDYLVYERSLSMAPESNEVNWKHVKGTFIRWQQIVP
FT                   VFMNMCQQITGALFSAFLPTFLSENGFEGANAQIATLAPYGSAAVCMIIASMISDRYRN
FT                   RGWPTQFGWWLSIIAFGIYLGAPYTNRSARIAALILGETGHYIATPLIVTWTANNAGSE
FT                   SRRAVAVPLAVSCAQAVAVGSGYLFPAKDKPAYQMGSAVVLGLSIAGSLFTFLYQGLIW
FT                   RENKKRDKAEGGPPASDFVAETNVYADDAPGFRYMP"
FT   gene            66867..68238
FT                   /locus_tag="CNA00220"
FT   mRNA            join(66867..67303,67361..67401,67457..67569,67629..68046,
FT                   68096..68238)
FT                   /locus_tag="CNA00220"
FT                   /product="D-3-phosphoglycerate dehydrogenase, putative"
FT   CDS_pept        join(66911..67303,67361..67401,67457..67569,67629..68046,
FT                   68096..68204)
FT                   /codon_start=1
FT                   /locus_tag="CNA00220"
FT                   /product="D-3-phosphoglycerate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40638"
FT                   /db_xref="GOA:Q5KQ73"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ73"
FT                   /protein_id="AAW40638.2"
FT                   /translation="MAISPSTKGQNGILNGVANGHHINGTNGTCGAHVKPRVFALDPLH
FT                   SEALTLAEKHFDLVLPGHEGENQWQEEAQGLLVRGSYVTAEDLERATSMKGGKLKYISK
FT                   QGTGVDKIDIVNAKKLGIPVMNTPGVNAQAVAELAFGMMLSLARQTPSIDRKIRKGASV
FT                   TKLDGWKGQMLYGKTLGVIGGGNIGLLVAKMFAGAFSGKIVLYDPYLKSLDTWHSAIPN
FT                   ASIHKVSEIDELLTTSDIVTIHVPLTPSTENMISAPQFKTMKPTAILINTARGGIINEE
FT                   DLSQALLNEEIFAAGLDAFTVEPPSLERYPDLCASERVLMLPHIGAACESVQQATCLAM
FT                   VQNLVNAFEGKVENRVY"
FT   gene            68527..69847
FT                   /locus_tag="CNA00225"
FT   mRNA            join(68527..68657,68716..68927,68995..69103,69164..69300,
FT                   69356..69443,69495..69847)
FT                   /locus_tag="CNA00225"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(68558..68657,68716..68927,68995..69103,69164..69300,
FT                   69356..69443,69495..69784)
FT                   /codon_start=1
FT                   /locus_tag="CNA00225"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LID7"
FT                   /protein_id="ALO60286.1"
FT                   /translation="MSNFYPPPRLVTARAFSSVPTTLWSTKTTDWLPGSGVPPEIFLEG
FT                   PTTDAQGNLFVVDVPYGRILRCELKSREWEVLADSDGEPNGLALNDEGQLIVADYKNGL
FT                   MKCDPKTGKIDPVLLRRNMERFKGLNDVIVARNGDIYFTDQGQTGMTDQTGLVYRLSPN
FT                   GKLDTLLWNGISPNGLVLNPEETVMYVAMTRDNSVWRLPLHSDGTTTKTGKFFTSFGIA
FT                   GPDGLTVDEEGNLFICHPSLLSIFVVTKHGIPLARIVPPEGHGTSVTNCIFGSTEEDRN
FT                   RLYFTDSTIGRICYVDWHCKGVTPLRASAR"
FT   gene            complement(69840..73057)
FT                   /locus_tag="CNA00230"
FT   mRNA            complement(join(69840..70346,70411..70563,70624..71032,
FT                   71092..71170,71231..71357,71404..71512,71568..71590,
FT                   71641..71712,71787..72604,72658..72755,72834..73057))
FT                   /locus_tag="CNA00230"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(69925..70346,70411..70563,70624..71032,
FT                   71092..71170,71231..71357,71404..71512,71568..71590,
FT                   71641..71712,71787..72604,72658..72755,72834..72968))
FT                   /codon_start=1
FT                   /locus_tag="CNA00230"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40639"
FT                   /db_xref="GOA:Q5KQ72"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ72"
FT                   /protein_id="AAW40639.2"
FT                   /translation="MSPQRGHPAHDAQTSRSSSRRSGATRVRRGANGSACDQCRKRKIR
FT                   CTGETPACARCIRLNKECRYAEGSSSAIAQTASYLEELQNQIRDLEARRSALRSLSPLN
FT                   TARETVLPSDGGHHIDDARVHQHDQSYNRNHYQHAMSMNISHVESQERYRPTADMSNRS
FT                   AELTRQTTTSSPTVSWDHHEPLRTQTHVPTSYSTTHSQNQHIDSTLNRGSQPTSPPLTT
FT                   AQPTTTLDSDGPSPRYEAISTTYPKPHDRPLPSNDQILLDLPTDLGVVSILEQSSSTQI
FT                   PLSSRITSLIRINRDILPPAENVWFLIAHFEDFISAAFPIFHIPTLRVWVDNVCFKGEP
FT                   VEAEIACSVLLVLAVSATSLARGSPCEYLKNRAASLWEYGQKFLPPVFLPPIDEQRGLL
FT                   RVQVMLIRLQYVLYNPNAGNVWGLSGAAVRASVDLGLHHESRLRGNSRTAIETDIRRRV
FT                   FWIAYSCDRDLGMALGRPPAIQDEWVTAEFPSDLDDSLITIDGLLPGPPSPAKQTAIHL
FT                   FRIRKLQSSIIFRLYASGQTVRNPTNEWLTDIQHLIEEWNDQKPRGRGFCSDEWLLLCY
FT                   HQTTTLLHRPCPGNPTPSRDSLGKVLQGSSATMRLYKEVYRNGRISFGWLSMYHLFISG
FT                   VTYLNSLWQGYRNGWRLVPSYIDALLDMQVCTSVMEGLAALTPGTVSIRNTWEAVSERM
FT                   IRQLSSHAPWDLLSRPSSPNGPNNHSSHIDSSIPLSDSSETWQAARGEGANSAMSMPND
FT                   NSGGSGTLGGGGNAMNGLMGMENPFDPFLLHPLGELSNDDWARAVASVFGPMDSTAELP
FT                   FN"
FT   gene            73171..74308
FT                   /locus_tag="CNA00240"
FT   mRNA            join(73171..73541,73590..73741,73789..74308)
FT                   /locus_tag="CNA00240"
FT                   /product="aldolase, putative"
FT   CDS_pept        join(73395..73541,73590..73741,73789..74293)
FT                   /codon_start=1
FT                   /locus_tag="CNA00240"
FT                   /product="aldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40640"
FT                   /db_xref="GOA:Q5KQ71"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ71"
FT                   /protein_id="AAW40640.1"
FT                   /translation="MSTITNGITVHVPRHRLRNGLEAGKPMIGCFSSLPSAWTARIVAS
FT                   CGWDYVIIDCEHGNHDDSDMHDTVNVIASENVSPIVRLRAGEYGLIKRALDCGAHGIMV
FT                   PMVNTPEDARNIVKWSKFPPMGVRGQGSSFSAMASGLTTHQYVSLANKTILTIVQIETP
FT                   EAVSNAEKIASIEGVDALFIGPNDLALSLLGYVPARWDEPEFLDALEKVRLAAKKYGKY
FT                   VGILARNGAHAKELSEKWKLVGLGSDVRALQTAMKATVAASRSEA"
FT   gene            75585..76906
FT                   /locus_tag="CNA00250"
FT   mRNA            join(75585..75638,75798..75944,76237..76356,76410..76503,
FT                   76556..76732,76784..76906)
FT                   /locus_tag="CNA00250"
FT                   /product="60s ribosomal protein l9, putative"
FT   CDS_pept        join(75804..75944,76237..76356,76410..76503,76556..76732,
FT                   76784..76827)
FT                   /codon_start=1
FT                   /locus_tag="CNA00250"
FT                   /product="60s ribosomal protein l9, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40641"
FT                   /db_xref="GOA:Q5KQ70"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ70"
FT                   /protein_id="AAW40641.1"
FT                   /translation="MKDISSIESLVVPEGVTVAIKARTVTVEGPRGKLTKNVGHIQMDI
FT                   QLVKTPKDSKVVFTVWHGARKHVACLRTVKSLVENMIIGVTKGFLYKMRLVYAHFPINA
FT                   LPSDDGSALQIRNFLGEKFVRDCPMLEGVKVSLSDVKDEIIIQGNDIEKVSQSAASITD
FT                   KCRVKDKDIRKFLDGVYISERTVVVKDE"
FT   gene            78361..83367
FT                   /locus_tag="CNA00260"
FT   mRNA            join(78361..78984,79056..79312,79368..79494,79640..79695,
FT                   80020..80083,80310..80735,80790..80956,81008..81104,
FT                   81156..81834,81894..81971,82026..82203,82268..83367)
FT                   /locus_tag="CNA00260"
FT                   /product="expressed protein"
FT   CDS_pept        join(81028..81104,81156..81834,81894..81971,82026..82203,
FT                   82268..82734)
FT                   /codon_start=1
FT                   /locus_tag="CNA00260"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41257"
FT                   /db_xref="GOA:Q5KQ69"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ69"
FT                   /protein_id="AAW41257.2"
FT                   /translation="MSNQKEHQYWEVTAPAIEAQSSSQTELSPVGPQGVDYSPSQSLPQ
FT                   VPDSTPPPSGSHTSSGISSTYSSMMLPPLRMTHDPRNLVPSPLSSGHPQMYSLRPPPPN
FT                   SSPNQIQAEFYYSYSMPYPPRPPAYSGHMPAHSGSSSNGPPEIFTPVSAHTNSYRFSYP
FT                   GQGTIQPYLFSPWQGQDRQLPGAPGSNFGTSERKGSPDSSTTTGERWDRPSPNQVGAAS
FT                   PLTERSTSVDEKDCKGISYTADAEVKQTPQMKRQCFNCTNRNPPSWRKSVLHPGKILCN
FT                   KCGIFERTHHRPRPPQNDDQKLRKASTLSNSIHRREAPPPLQNARTEHSSASPRSPFSG
FT                   PQSTPMSTSLTYPPMYGSPDPLQASGGYFRRSATHQPTLGSPERSPFSHSMISPNLSSS
FT                   AEDPNAMSGTASRHYGYQHSVSSPYAHAYASRRRYAPTARGMVSSPSMTPGAFSGAMGP
FT                   VMTPISGQSQLGSQTPAAGEERQPQQGQEDNDSA"
FT   gene            complement(83175..84928)
FT                   /locus_tag="CNA00270"
FT   mRNA            complement(join(83175..83753,83829..83861,83942..83943,
FT                   84015..84059,84113..84405,84484..84714,84762..84796,
FT                   84842..84928))
FT                   /locus_tag="CNA00270"
FT                   /product="sec14 cytosolic factor, putative"
FT   CDS_pept        complement(join(83529..83753,83829..83861,83942..83943,
FT                   84015..84059,84113..84405,84484..84714,84762..84796,
FT                   84842..84847))
FT                   /codon_start=1
FT                   /locus_tag="CNA00270"
FT                   /product="sec14 cytosolic factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40642"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="InterPro:IPR036273"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ68"
FT                   /protein_id="AAW40642.2"
FT                   /translation="MSAYDPLSGHPGHLSEAQETALKEFRQELTTEELIPADWEALVQR
FT                   IGYNRFDDQTLLRFLRARKFDLPKAKLMWANNEKWRKQFGADEIAANGFDYPEQSQVVK
FT                   YYPQFYHKTDNDGRPVYIEQLGKLDINKLYAITTQDRQLKRLVSEYEKFLRDRLPASSK
FT                   MTGHLVETSCTILDLYNAGISTFYKVKDYVRAASAVGQNNYPEVMGHMFIINAPYLFST
FT                   VWSLIKPWLDEATVRKIHILGKNYKPELLQYIPAESLPADLGGTCKCPVGCEMSDAGPW
FT                   NVSTTTAV"
FT   gene            complement(89520..91165)
FT                   /locus_tag="CNA00280"
FT   mRNA            complement(join(89520..89703,89767..89939,89988..90369,
FT                   90420..90476,90533..90619,90675..90769,90820..90928,
FT                   90983..91165))
FT                   /locus_tag="CNA00280"
FT                   /product="alcohol dehydrogenase, putative"
FT   CDS_pept        complement(join(89620..89703,89767..89939,89988..90369,
FT                   90420..90476,90533..90619,90675..90769,90820..90928,
FT                   90983..91093))
FT                   /codon_start=1
FT                   /locus_tag="CNA00280"
FT                   /product="alcohol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40643"
FT                   /db_xref="GOA:Q5KQ67"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ67"
FT                   /protein_id="AAW40643.1"
FT                   /translation="MSSPKTMKRYVLVHRNDLSGITFEQGAPLPQIKKSTEILINIKAL
FT                   SLNARDLQIATNQYPAPHPIPDGIVPVSDASGEIAAVGDDVTDFKVGDRVTPIIFQGHH
FT                   QDEDVTLDSMNRGIGGARNGVAAEYFVCDQSEAVKIPKSFSHQDASTLAIAYATAWSSL
FT                   YSHHPRLQSGDTVLCLGTGGVSLCAAQIALISGAKVIVTSSSQSKLDRVVDLLKPLVKG
FT                   NFADTIHTIDYSRIDKWDEEVRRITEGKGANFVIEIGGRGTIGKSIRSTRRGGLVAVSG
FT                   YLSTYKDIPKEILEEDLAQTILYSGSYVRGVFVCNREDEKRMISALEVGNVKPVIDKVF
FT                   DFENLKEAYQYMADGKHFGKICVTV"
FT   gene            94106..99392
FT                   /locus_tag="CNA00290"
FT   mRNA            join(94106..94501,94576..94908,96208..96651,96706..98190,
FT                   98249..99392)
FT                   /locus_tag="CNA00290"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(96258..96651,96706..98190,98249..98817)
FT                   /codon_start=1
FT                   /locus_tag="CNA00290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40644"
FT                   /db_xref="GOA:Q5KQ66"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ66"
FT                   /protein_id="AAW40644.1"
FT                   /translation="MVSVEQYRSQRTSYYPPPHSPTYVSPTSTASPVSGAPIFTFPFQQ
FT                   PDISSPVGKMARRPSRADPMVRTEDDMYEEDDGYGELGQRHPLRRGKEDMREEIEARPG
FT                   HEVNLTRIRERGEGMSLPGIKTLLGVKEHPSGSSSLYHSPSLPSLETNSPTTSPSSART
FT                   SRFSSFTSSTVPELSAPGWWAPEFERSPFHAVPSRSDSFSSAQLHIVDEHDQKRRRSDV
FT                   PPLRDVEESARLRWQAQSRNASFPSSSPHSSGRTTPTSWSSMRNRLHPPISSSPSVATV
FT                   MGRGSISSTSGAMSPPITRRASPSSRNPSLVGGQLSRHFADLSATDSQRGSISGAAGPP
FT                   ERRISVQAPSSTTPIDLDRAPILPPLISPENERPSMPSASFSLPSIRRSSSTSSDCLRR
FT                   HSNTQPTTPDTTGQPEVRRSSLTEIIMARSGDHIAMKEGRYAFSTEERHGSLGMEKRAE
FT                   TALGLAPIPLQSKTSVQSLAGTSSDTPAWNPQGRRESTESISSATAHLAINSEAERERT
FT                   ASLRGRKRSADMRDDSEPRADPSLVGVGVSVNVGAGDPGLRGMEVLAESARRIAAAEEE
FT                   QKAKNVEEEEVEEAQEKDEVPEKTGGPKYTCTYCVKTFSRPSSLKIHTYSHTGERPYIC
FT                   NEAGCGRRFSVQSNLKRHAKVHQVGPLGVSAPEPSVPPTKASKQPTHPSKPNEHSSPHP
FT                   PPLHHHQSHHRMAQPLPPPVMSGPMPPPGGYPFFPPSYPPLSMNAMPGPPPPGSTPGMA
FT                   PPPGYYIDGRYAVAPPPPTNGMPHGGYVQYDMPVPTHDGKDESGRDNGKGKEKSRKSNS
FT                   KEE"
FT   gene            99512..101925
FT                   /locus_tag="CNA00300"
FT   mRNA            join(99512..99776,99873..100112,100167..100244,
FT                   100294..100665,100713..100885,100940..101066,
FT                   101121..101134,101181..101598,101657..101925)
FT                   /locus_tag="CNA00300"
FT                   /product="sterol 14-demethylase, putative"
FT   CDS_pept        join(99621..99776,99873..100112,100167..100244,
FT                   100294..100665,100713..100885,100940..101066,
FT                   101121..101134,101181..101598,101657..101731)
FT                   /codon_start=1
FT                   /locus_tag="CNA00300"
FT                   /product="sterol 14-demethylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40645"
FT                   /db_xref="GOA:Q5KQ65"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ65"
FT                   /protein_id="AAW40645.1"
FT                   /translation="MSAIIPQVQQLLGQVAQFFPPWFAALPTSLKVAIAVVGIPALIIG
FT                   LNVFQQLCLPRRKDLPPVVFHYIPWFGSAAYYGEDPYKFLFECRDKYGDLFTFILMGRR
FT                   ITVALGPKGNNLSLGGKISQVSAEEAYTHLTTPVFGKGVVYDCPNEMLMQQKKFIKSGL
FT                   TTESLQSYPPMITSECEDFFTKEVGISPQKPSATLDLLKAMSELIILTASRTLQGKEVR
FT                   ESLNGQFAKYYEDLDGGFTPLNFMFPNLPLPSYKRRDEAQKAMSDFYLKIMENRRKGES
FT                   DHEHDMIENLQSCKYRNGVPLSDRDIAHIMIALLMAGQHTSSATSSWTLLHLADRPDVV
FT                   EALYQEQKQKLGNPDGTFRDYRYEDLKELPIMDSIIRETLRMHAPIHSIYRKVLSDIPV
FT                   PPSLSAPSENGQYIIPKGHYIMAAPGVSQMDPRIWQDAKVWNPARWHDEKGFAAAAMVQ
FT                   YTKAEQVDYGFGSVSKGTESPYQPFGAGRHRCVGEQFAYTQLSTIFTYVVRNFTLKLAV
FT                   PKFPETNYRTMIVQPNNPLVTFTLRNAEVKQEV"
FT   gene            complement(101895..104228)
FT                   /locus_tag="CNA00310"
FT   mRNA            complement(join(101895..102295,102471..102771,
FT                   102889..103279,103355..103591,103656..103860,
FT                   103935..104105,104161..104228))
FT                   /locus_tag="CNA00310"
FT                   /product="expressed protein"
FT   mRNA            complement(join(101895..102295,102471..102771,
FT                   102889..103279,103355..103591,103656..103860,
FT                   103935..104228))
FT                   /locus_tag="CNA00310"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(102039..102295,102471..102771,
FT                   102889..103279,103355..103591,103656..103860,
FT                   103935..104181))
FT                   /codon_start=1
FT                   /locus_tag="CNA00310"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41259"
FT                   /db_xref="GOA:Q5KQ64"
FT                   /db_xref="InterPro:IPR025337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ64"
FT                   /protein_id="AAW41259.2"
FT                   /translation="MGPFPPKVRNICISQTIHQSFQRRTVTAMSARPPSFASNFPTSTA
FT                   EPSAYFKWPGITWDSTKAVREVLEENNRGYDIYESRRFAHNHFPHSVFSRYAFGAPPKL
FT                   IHDCWNHDKTHLVSLDPAGPDRKDVDETKVPKRITREDWGNHLGNKGCYAPYLVFFHDE
FT                   IARLGPQGVLEEYIFSPQANWEIFTDPSSKDQGPPNMFNRLLAGAIHPFIHIGFGLEFN
FT                   DRVVLAEGLAEAAVHPDVIVNLVIPPSHIQPLFTTSSPRPSSSPSLLSIYTSLISSPIL
FT                   TPQPYDPKSMVNDQLKSSVNGPKAQELRAIVDRWSLSDEEVADGPNGWQKKFEEIAVFA
FT                   TLLACATGRKGKEIRVDFFLMHALTSSIFLPAYLSRLPPSFRRALLRRYILEAFHTALA
FT                   RGRPSIDPELIMSYDLYPTINTEGSEDALKKLVKEDKALGKGEKEERNAWLSLVESAMV
FT                   YPDSHVIKSIRSLAHYASLLGNSPPGGLPGTYKEEGRGVDKEEAVKGMSKLDGSVFLRA
FT                   AGAIMTTMAPGGEGAWDRSQLGYDEAWE"
FT   CDS_pept        complement(join(102039..102295,102471..102771,
FT                   102889..103279,103355..103591,103656..103860,
FT                   103935..104097))
FT                   /codon_start=1
FT                   /locus_tag="CNA00310"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:A0A0S2LHR1"
FT                   /db_xref="InterPro:IPR025337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHR1"
FT                   /protein_id="ALO60287.1"
FT                   /translation="MSARPPSFASNFPTSTAEPSAYFKWPGITWDSTKAVREVLEENNR
FT                   GYDIYESRRFAHNHFPHSVFSRYAFGAPPKLIHDCWNHDKTHLVSLDPAGPDRKDVDET
FT                   KVPKRITREDWGNHLGNKGCYAPYLVFFHDEIARLGPQGVLEEYIFSPQANWEIFTDPS
FT                   SKDQGPPNMFNRLLAGAIHPFIHIGFGLEFNDRVVLAEGLAEAAVHPDVIVNLVIPPSH
FT                   IQPLFTTSSPRPSSSPSLLSIYTSLISSPILTPQPYDPKSMVNDQLKSSVNGPKAQELR
FT                   AIVDRWSLSDEEVADGPNGWQKKFEEIAVFATLLACATGRKGKEIRVDFFLMHALTSSI
FT                   FLPAYLSRLPPSFRRALLRRYILEAFHTALARGRPSIDPELIMSYDLYPTINTEGSEDA
FT                   LKKLVKEDKALGKGEKEERNAWLSLVESAMVYPDSHVIKSIRSLAHYASLLGNSPPGGL
FT                   PGTYKEEGRGVDKEEAVKGMSKLDGSVFLRAAGAIMTTMAPGGEGAWDRSQLGYDEAWE
FT                   "
FT   gene            complement(104530..106919)
FT                   /locus_tag="CNA00320"
FT   mRNA            complement(join(104530..105664,105737..106919))
FT                   /locus_tag="CNA00320"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(104898..105664,105737..106913))
FT                   /codon_start=1
FT                   /locus_tag="CNA00320"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ63"
FT                   /protein_id="AAW41265.1"
FT                   /translation="MAVTSTFSSSDTLHTISLLPLATFLKSLTSAENIARLQDVLVKYR
FT                   SPESWERVDERMISSGDLPPPGYTSKPKDDLSDEYIDDIKARNQSQDRKPDRGEDEDEN
FT                   EVLEEGMEWDHDHDILYPSPPKRYIQEIRIDLRTLHPRAIFALESWRRETLGMEQLVME
FT                   SMESKAFAAGLDAGAGEKNEGGYFSLGVSSSPKPVQLRSLDIWFRGDREGSESTSTDER
FT                   SSIEVESIPIRAKAEPFMDGLSISGSAKRARVLKTYGSSKRLSSSSLSHPDFATRFASL
FT                   SPILATSSSPLLSPTPSEAEKGKTEDRESVSGERLEAVSASKAVSEQRSLSKKRKRGRP
FT                   RKKAERPGRPVQTSAQLGEEISATKSDGVEEEEEDKSFIEHDAGEEKEGTSRGPSSRSL
FT                   RSRMLIASTSKTPDIFEGEEELESFPSEDEPEMKKQRRIYRRKEKGVNGEERPKKRGRP
FT                   RKRPFVLASPPPANMFLPVNRPAKGTFANPIKISTPALPINNGPTAATFASLKPKSTFD
FT                   SRNASPIPYLYAATLPRISGNPTLPFGSTSSTSSSSSPRPQRPKRKNASGVLQAAEFES
FT                   DSELTELSEMSELEPRPQSQFQSHSRSGSGSWPHSQSQSKFRASASASASSKHKYKFQF
FT                   DGVLLPSFSRHV"
FT   gene            107100..110956
FT                   /locus_tag="CNA00330"
FT   mRNA            join(107100..107211,107268..108181,108236..109185,
FT                   109244..109365,109419..110361,110420..110557,
FT                   110616..110956)
FT                   /locus_tag="CNA00330"
FT                   /product="glutamate-cysteine ligase, putative"
FT   CDS_pept        join(107173..107211,107268..108181,108236..109185,
FT                   109244..109365,109419..110361,110420..110557,
FT                   110616..110857)
FT                   /codon_start=1
FT                   /locus_tag="CNA00330"
FT                   /product="translation elongation factor 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40646"
FT                   /db_xref="GOA:Q5KQ62"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ62"
FT                   /protein_id="AAW40646.1"
FT                   /translation="MSNIFAVPLQNTRNVTIVAHVDHGKTSFADSLLSSNNIISSRMAG
FT                   KLRFLDSREDEQERGITMESSAVSLRFDMTRLSPDGTSSIQQCICNVIDTPGHVDFASE
FT                   VSTASRLCDGALVLVDVWEGVATQTIAVLRQAWMDKLKPLLVINKMDRLITELKLSPSE
FT                   AYHHISQLIEQVNAVMGSFYASERMEDDLRWREEREKRLAARKEQQGEDLDDDEEYEEK
FT                   EDEDIYFAPDRGNVLFASAIDGWAFRLGKFARLYAEKLKIKEGNLRRVLWGDWYLDPKT
FT                   KRVVGRKKLAGRNLKPMFVQFVLENIWRVYDTVLNEYNPDAVQKIVTALNIRITPRDLR
FT                   SKDTRNLLNLIMQQWLPLSTATFQSIIEVIPPPPSAQAIRLPYMLHPEKAKAAAASGGL
FT                   KAENELERGLYECDQGEGAEVVAYVSKMFAVRKGDLPEYKPKEMTAEEMRARGREERER
FT                   RAALVAERQAKGEGLDGQPLPEDLAKPLESLSLENIQPATSEKPAVDDSDSEVLLGFSR
FT                   IFSSTLHRGTSLLAILPKFDSSLPPSHPHNIKHTVPIIASDLYMMMGRELVSVDSVPAG
FT                   HVCAIGGLNRAVPRSATLWAPDAKGVEEGFGKEALVNLAGVGVGANAIVRVALEPENPS
FT                   DMPKLIRGLRILNQADPCAEYFVQESGEHVIITAGELHLERCLKDLRERFAKCPIQQSA
FT                   PIVPFRETAVKAPDMAPPKTTGAPRGTINGTVINGLVKFRLRAMPLPEGVETFLLSQQG
FT                   AISKMLVRERDGKEGEEETDVQEGAEGQSGEGEVPEGQQEARQLSPEEFWTELERLLNK
FT                   AGGDWAGAADRVWSFGPKRVGANLLLDPVGTKHLRLRRREQLFTQARAQGQSADDALLS
FT                   TDHAVAADQLASLSSITSSDNEAARAELRLLRDYESSIETGFQLSTFQGPLCAEPVVGM
FT                   AWVVESVELDRQGMESEQGKGQVVGGALISAVRDACRQGLLDWSPRIKLAMYTCDIQAS
FT                   TDVLGKVYGVIARRRGRIVSEEMKEGTSFFTIRAMLPVVESFGFADEIRTRTSGAASPQ
FT                   LIFSGYETLDLDPFWVPTTQEELEDLGEKADKANVAKAYVDGVRKRKGMFVERKIVEFA
FT                   EKQRTLKK"
FT   gene            complement(110962..112420)
FT                   /locus_tag="CNA00340"
FT   mRNA            complement(join(110962..111688,111748..111899,
FT                   111978..112420))
FT                   /locus_tag="CNA00340"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(110998..111688,111748..111899,
FT                   111978..112388))
FT                   /codon_start=1
FT                   /locus_tag="CNA00340"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40647"
FT                   /db_xref="GOA:Q5KQ61"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="InterPro:IPR021625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ61"
FT                   /protein_id="AAW40647.1"
FT                   /translation="MSDPLNAASLLGLLPTLLPQGTTSPLPLSTDAIAALVHAIHTALQ
FT                   FRLISPAPQPVDDNSKLEQPRSGGDNDDAMSEVTAVEQEDNSQPPIGRLAEGWNSRGED
FT                   SYSFQYRHDQSAMNFRVRVGKMGNRVQIDAMAEDGEPHNLSVVRSELVDSGLFPIPSSA
FT                   TASSASNQESPDASATAVGFKSMNDVKTFVEKYSRDVISRLLPGLSIPGYSQVSGSDPR
FT                   GPPPAGAPQGSEPSPARPSVPRTGDPLLDNINNINPSGRNPASLGHRDLDPLASLRPPG
FT                   SFNPNRDGGGMLMDFNHPMFDSRRGRGLGDPDLDGPGGSVQPPGSRWDPVGPSPDGVGG
FT                   GGIFPGVGGNPLGGVGRGDRDRWGDEMPPPGEFGPDLGRFGGGNGIGGPLGGGRGGGRF
FT                   GGGGGFGGGGGFGGNMYM"
FT   gene            112605..114217
FT                   /locus_tag="CNA00350"
FT   mRNA            join(112605..112679,112740..112765,112827..112955,
FT                   113038..113138,113193..113801,113862..114217)
FT                   /locus_tag="CNA00350"
FT                   /product="proteasome regulatory subunit 12, putative"
FT   CDS_pept        join(112656..112679,112740..112765,112827..112955,
FT                   113038..113138,113193..113801,113862..114025)
FT                   /codon_start=1
FT                   /locus_tag="CNA00350"
FT                   /product="proteasome regulatory subunit 12, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40648"
FT                   /db_xref="GOA:Q5KQ60"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033858"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ60"
FT                   /protein_id="AAW40648.1"
FT                   /translation="MPGLTTAQVTELSGVNVVIHPLVLLSVVDHAARVPLSKNKRVLGV
FT                   LLGQDNGTSINVANSFAIPFEEDERDPKTFFLDLDYVEEMWRMFRKVNAKERPIGFYHT
FT                   GPRLRSSDLEITELFKRFCPRPVMVIVDVRTSGGRGDTGIPTDAYFAVEEIKDDGTATQ
FT                   RTFTHVSTSIEAEEAEEIGVEHLLRDISSSSSAPSSSLLTTQSLSTRVASQLQSLRGLH
FT                   ARLHEIGEYLEAVRSGKMPINHQVVYQLQEIIGLLPQLGGDVELGKAFRMGVNDQSLVV
FT                   FLSSMIRTVLALHDLIENRIQNAQQDIEDAKSPAEKANEARAEAAGIKAEDVAKAKKDA
FT                   EEEEKEKKKK"
FT   gene            complement(114123..116531)
FT                   /locus_tag="CNA00360"
FT   mRNA            complement(join(114123..114273,114330..114421,
FT                   114476..114500,114563..114646,114711..115002,
FT                   115059..115151,115232..115677,115735..115805,
FT                   116021..116214,116273..116531))
FT                   /locus_tag="CNA00360"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(114255..114273,114330..114421,
FT                   114476..114500,114563..114646,114711..115002,
FT                   115059..115151,115232..115677,115735..115805,
FT                   116021..116214,116273..116345))
FT                   /codon_start=1
FT                   /locus_tag="CNA00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41266"
FT                   /db_xref="GOA:Q5KQ59"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="InterPro:IPR036784"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ59"
FT                   /protein_id="AAW41266.1"
FT                   /translation="MSRFKISGALWDSIHHYSSFPQTGVSLQQMIHFGHNPTPGTLLKA
FT                   SQFLSEELPIRLSHRVVELNALPDGLAKMPSINKVKEWYAQSFEELVTFPKPRFKPELE
FT                   GILNVPNSDRTKLAFPSSTPNPSLDPLMDEGPVGSGLLVERHNQGNGNGNGNGNISGNG
FT                   NGNGNGNGQRLRIPMERRYYSPPPATLVYPPEVHEYNERFTHLLENIKKRHDPTVTTVA
FT                   QGVLEWKRKRKTGRIGVPIQEWLDRFYMSRIGIRFLIGQHVALNTLQPHPDYVGIICTR
FT                   ANVHDICHEAIENARYVCEEHYGLFKGPPIQLLCPKDLTFPYVPGHLSHICFELLKNSL
FT                   RAVVERFGVENEEAFPPIKVVVVEGREDITIKISDEGGGIPRSAIPMIWTYLYTTMSDE
FT                   GLEATIEQSDFKAPMAGFGYGLPLARLYARFFGGDLRLISMDGYGTDVYISLNKLSSSC
FT                   EPLQ"
FT   gene            complement(116724..119627)
FT                   /locus_tag="CNA00370"
FT   mRNA            complement(join(116724..117017,117078..117192,
FT                   117251..117634,117689..117761,117812..118124,
FT                   118183..118460,118523..118602,118666..119039,
FT                   119351..119497,119568..119627))
FT                   /locus_tag="CNA00370"
FT                   /product="hexose transport-related protein, putative"
FT   CDS_pept        complement(join(116872..117017,117078..117192,
FT                   117251..117634,117689..117761,117812..118124,
FT                   118183..118460,118523..118602,118666..118899))
FT                   /codon_start=1
FT                   /locus_tag="CNA00370"
FT                   /product="hexose transport-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40649"
FT                   /db_xref="GOA:Q5KQ57"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ57"
FT                   /protein_id="AAW40649.2"
FT                   /translation="MEDKTAPAVHSLEPVGSHSSFDKKEVHVELETTQKQGEATFYETI
FT                   SASPLNPWSKTSFQLYGILLVAALNATASGFDGSIFSSINAMSQYSEYFHHEELGSSTG
FT                   IIFMIYTIGNMIGSLFTGPICDHFGRRAGMGSGAIIIMAAAIILTAAKNDSYLLGGRFL
FT                   LGFGISIGTSSAPTYALELAPPQWRARIVGFYNTFFYAGSILSTGVAYASNKSSGELAF
FT                   RLPLGLQLIPPTCILAGLAFVPESPRWLTARGKTDQAAEILAKYHGGGDINHPVVQMEL
FT                   REFEEGIQVKKAQSWWNYYDLVDTHNQRWRFLMMACMSFFAQLSGNSVLTYYLPSMYTK
FT                   LGITSTDRRLLLTFANSIVSCTGAVFGSATNDMIGRRTKLWVGSIVLACLFAAVTGFSS
FT                   QFEGGADNVDAPMSNAGVAFIFLFGCAYSFVYTPLTATYCAEVLANHTRAKGMGVHVIM
FT                   SNCANLYNTYVTAIALEAIGWKYYLVFVALNLVYAAVWFILGVETRGRTLEELNSVFDA
FT                   KWPPKEALKKATLVKAEGRLEQL"
FT   gene            119468..121393
FT                   /locus_tag="CNA00380"
FT   mRNA            join(119468..119618,119684..120139,120215..120274,
FT                   120335..120474,120536..120811,120872..121032,
FT                   121117..121393)
FT                   /locus_tag="CNA00380"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(119952..120139,120215..120274,120335..120474,
FT                   120536..120811,120872..121032,121117..121269)
FT                   /codon_start=1
FT                   /locus_tag="CNA00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40650"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ56"
FT                   /protein_id="AAW40650.1"
FT                   /translation="MTRPAFLNDLERDGYVVVPGIVPESSCDEFISEAWEWLESFPYGF
FT                   KRDDRSTWTTEHLPYSTTGGLYNRYSVNHEAFVWKIRTDPGIRKIFEQIWDTDDLIVSF
FT                   DGMNASLPINDQTGRTDIKPTAPWPHIDQNPRNVNRFELYQGIANLAANGPSDGGLCVL
FT                   KGSHKIHQEYFDSMGGFKPDQDVGVLENGYNYKLEDTEWYKNKGCEEVKICAGKGDLIL
FT                   WDSRTIHWNASPIGDQTRFVTYVCYCPRNSMSPAELAKKVEVFKGRKGTTHFPYLNRIP
FT                   VERPGYYNALPRRPDGTLDPANRTRPRKEPEETPAVLNAVGIRA"
FT   gene            complement(121315..122743)
FT                   /locus_tag="CNA00390"
FT   mRNA            complement(join(121315..121745,121799..121917,
FT                   121967..122043,122100..122191,122247..122359,
FT                   122413..122743))
FT                   /locus_tag="CNA00390"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(121386..121745,121799..121917,
FT                   121967..122043,122100..122191,122247..122359,
FT                   122413..122557))
FT                   /codon_start=1
FT                   /locus_tag="CNA00390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40651"
FT                   /db_xref="GOA:Q5KQ55"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ55"
FT                   /protein_id="AAW40651.2"
FT                   /translation="MSTTADQETQVITADGMATPVGKSSIGKGRIAVDMDDVLCQTNAT
FT                   IVRMHNELFGLDPPLTLDDFENYLYWMNRGWGNPEETVSMVSKLYQNGLYMRAPPVPGA
FT                   KEALQKLKDMGYCLIIITARSESQREGTEEWIMEYLPDIFDEIHFTGAFQDLEPTKEEH
FT                   EGHAARKAIVSHKKRSKAEIIHNTSSLFLIDDSAENAYDIATSCYTHPHATKVLLFGAY
FT                   PWNAVVRSPESTLPIEKMTYVAKKEKGLLGESEKLRNEKIQKGWLPEGVVRVSGWKEVV
FT                   KWVEAFDKNGGAGGNRIKTA"
FT   gene            complement(122982..129542)
FT                   /locus_tag="CNA00400"
FT   mRNA            complement(join(122982..124075,124130..126166,
FT                   126216..128042,128105..128486,128634..128797,
FT                   128886..128959,129015..129159,129223..129542))
FT                   /locus_tag="CNA00400"
FT                   /product="histone deacetylation-related protein, putative"
FT   CDS_pept        complement(join(123083..124075,124130..126166,
FT                   126216..128042,128105..128239))
FT                   /codon_start=1
FT                   /locus_tag="CNA00400"
FT                   /product="histone deacetylation-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40652"
FT                   /db_xref="GOA:Q5KQ54"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ54"
FT                   /protein_id="AAW40652.2"
FT                   /translation="MYPDAGPSRPAPYPAKPLVGTTGRSPRSGPSRRDDFERDRDREGY
FT                   SATTRPYPIPPWSSRLPPRQPVRPYQSGPSIGSRPRSFSPSPPRRSYDRDWERDRDRER
FT                   ARDRERDWERDRDRSYDVRDRLALDPGWRSGTSIAGDLDNQPPRRPGGFSSVPSRGPDR
FT                   EGWGREDRRWIGDRRDDRDRYEPSPRGPPRPITSSMPHSYPSERPRSPPSAPRGPRSVT
FT                   AQPLASPYPSRIPPGPKSQGAPMWNDRDRESGPRRTSGPNGLPSLNLAAAQSLSAQPSP
FT                   TISKFSPTTTYIPNAPNSARGSNSPIDSRRTRDVERPQSLPPGSIVPSLPPVNTEIEPK
FT                   PAPESQDLEEGEVVSPVQTARNPSWNYPEERRRAWTPPRDRDREHWEREREREREWLRE
FT                   RDRGRVDRDLDRRRPSPALSSWSNKRTEESRQVRPRRSPSNPPRDPIRPISPVQRSKQP
FT                   THVPVEDGELRLSEAAITSDKRIEELKRDPERTDHPATPSVPPPPSLPDADDGMPDSTP
FT                   VKEEKEASPVEHPAINPVRDTTTETGYSALPVQPTADTLNDVTMKSPVIETVDAQANGM
FT                   LQETITTDIIMTSHDTKDVSMDPASPLGPPPLENGSEVSVERQTSPILDAVAPSQLTSP
FT                   SLPKAEKVIESVDANMANNGAVPEPTEPFSGKQTDTVPQLSPHSTIAERRSVKLPPNIP
FT                   LNRKESFPRKDSMLSGQSTDVENDVELRTAVSEIDTLVLEDGEEQDELGAEKARELNLI
FT                   ASVKAAQARHVHLQEFPILAWNMAAAPEESSRVTVMDDEGRERMLKEFTRPLKREEAIR
FT                   AKFVRFVVAHEKVKTKNTITRLKDSYLSINKKWKDHCSFLDELMKERGPPPPELYAMPG
FT                   AIHPVVTPGAVAPTTPAVEEIFNSRSNRRRGLGGDIVATDAEFEEILAGLADNALKDPN
FT                   LRASKTAAVIPDMIVGQERNLQYDNDNDLVTDPLSFYDNIGVAEPIWTSEERAIFVKRY
FT                   LAYPKQFGRIADGIPNKTAGECVLYYYRTKKEMDYKGMLAHKRGGGKRKLALKKGAKSS
FT                   ALMQDLTRAKPTVSKDDAAVATPAKGREQSVVLPAGGKRGRGEGGGPGRKKRVSQSVAV
FT                   PQTPTPQNEEEEEGHMDSASTSRAGSEVPSVSSTKAKMRMTVKTAKRPRVSSIPELSTP
FT                   TQNPPAQPDTTALTPATEVPEHPSLTNTTELAAAALASLADVATSAAQAELLPPVRRAG
FT                   KRRKIAGEPGPIVDPNAPPAITVAGAPEKEKPARRSATNSYWSVEERRKVKELVVLHGM
FT                   DAKLIAAQLKGKSERQVGNFLEGHRTELEALEGVTGTTGVVEETKVQTSTPLESQAHQQ
FT                   IDAPVQARPEMYNKPRQSGGRTIYDAFPSFMSSQDRYEPRLGMFPSSNPVSTPTPASHA
FT                   SHIAQSAPKSAQGSNSPVRPIFRAGGMRISALLNDEPPTEAGEQGEIGVVPDSIDTASD
FT                   VTIDERELDVVTGPSPRSLPAASDIPAGYPSYEQRHDERHSAHASQSPSLPHMSHSPNA
FT                   WNGTRPEASPIYGHAPAVPAPTLAHRGSWESHPPPGHICTSSTTRFETLPPIRSQPATY
FT                   DRSPLAHGHIGPLTPHGHDREQFHQQQPQAHDGSQREWDERKYEKTEGFQSATLPPLRN
FT                   MEHEGGAQGGTGDGVADDRNGDQER"
FT   gene            128832..129625
FT                   /locus_tag="CNA00410"
FT   mRNA            join(128832..128967,129029..129170,129269..129502,
FT                   129567..129625)
FT                   /locus_tag="CNA00410"
FT                   /product="expressed protein"
FT   CDS_pept        join(128929..128967,129029..129170,129269..129372)
FT                   /codon_start=1
FT                   /locus_tag="CNA00410"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41407"
FT                   /db_xref="GOA:Q5KQ53"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ53"
FT                   /protein_id="AAW41407.1"
FT                   /translation="MTNLFEGLYHTVQGIFQSIFAVFQSFFNVVYAFVHGVVSLVWNVL
FT                   ESIAEFVGASVHFVISNILIIGLIALGVVLYNDRNKRGTLGNDLKKKAQ"
FT   gene            129721..131335
FT                   /locus_tag="CNA00420"
FT   mRNA            join(129721..129935,130008..130248,130306..130393,
FT                   130459..130515,130566..131100,131192..131335)
FT                   /locus_tag="CNA00420"
FT                   /product="expressed protein"
FT   CDS_pept        join(129882..129935,130008..130248,130306..130393,
FT                   130459..130515,130566..130656)
FT                   /codon_start=1
FT                   /locus_tag="CNA00420"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41260"
FT                   /db_xref="GOA:Q5KQ52"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ52"
FT                   /protein_id="AAW41260.1"
FT                   /translation="MPPVVSSVVWFAQNAQYIIAFVLGATTLVFSCLAYLILRWVILPN
FT                   PFLGLFSPKSHPKRKPTKAKGKTTNLKKTTSRSKVTRNSSPGLVDSAFTMMGTGLLICS
FT                   IASAVICAYSLTSQGCEALRHFGLIEWLPWKTGLRCYRSRWDWVGEFLGELLLTLLHKS
FT                   EYGTAAIKTIENM"
FT   gene            complement(130685..131844)
FT                   /locus_tag="CNA00430"
FT   mRNA            complement(join(130685..131173,131255..131324,
FT                   131396..131844))
FT                   /locus_tag="CNA00430"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(130842..131173,131255..131324,
FT                   131396..131710))
FT                   /codon_start=1
FT                   /locus_tag="CNA00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40653"
FT                   /db_xref="InterPro:IPR010686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ51"
FT                   /protein_id="AAW40653.1"
FT                   /translation="MPRSADDPIVQAEQNFYNSSMYNAMGAAQMSFQPINRIHQHLCGL
FT                   HIYAHDTKRGVKAHHFCTHLRHDLHQCVIYDSDQPDARLIGIEYLIPEDAFIALPTDEK
FT                   KYWHSHRYEVDSGMLMLGTKSLVPNAVSDIAERPAMLELHRMYGKTTHTWQFDLHPDLP
FT                   LGPPQLMMAYTDDSQVDRQLLKERDEALGVSTEAKRKVRKGYLKKEDLERPPAEGADPC
FT                   WNGKLGQWEYVEKEKE"
FT   gene            132051..133461
FT                   /locus_tag="CNA00450"
FT   mRNA            join(132051..132816,132871..133036,133093..133461)
FT                   /locus_tag="CNA00450"
FT   gene            complement(132063..132917)
FT                   /pseudo
FT                   /locus_tag="CNA00440"
FT   gene            133655..135951
FT                   /locus_tag="CNA00460"
FT   mRNA            join(133655..133799,133858..134341,134396..135951)
FT                   /locus_tag="CNA00460"
FT                   /product="expressed protein"
FT   CDS_pept        join(133771..133799,133858..134341,134396..135907)
FT                   /codon_start=1
FT                   /locus_tag="CNA00460"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40655"
FT                   /db_xref="InterPro:IPR010378"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ49"
FT                   /protein_id="AAW40655.1"
FT                   /translation="METAPLTLKVLHISPLTLIPTSNPDASASIPPIPLPPPPPPAGFN
FT                   FSPTPNYPPPFGSIPLGSKLDLRVGLENVHRQRYGVHGVRMMVEVQSASGRVRLGEAIH
FT                   GQISDTSSEQPLQEGQESQLPELKFGEMVELGVESEMKDLGLGVVIVSVAWETLDGRKT
FT                   FQRFFKFNIITPLGIKTRVQIPSHPNSTLSLSLREQTYLEVFMQNTSLESMLISGISLE
FT                   PVEGLKVNKIGGSEMDGEELIVGGTRQYLFVVDSSPSNDDEGAKQGKSIFPPTYPAGAV
FT                   LPLGRLLVEWISGPYHTPGKLLTSMLNRRAPAPRLPSITQPHPTPTRTLSAAPPTPSKG
FT                   PTALDTGSGTLATPRRGLSPNPDSIPSPRHRPLPSPSPKWAFDLTLNGSRKVPLQSEWY
FT                   LTLNLAVRSAAPIQDSSEEQAVPTLPRLGIQYLTPVEPPLVDGAQSETDHSRQSQQGNP
FT                   QMMLSPPSRTSTPASPALSSAGRPLSPFTTTSTASTSIAGISGISRSTTPLRAELKSAV
FT                   GSMIGPNPFTSAFFKKIQTAPDDDQEEKESRASFPPIASVVPNPDYKPSASLDKSAGPV
FT                   QIYHIGSSLIFPDFPPLTPKFENLGLQPLSAGGSEKKERESEKVAKKYWETSVQWQWKF
FT                   VGFEEGLGVLGGARVLISEGEDEGVIGREWECLGDVTVS"
FT   gene            complement(136220..137816)
FT                   /locus_tag="CNA00470"
FT   mRNA            complement(join(136220..136830,136887..137027,
FT                   137080..137164,137218..137438,137576..137816))
FT                   /locus_tag="CNA00470"
FT                   /product="fructose-bisphosphatase, putative"
FT   CDS_pept        complement(join(136372..136830,136887..137027,
FT                   137080..137164,137218..137438,137576..137722))
FT                   /codon_start=1
FT                   /locus_tag="CNA00470"
FT                   /product="fructose-bisphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40656"
FT                   /db_xref="GOA:Q5KQ48"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ48"
FT                   /protein_id="AAW40656.1"
FT                   /translation="MAAPQATLGADLEPPATDLITLTRHILSQQYALGESATGDLTMLL
FT                   IAIQVTSKYIASNVRKARLINLVGLAGASNVQGEDQKKLDVLSNDIMVNALSASGKCSV
FT                   MVSEEVDEAIIVSGIKGTYCVVFDPLDGSSNIDAGVNVGTIFGVYKVQEGSRGTVEDVL
FT                   RPGREMVAAGYTMYGSSCNLVLSTGNGVDGFTLDESLGEFILTHPAIKIPSRGKIYSFN
FT                   EGNSLHFYPPTNDYLNSIKYPENGKPYSARYIGSMVADVHRTLLYGGIFGYPDDKKSKD
FT                   GKLRMLYEAFPMSFLTEQAGGVATTGSQRILDIVPTSIHGRCPVFLGSKEDVEDLKKFY
FT                   VNYKDDSRKW"
FT   gene            complement(138008..140770)
FT                   /locus_tag="CNA00480"
FT   mRNA            complement(join(138008..138178,138462..138642,
FT                   138701..138838,138898..139083,139171..139291,
FT                   139353..139694,139767..139834,139897..140027,
FT                   140093..140293,140358..140382,140453..140498,
FT                   140586..140611,140674..140770))
FT                   /locus_tag="CNA00480"
FT                   /product="T-complex protein 1 epsilon subunit, putative"
FT   CDS_pept        complement(join(138048..138178,138462..138642,
FT                   138701..138838,138898..139083,139171..139291,
FT                   139353..139694,139767..139834,139897..140027,
FT                   140093..140293,140358..140382,140453..140498,
FT                   140586..140611,140674..140724))
FT                   /codon_start=1
FT                   /locus_tag="CNA00480"
FT                   /product="T-complex protein 1 epsilon subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40657"
FT                   /db_xref="GOA:Q5KQ47"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ47"
FT                   /protein_id="AAW40657.1"
FT                   /translation="MSVDQINPGQAVYAQDENGRPFIIVREQGRKVRTHGLEAIRSHIL
FT                   AARSVTNIIKTSLGPRGLDKILISPDGEITVTNDGATILGQMEVEHQIAKLLVEVSKSQ
FT                   DDEIGDGTTGVVVLAGALLSSALSLLDRGIHPIRIADGYEKACEIAVAELDRVADTIEF
FT                   SKDDVSNLMKTAKTSLGSKIVSIAHDKFASIAVEAVLSVADLERRDVDFELIKVDGKVG
FT                   GSLEDTSLVKGVVIDKDMSHPQMPSVVRDAKIAILTCPFEPPRPKTKHKLDIESVEEYK
FT                   KLREYEKEKFLDMIKKVKDTGANLVICQWGFDDEANHLLMQNELPAVRWVGGPEIELIA
FT                   IATNGRIVPRFEDLTADKLGHAGVVRELTFGTTRDKMLVIEECANSRAVTVFVRGSNKM
FT                   IIDEAKRALHDAICVARNLVRDNRVVYGGGAAEICASVAVSKRADEIPTIEQYAMRAFA
FT                   NALDAIPLALAENSGLSPIDTLADVKSRQVTEGNPRLGIDCLGRAENDMKKQHVYDPLI
FT                   SKRQQFLLATQVVRMILRVDDVIDASAFGDE"
FT   gene            140963..142003
FT                   /locus_tag="CNA00485"
FT   mRNA            join(140963..141122,141207..141607,141674..142003)
FT                   /locus_tag="CNA00485"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(141003..141122,141207..141607,141674..141944)
FT                   /codon_start=1
FT                   /locus_tag="CNA00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHS9"
FT                   /protein_id="ALO60288.1"
FT                   /translation="MSTPAAVTQPQSASKEPHRMRITAGGSIRHYVAFALASLRDDPAT
FT                   PVVLHTLPSSSSSPSSSSSSSSTNAPKKDNDKIKPQPKSKSPLPACLITAPRLISVVEL
FT                   IKREYISELRAAKASCRGDVRSKGKGIWQYTESGLWEPATEAGVNAVTQRTETEGIDGG
FT                   ALRRVLAGRTKPKMSHSPYLQITLSARPLEGLEREGATCQYMPVKKNQRGKKGSAKKNG
FT                   DGEQNEGSRQGAEDSESVESRGTKRKGEAEDREGKKRRTDE"
FT   gene            complement(141965..143609)
FT                   /locus_tag="CNA00490"
FT   mRNA            complement(join(141965..142495,142549..142749,
FT                   142818..143189,143263..143346,143395..143400,
FT                   143462..143609))
FT                   /locus_tag="CNA00490"
FT                   /product="chaperone regulator, putative"
FT   CDS_pept        complement(join(142052..142495,142549..142749,
FT                   142818..143189,143263..143346,143395..143400,
FT                   143462..143566))
FT                   /codon_start=1
FT                   /locus_tag="CNA00490"
FT                   /product="chaperone regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40658"
FT                   /db_xref="GOA:Q5KQ46"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ46"
FT                   /protein_id="AAW40658.2"
FT                   /translation="MVADTTYYDLLEVAVDATETEIKKAYKKKAMQHHPDKPQNPDDPN
FT                   SHETFQRIGQAYETLSNPNDRATYDQYGADGPPRGGMPSDMDMDDLFSAMFGGGFDDFG
FT                   GGMGGGFFDPSGGRGGGRRKPAKGRDTTVPYDITLEEAFKGKKVVMSIERDRVCGGCKG
FT                   SGARPGVAPKECSKCSGKGVVFTDRMLGPGLVGKVKSPCPECNGEGVKLRDKEKCKKCK
FT                   GQKVVKEKKRIEFMIDPGTEDGERIALRGEGDEAPDIPPGDVIFLIRHLPHPSFRAQPH
FT                   SPGSLTILLSIRLSEALLGFSRVLFIHLDGKGVHVTSKKGERIIQPGSVWVIKGEGLPI
FT                   RGKGKRGDMYVRFDVEFPTTDWAKGVEVDGGESTKVELPGRKPDLGLSPEQIVVRELSD
FT                   KPVN"
FT   gene            143821..145711
FT                   /locus_tag="CNA00510"
FT   mRNA            join(143821..143900,143954..144436,144493..145029,
FT                   145083..145209,145260..145402,145471..145711)
FT                   /locus_tag="CNA00510"
FT                   /product="citrate synthase, putative"
FT   CDS_pept        join(143862..143900,143954..144436,144493..145029,
FT                   145083..145209,145260..145402,145471..145536)
FT                   /codon_start=1
FT                   /locus_tag="CNA00510"
FT                   /product="citrate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40659"
FT                   /db_xref="GOA:Q5KQ45"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010109"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ45"
FT                   /protein_id="AAW40659.1"
FT                   /translation="MSFIASRNALRSQLRPSLARSFATTPAAYAQSLKDRMAELIPQEI
FT                   ENVKATRAAHGAKSLGDVTVDMAYGGMRGIKGLIWEGSVLDPNEGIRFRGLTIPECQQK
FT                   LPTAPGGSEPLPEALFWLLLTGEVPTDEQVKGLSQEWAARAAIPKFVEELIDRCPNTLH
FT                   PMTQFAIAVNALNHDSAFAKAYSNGVHKKEYWKTTFDDSMDLIAKLPNIAGRIFRNVFG
FT                   DGKLPPIDPSKDYSANLATLLGFGDNADFVELMRLYITIHSDHEGGNVSAHTGHLVGSA
FT                   LSDPFLAFGASLNGLAGPLHGLANQEVLRWVQKMRSQIGEDASDEKVAEYVWSTLKSGQ
FT                   VVPGYGHAVLRKTDPRYTAQREFALKHLPEDPLFKLVGQIYKIVPNILLEAGKAKNPWP
FT                   NVDAHSGVLLTYYGLHQQDFYTVLFGVSRAFGVVSQLIWDRALGMPLERPKSYSTEAIK
FT                   KMFEGK"
FT   gene            complement(143963..146366)
FT                   /pseudo
FT                   /locus_tag="CNA00500"
FT   gene            complement(146866..149723)
FT                   /locus_tag="CNA00520"
FT   mRNA            complement(join(146866..146985,147040..147099,
FT                   147163..147663,147716..148221,148274..149410,
FT                   149482..149723))
FT                   /locus_tag="CNA00520"
FT                   /product="peptide-binding protein, putative"
FT   CDS_pept        complement(join(146917..146985,147040..147099,
FT                   147163..147663,147716..148221,148274..149410,
FT                   149482..149689))
FT                   /codon_start=1
FT                   /locus_tag="CNA00520"
FT                   /product="peptide-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40660"
FT                   /db_xref="GOA:Q5KQ44"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ44"
FT                   /protein_id="AAW40660.2"
FT                   /translation="MSGVPPGPPPGRPPVANVPYIPQPGAPAAPPFRPPAAPGFGFPPG
FT                   PPPGMPFSVGGFPHPLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPPGTTPPT
FT                   GSPAPGAVTPGGTGAAEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKENKRS
FT                   EWTVPDEIKDAVAQLEEEERKKKEEKDKEEQEKIEQERIEKLKELERIRAEIDAERKKK
FT                   EEAEKERKRKQREDGEDDAPEEKKAKVGGQEQEEEDVVGPEGEEDEEAWMKAVAAEFAE
FT                   KDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNVSVEEGRALFKALLIEKDISPFAP
FT                   WDQSLPLFINDPRYVLLSSMKDRREVYEEYCREVGRAKRLKKGSAAEEKKAEPEKEYKA
FT                   LLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKAFKQHLRDLGERKRAAAQKAE
FT                   EDFNTLLKESTNITSSSQWSSVKRSISSDPRYDAVGSSSLREDLFNNYIRALSSTSNPA
FT                   KSNPEEQSIKEKEEAAARRLAERKAGQSAQPSESKEDAAARKLAERKAKSEASLREREA
FT                   KVREEKERVEREMHKSKMGAGREEAEALFRSLLVDSVKEPNVTLDEAQSYLSSDPRWNH
FT                   PSLSARDKQRLFAAHSERLFSKRSNALHSLFESKTPALNTSYDDVYPQIIDDPLVKRLG
FT                   LQGEALEDRWRSWRRKKEHDARIEFDQMLRENSFVEFWSKMRKKTMDEKALEVQEQDEY
FT                   DEGEGMGEGGAADLTQLAKQIDLGEIKAVLRRDKRYTVFDHMPDEREKWLRDYLENVEA
FT                   ASGSKTIHNVGLDR"
FT   gene            complement(150778..152846)
FT                   /locus_tag="CNA00530"
FT   mRNA            complement(join(150778..151034,151100..151892,
FT                   151946..152082,152155..152414,152486..152638,
FT                   152709..152846))
FT                   /locus_tag="CNA00530"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(150897..151034,151100..151892,
FT                   151946..152082,152155..152414,152486..152638,
FT                   152709..152820))
FT                   /codon_start=1
FT                   /locus_tag="CNA00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40661"
FT                   /db_xref="GOA:Q5KQ43"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="InterPro:IPR035267"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ43"
FT                   /protein_id="AAW40661.1"
FT                   /translation="MANQPEKLADAQNKDAGEKVQETEEKTVVEAVPTVEEEILNNIAL
FT                   IGRAVTTIEPRFTIRVLRTLTSLRKKLTKNALKTVLDDAFPKGSKTGQTLIASPIFSSL
FT                   PESAPAATEQQSDAMEIDSSIPAAEGTTAPTPKKKFVPPIYSATGDLLPEGIVYLRLLL
FT                   ILANLDAGRVVEAGDFAMETADLISSWNRRTMDQLAGKIWFYVARAYELQGRLAELQPQ
FT                   FMAIRQTAALRKDETLEVTVLNLLLRSYLANSQYEQAEKLVSKTQFHGAANQAQTVRWL
FT                   FYTGRLRAIQLNYAEARNYLQTAIRRAPKDEVAPGFVQLIHKYFIIVVLLTGVIPDRAL
FT                   FRKPVLKQALAPYFQIVQAVRIGDVAGFQKAFQTHEATFFADSTHFLISRLRHFVIKTA
FT                   LRTITLAYSRISLADVCIKLHLDSEEDTEYIVAKAIKDGVIDATIDPQGGWMQSKVAKD
FT                   LYETDEPAKQFQKRVQYCTQVYNESVRAMRYPPDAHRKELDSAAESRERDREIAQLIQE
FT                   SDEPDDMDDMGDL"
FT   gene            153018..154595
FT                   /locus_tag="CNA00540"
FT   mRNA            join(153018..153468,153610..153758,153929..154050,
FT                   154206..154595)
FT                   /locus_tag="CNA00540"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(153345..153468,153610..153758,153929..154050,
FT                   154206..154290)
FT                   /codon_start=1
FT                   /locus_tag="CNA00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40662"
FT                   /db_xref="GOA:Q5KQ42"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ42"
FT                   /protein_id="AAW40662.2"
FT                   /translation="MARTVTSPSRGGGRSSIGEGSRKTKNTARKSTGGKAPRHSGVQRN
FT                   PPPDPKSPAGPKKKHRFRPGTVALREIRHYQKSTDLLIAKLPFSRVVREVAMNVGSDEV
FT                   GEYRWQSSAIMALQEAAEAFLVHLFEDANLCAIHAKRVTIMQKDLQLARRIRGRY"
FT   gene            complement(154609..155802)
FT                   /locus_tag="CNA00550"
FT   mRNA            complement(join(154609..154829,154954..155099,
FT                   155201..155340,155435..155488,155575..155802))
FT                   /locus_tag="CNA00550"
FT                   /product="COPII-coated vesicle protein, putative"
FT   CDS_pept        complement(join(154705..154829,154954..155099,
FT                   155201..155340,155435..155488,155575..155694))
FT                   /codon_start=1
FT                   /locus_tag="CNA00550"
FT                   /product="COPII-coated vesicle protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40663"
FT                   /db_xref="GOA:Q5KQ41"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR015720"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ41"
FT                   /protein_id="AAW40663.1"
FT                   /translation="MLFRTLIPFLLALPLAFAHRIDIEAGEKECFYEVLAPQDRVTVTY
FT                   EVGGGGHLDIDFYVTDPQGKVIHTKNKQPQGSWSITTSQEGRFTFCFSNEMSSYTTKTL
FT                   SFNVHGQLYMGDDEQIAPVEQEVRDLSAGLQLVKDEQAYLVVRERVHRNTCESTNSRVK
FT                   WWSIAQIVILLGVCGWNIHYLKSWFEVKRVL"
FT   gene            156020..157681
FT                   /locus_tag="CNA00560"
FT   mRNA            join(156020..156050,156179..156230,156430..156524,
FT                   156663..156814,156893..157021,157115..157233,
FT                   157351..157681)
FT                   /locus_tag="CNA00560"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(156198..156230,156430..156524,156663..156814,
FT                   156893..157021,157115..157233,157351..157539)
FT                   /codon_start=1
FT                   /locus_tag="CNA00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40664"
FT                   /db_xref="GOA:Q5KQ40"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ40"
FT                   /protein_id="AAW40664.1"
FT                   /translation="MAEPTETVNTGEEHDPQFEPVIRLTEQVEAKTFEEDEEPLFKMRA
FT                   KLFRFHKDTTEWKERGTGDVRLLKHKQSGKVRLVMRRDKTLKVCANHILSPDMKLSPNV
FT                   GSDRSWVYNVAADYAEGEASAETLAIRFGNSENANLFKQAFEDAQAHNASLSGAAPKEE
FT                   DESAAVAKPEAAAESAAPEAEAKKEEASTLEESKPEEPATGAEAETKVADAPAATEIKE
FT                   EGIREADEAAAEKKDE"
FT   gene            complement(157802..162332)
FT                   /locus_tag="CNA00570"
FT   mRNA            complement(join(157802..159969,160021..161201,
FT                   161242..162069,162135..162332))
FT                   /locus_tag="CNA00570"
FT                   /product="DNA-binding protein cre-1, putative"
FT   CDS_pept        complement(join(158119..159969,160021..161201,
FT                   161242..162064))
FT                   /codon_start=1
FT                   /locus_tag="CNA00570"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40665"
FT                   /db_xref="GOA:Q5KQ39"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="InterPro:IPR032800"
FT                   /db_xref="InterPro:IPR040241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ39"
FT                   /protein_id="AAW40665.2"
FT                   /translation="MPLLLLLFLLIAGLYVQATPLQPTFSSCLFAHSPVAASENLLNVT
FT                   QVFATLVPGNEATELGLTGDGHDVLRLDLVGVTGAELAGYDNSTNKLATLFTDTHAATA
FT                   RVYSSTTWLCNSLFPAALPEPYYPYNTTYCPLPAGDFAINISIPLYRSYALTTLHTQVR
FT                   IVDTSLEAASLTCLNIHVSPYDDSGWYYLLFRYWLVALVAGFWLVSWGARFVTGWIVGS
FT                   GVAEYGQKELAGARLMAGGSNNREATMRKWGTMIISGLSGERLSVSGGLLRFVTPGVKD
FT                   ILFHIQYASMLGMIAVNWPEFSYPIFAQGAWGNLVWNTTLVQGSNPTSKRVSIYPDNYT
FT                   VPSQFSTQMTDPLYPLYLDADAFDPVLDLHNSPDGMESFATAVGLRPQDLFGTCLAIFL
FT                   CITAAVIFLSLLLWFLHGLSEYILTKEHKQNSPAAKRTTLGSSPRGSLGGKEALDPQTS
FT                   SSEGLGVLPTQSGFFSHKSSSPSLLRRIWLRFRPRGEAGAFHAAALYGNLIRLILVFHL
FT                   PVTIFSMYQLCLGGRASIVSRVFAAFSFAFISVLIPAYILYRVYNTPTGKLYDATRTLL
FT                   SIGPMYTVYVEKKQMFRVFSLTASLIAGIVVGAGQKSGIAQTIILIVVELAMLIIPGVW
FT                   YPWGEGASMGAPNAFLTALRLVSVVLAMLLSRTISMPGTAADWITYAILIIQAIIFVFF
FT                   LLMLLTKIIEGSIRLFGGVHFDESTHPLDGGIFAAIMDLDCLNPVRGGKAAERRRRKRD
FT                   SRQLHKNVYAAGTLSTQMMLDRHSQGVPRQTVSEGSTPMLYPVGYQPPLGPPPVDRRSS
FT                   DDRSDERPSGSGNIMDAWRPVSGPGYVPPGAYAPTVTSPTSPPPGSLFDNVQSGPSRGF
FT                   SVVRGGRSNYQNPYDIQNLNAGSDTSTPIMTMPVPTIRVSQVGQRPMSPPHSRQKSSSA
FT                   IIELSTPPIQTVGLPRTTYPPSPSTSQGIRPNNEGMRPPVLAIPKRRSLNDLKNENDPS
FT                   PTSQYSESERQKKKGRRNAGWFHRNEARAQDSESEESDDEPGPSRRKARKAALLTSGMR
FT                   EPEPFEDISKFEQPSGWKKVLGIGKKGLDDLAAQERDENKARKAALATESGSLFAGVEA
FT                   PKPSPKKKGFVVTRRSGDRPGVTPISPASPESQAGTSFKVKRMGQPTPTPTRVESPAQP
FT                   ESAHASPISPMSPAPLAGLATGSVVGPGKKKSFQVIRPATKSSVASPTGNGGSTGFVVN
FT                   RRSPQSTPLENTSTPSPPPPEQGGYAPSLFVPINQPDESEGLAKDPRRSSESQQRYHAL
FT                   "
FT   gene            162682..163946
FT                   /locus_tag="CNA00580"
FT   mRNA            join(162682..162913,163016..163049,163292..163379,
FT                   163452..163466,163624..163870,163917..163946)
FT                   /locus_tag="CNA00580"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(162851..162913,163016..163049,163292..163379,
FT                   163452..163466,163624..163636)
FT                   /codon_start=1
FT                   /locus_tag="CNA00580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41412"
FT                   /db_xref="GOA:Q5KQ38"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ38"
FT                   /protein_id="AAW41412.2"
FT                   /translation="MSERLTEFAEIPRQFVKEGTLFVNRCTKPSAEEYKQLCRAVAIGF
FT                   GVMGVIGYLVKLIHIPINNILVGGA"
FT   gene            167188..171227
FT                   /locus_tag="CNA00590"
FT   mRNA            join(167188..167709,167790..167935,168803..169564,
FT                   169624..169783,169839..170559,170619..171227)
FT                   /locus_tag="CNA00590"
FT                   /product="specific RNA polymerase II transcription factor,
FT                   putative"
FT   CDS_pept        join(167864..167935,168803..169564,169624..169783,
FT                   169839..170559,170619..170718)
FT                   /codon_start=1
FT                   /locus_tag="CNA00590"
FT                   /product="specific RNA polymerase II transcription factor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41262"
FT                   /db_xref="GOA:Q5KQ37"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ37"
FT                   /protein_id="AAW41262.2"
FT                   /translation="MSSIHHQVSATYEGRTGEGRTDVSPYPQQQHYPTSAQPSFQPPPP
FT                   ISPPSSSPFAFAPPPLGTTLPPGGTSRPPLVSHHSDPPPVAQPISYSFMKQQQQLPPPA
FT                   PHHGSYPYVTSIPMSYRSYSGDSDRNSPQSLNGRAPAPSNPSTHSASISAQSSPLPSNF
FT                   QYQRQMLPGPYEAPVGQTLPDLNRSATYPQGYYNPGYASALSTEMPRSLSYPSGYSQPY
FT                   SYIPPLPSPTSFHPAIPGYSSLTRHHTLGTGPSYAFSSRQPVQDRPFKCDECLQSFNRN
FT                   HDLKRHKRIHLSVKPFGCEKCGKTFSRKDALRRHWLVKGCRGSEGATAPIVPLYPLSST
FT                   SSQPPALSPSTPTSLEQLKGNPITGSSSSSRSSTTLPPLSSLPQRQSADQSQIILTPRE
FT                   PSGLTLAQAAAPVAQISIKTVDPAVGNIDVGSGSGSAGSMGEGFAPEYFDSVVPVKSAS
FT                   GTSTDARSNVSPFSSTCTSPPESIQPQPYRKSTLTLASDGTGPSPSSSYNDTISFAPSS
FT                   LGAEGKPVFITPFTPTAQSFAMQQQGTNVSQTSSEAATMERQASSDKMPETWQRWHRPS
FT                   FPFPAPPGISFAFDPASPLEGTDPSYAQ"
FT   gene            171331..172762
FT                   /locus_tag="CNA00600"
FT   mRNA            171331..172762
FT                   /locus_tag="CNA00600"
FT                   /product="expressed protein"
FT   CDS_pept        171452..172408
FT                   /codon_start=1
FT                   /locus_tag="CNA00600"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ36"
FT                   /protein_id="AAW41261.2"
FT                   /translation="MSSSSSSSDSPSSHSSSDSPSFERSSIDISNLDTFLSSSITSPYI
FT                   QETYPPTDPSVVSAVSSVLKGSSFDISVPREVSAALSERSSAVEREVREIGSGKERDNG
FT                   ERVGKWMRERAKRLGEMVESWVSSGATFAPFSSDRSSGYFSGSHNDRLSTATSIPSPGT
FT                   CASTSSYISSTPRSTTATAATTATTTASVELSSASRRRLATTTAANLKSSPPTIDPSTV
FT                   RKIISYIRSANSNSNPPLNEEHWWTAYHALRSPSAFGTHGVPIPLSEKLARMRALRWED
FT                   VESDVGYERARAKMFLGDERLAGSHLEGWGGSTFGVA"
FT   gene            173968..176206
FT                   /locus_tag="CNA00610"
FT   mRNA            join(173968..174329,174575..175046,175098..176206)
FT                   /locus_tag="CNA00610"
FT                   /product="expressed protein"
FT   CDS_pept        join(174306..174329,174575..175046,175098..175933)
FT                   /codon_start=1
FT                   /locus_tag="CNA00610"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40666"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ35"
FT                   /protein_id="AAW40666.2"
FT                   /translation="MQSEVWTTSYSTEIFDMSAPPPVPARSRLRDAAPPKIDTSRDARD
FT                   ASSRLNAGNHNDNASTPATPSTPDLRVPTMPTSSSSPLSPYYRKASLQVDSVNPPTTPR
FT                   LNSPSTPSFTIGPSSLASPSSGPLSSFGRKRQSKVMEKDPRDPYKVKDGALKKKASSGI
FT                   YTPPTFPGPSGHHLPLPQQSTSTLYTPSHSHILDAPGQSAGLGLGPMSPSQSSSTRSSA
FT                   SDHSDSTAPPRTPISPTNRFGKTFSSNVRRLSSMAALSGMTSPSREREEEREREEQRMK
FT                   GRGSEGASIAGSGSWNWSDGRSRKGSAHSHSYSHTFSYYPSGTPSLESGSSCDPHSSLE
FT                   HYANPQPLVASPASVSALTPVPPPTPTPAHFYTPSSPSSPPSTASLGIHYSVEEEPGDG
FT                   VEGAENKVPRPSPRTKGRRKPVPRLLEDEDRNLVDRMDGLHVGL"
FT   gene            177738..179733
FT                   /locus_tag="CNA00620"
FT   mRNA            join(177738..177926,177988..178022,178079..178087,
FT                   178156..178178,178231..178271,178329..178410,
FT                   178464..178542,178604..178742,178801..179025,
FT                   179103..179362,179435..179733)
FT                   /locus_tag="CNA00620"
FT                   /product="disulfide-isomerase precursor, putative"
FT   CDS_pept        join(177828..177926,177988..178022,178079..178087,
FT                   178156..178178,178231..178271,178329..178410,
FT                   178464..178542,178604..178742,178801..179025,
FT                   179103..179362,179435..179678)
FT                   /codon_start=1
FT                   /locus_tag="CNA00620"
FT                   /product="disulfide-isomerase precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40667"
FT                   /db_xref="GOA:Q5KQ34"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR011679"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ34"
FT                   /protein_id="AAW40667.1"
FT                   /translation="MRLSISISAALLAFTSLVSASNVVDLDSTNFDQIVGQDKGALVEF
FT                   FAPWCGHCKNLAPTYERLADAFPTDKVVIAKTDADGVGRELGSRFGVSGFPTLKWFPAG
FT                   SLEPIPYSGARDLETLAAFVTKQSGVKSNIKPPPPPAYTELDASNFDEIALNESKNVLV
FT                   AFTAPWCGHCKNMKPAYEKVAKVFSSEPDVVIALMDADEAENKPVAQRYGVSSFPTIKF
FT                   FPKGSKEPVAYDSGRTAEQFVNWINEKSGTHRSVSGLLSETAGRVLTLDTLASEFFSAN
FT                   VPERSEIVKKAQEAVTTVDEKSKATANYYIKAMERITAKGEEWLTKEQARLANLLASPS
FT                   LAPTKLDELKVKINILSAFAAQKAGEAYDSAEEVLEDAWDSAKQIPIQAKDGLDQFADA
FT                   VEEKAKRVRSDL"
FT   gene            complement(179702..183177)
FT                   /locus_tag="CNA00630"
FT   mRNA            complement(join(179702..180418,180474..181102,
FT                   181155..181420,181480..182113,182166..182331,
FT                   182381..182615,182665..183177))
FT                   /locus_tag="CNA00630"
FT                   /product="nuclear mRNA splicing, via spliceosome-related
FT                   protein, putative"
FT   CDS_pept        complement(join(180147..180418,180474..181102,
FT                   181155..181420,181480..182113,182166..182331,
FT                   182381..182615,182665..183042))
FT                   /codon_start=1
FT                   /locus_tag="CNA00630"
FT                   /product="nuclear mRNA splicing, via spliceosome-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40668"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR013258"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ33"
FT                   /protein_id="AAW40668.2"
FT                   /translation="MNRAVQRSQLFNPAGQQTRSQYDPQNPGVQHRGPAGPAPQQQYQQ
FT                   YQQYQQPQQQGQPQQQQQQQQQQLSQQGPQSTNGTADGASGSGSTPGQEMNLASVLHYL
FT                   QSEWRRWERDRNEWEIERAEMRARIALLEGQRRSAENLKVDLLRRVKMLEFALRQERTK
FT                   RVGAGGKLNSVPPTRLAALQDEDRLSTGDKEGSGSEGSQEDILEKPTKVNGVHSAAVGK
FT                   SSTIMSRSQPAEANQWKSIGVAPRDPKARARSREYLKQCLQEISYLTSPGALNPLPPYP
FT                   PVDPSALPQPDVSHDPNHPEVDLYERPRKELSEEPVPPLHTRKRNDEAAETKETAGSTS
FT                   ASEDDQVNGEKDKPIPSIPTPALPPGSSSSFPTSQPMEKSVSPSPLAFHRPGLDPALLP
FT                   PSDNSGPPSSPSPRTVSLPDISATKSEDEPRSPGAGKDSDEPGKQLLTAIYRPDSKTAW
FT                   REELKAANEEAEKAKEERARKVPDQAEDDRLTTLSLNTEEEEIKADDSVDKIWVSKRSL
FT                   KSHLDIVRAIAFAHGPGIMLATGGDDCTVKVWSVDSASIISHRHTAQEIEPIMTLRGHT
FT                   AAITSVAISNALSIIFSASLDSTIRLWQLPAHNHDPYATYNPSVAVQTLEGHTESVWDI
FT                   CLLPPQEVSPAGKEGIEGRLVSASSDGSVKLWERSGSSPSASNWKLEKSFSSFGEGVIP
FT                   TCLAVFNLDFGKVLVGTSDGKARLWDVDAGEEVRLFGEEGQGVDSQVNAILSHPTLPAI
FT                   VTAHEDGYLRFYDAKSSSTTPTHTVLAHPAPITSLALSPSSPTCILTSSVDCTVRLWDL
FT                   TKKTSIQELAGHRGRADEGVCAVASHPELPVIGSAGADGVVRLWGLA"
FT   gene            183964..186752
FT                   /locus_tag="CNA00640"
FT   mRNA            join(183964..184487,184543..184609,184666..184744,
FT                   184804..184821,184876..184948,185009..185175,
FT                   185226..185357,185413..185601,185663..185740,
FT                   185804..185810,185879..185889,185950..186051,
FT                   186113..186178,186235..186274,186333..186396,
FT                   186452..186752)
FT                   /locus_tag="CNA00640"
FT                   /product="integral to plasma membrane protein, putative"
FT   CDS_pept        join(184054..184487,184543..184609,184666..184744,
FT                   184804..184821,184876..184948,185009..185175,
FT                   185226..185357,185413..185601,185663..185740,
FT                   185804..185810,185879..185889,185950..186051,
FT                   186113..186178,186235..186274,186333..186396,
FT                   186452..186580)
FT                   /codon_start=1
FT                   /locus_tag="CNA00640"
FT                   /product="integral to plasma membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41263"
FT                   /db_xref="GOA:P0CM92"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM92"
FT                   /protein_id="AAW41263.1"
FT                   /translation="MSAQEFYQGGNQRGYQQQQFPPPPGGPPQDQNGGKQEYVPPQGQP
FT                   PNYNMKPSQPYASTNPETGGQPVYQDTAPFSQANEKTGERMNPRKRVNDIIPLILFIAA
FT                   VVGFAVVSGIAIHGFVQVNGLGGGMGDSSIGRTGSSITLDYHTVYLLLVVVALGLVIAS
FT                   LYLAALRAFTKIILEVTLALTVILNIGICIYYFIIQYWSGAIIFLIIALVSVFFYWGMR
FT                   KRIPLAKLLLQTTIDVTKHHPSVYVVVFIGLIIQAAVSVWYTFTCIAIYVKWTPGSAAC
FT                   SDGGCSSSKVAGLVFYATFSYLWLSQVIGNVILCTLAGGVFGGWYYYGPRTPGGGVPKR
FT                   ASLLAFVRASTLSLGSIAFGSLLVTILELLRLILQLFRQYEAGQGDMIGSILICIAQCC
FT                   IGCIQWMVEYFNKYAYIEIALYGKSYIPAAKDTWRLLKDRGIDALVNDSLVGTALMWGA
FT                   YINGFLCAVLGYFYLRFTHPAYNSDGQYSAPVILFSFLIGLNESFTVGSAIDAGVSTIF
FT                   VGLGEDPMVLAERSPGLFEMIRQVYPRVVQGVPH"
FT   gene            complement(186915..187690)
FT                   /locus_tag="CNA00650"
FT   mRNA            complement(join(186915..187221,187288..187442,
FT                   187528..187690))
FT                   /locus_tag="CNA00650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(186981..187221,187288..187442,
FT                   187528..187605))
FT                   /codon_start=1
FT                   /locus_tag="CNA00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40669"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ31"
FT                   /protein_id="AAW40669.1"
FT                   /translation="MSPQEQNNEPSQMTGQLNSASGLVQQAIGNVVPESMGASSWIQSG
FT                   HKLQKEGQNEVDAAKAQKAGAATVDSGIGKVKSVFGYVTGDQEKQTEGNTQAEKAQWDY
FT                   KQATSDSIAAIPIPSVEGAKGKLESVVGMAAEDPEKQKEGNVRAEKAAWKDGV"
FT   gene            187871..190324
FT                   /locus_tag="CNA00660"
FT   mRNA            join(187871..188270,188324..188402,188460..188466,
FT                   188527..188564,188618..188689,188746..188764,
FT                   188814..188957,189005..189045,189093..189254,
FT                   189314..189406,189462..189684,189738..190324)
FT                   /locus_tag="CNA00660"
FT                   /product="A/G-specific adenine DNA glycosylase, putative"
FT   CDS_pept        join(187960..188270,188324..188402,188460..188466,
FT                   188527..188564,188618..188689,188746..188764,
FT                   188814..188957,189005..189045,189093..189254,
FT                   189314..189406,189462..189684,189738..190270)
FT                   /codon_start=1
FT                   /locus_tag="CNA00660"
FT                   /product="A/G-specific adenine DNA glycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41264"
FT                   /db_xref="GOA:Q5KQ30"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ30"
FT                   /protein_id="AAW41264.2"
FT                   /translation="MRPDSSSPSIYSVSDSDSSDYAPSVSETKRSSIKRKRAAPASTKS
FT                   RTKTTIVKQARGKGKAVDNIEDIENLGATVSRRHGMDYHSVDKIVDEKESLLEWFECVR
FT                   EKRGMPWRKKYDPSLSFEEKGQRAYEIWVSEVMLQQTQVTTVIAYWQRWMERWPTISDL
FT                   AKADVEEVNAAWRGLGYYRRARSLLAGAKTVMGNSKYNGRLPDDPAVLEKEIDGVGRYT
FT                   AGAICSMAYGVRTPIVDGNIHRLLTRLLAVHAPQTGPATIKFLWRVADELIKHLPSGDK
FT                   HNNVVGDWNQALMELGSQVCKPANPECGVCPLKKACKGYAELSNSPSQPSTTKSDCKLC
FT                   APIPCDIETDRIPTVMVFPMKKEKKASRVEEETVCIVQWRGDGDQRRWLFTKRPEKGLL
FT                   AGLFEPPTTPVSAGLSSSERLGASLEALSDYIEITEGEAEGLQKSSRDVGNIPHIFSHI
FT                   NMTYHIHLLTLTSPGNEPPSVKPKAPRPAVWLNEEEVEKANVGTGVKKVWAEIYGSWGS
FT                   FEESEAGAILAKKQKRTNNKLTKPKPVVANRNEKIVKKVMMPPMPTTRKNVVDAVE"
FT   gene            191738..194834
FT                   /locus_tag="CNA00670"
FT   mRNA            join(191738..191846,191923..192315,192364..192449,
FT                   192499..192812,192872..194834)
FT                   /locus_tag="CNA00670"
FT                   /product="sulfate transporter, putative"
FT   CDS_pept        join(192013..192315,192364..192449,192499..192812,
FT                   192872..194676)
FT                   /codon_start=1
FT                   /locus_tag="CNA00670"
FT                   /product="sulfate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40671"
FT                   /db_xref="GOA:Q5KQ29"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ29"
FT                   /protein_id="AAW40671.1"
FT                   /translation="MGLIKSSLGNSNKGKFVDCSTPPLHNSSFIRIQEDSSSTAAARTS
FT                   TQEDLHASMSPDIKPSFRPEVVKSKIKHYFGYTETTPETVSVFDWARSQTPALGPGIKA
FT                   YILSLFPFIQWVPRYNLTWLFGDLVAGITVGMVLVPQSLSYAKIAELEPQYGLYSSFIG
FT                   VLTYAFFATSKDVSIGPVAVMSLETGNIILSVQDKYGDLYSKPVIATALAFICGFIVLG
FT                   IGLLRIGWLVEFIPQPAVSGFMTGSALNIAAGQFPAVFGLSKKFDTRAATYKVIINTLK
FT                   YLPQASLDTAFGMTALAALYGIKWGFTWLGKRYPRYGRITFFCQSLRHAFVIIIWTIIS
FT                   WRVNVHAASPRISLVGNVPSGLQHVGRPFIDSQLLSAIGPHIPVATIILLLEHISIAKS
FT                   FGRLNGYKINPNQELIAIGVNNTIGTLFSAYPSTGSFSRSALKSKAGVRTPAAGLATGV
FT                   VVIVALYAVAPAFYWIPNAALSALIIHAVADLVASPKHSYSFWRVAPIEYVIFVGAVLW
FT                   SVFYTIESGIYWSLATSVVLLLLRIARPKGHFLGRVRIKPEAGNTLEHIRDVYVPLDEE
FT                   SSGEDVKVENPPAGVIIYRFEESFLYPNASYINDRLIEQAKKVTRRGGDYSKVAAGDRP
FT                   WNDPGPSKKNAAAVIEADMVKPVLKAVILDFAAVANLDTTGVQNLIDTKTEMEKWADGP
FT                   VEFHFCGILSPWIRRALVAGGFGQGRAKEGAALEVAPAVIENLENAASPGMERERYNEH
FT                   EVSFIHEVGQASNSTSAGTSFSEEEKRIGSGATTPSPQLDGVNERRPSGVSTKTVPLLD
FT                   RSTPFFHFDLADALNSLNLPENE"
FT   gene            195300..199896
FT                   /locus_tag="CNA00680"
FT   mRNA            join(195300..195827,195886..197009,197055..197130,
FT                   197178..197526,197577..197669,197731..197869,
FT                   197920..198018,198069..198201,198252..198451,
FT                   198501..198825,198880..199043,199094..199564,
FT                   199621..199896)
FT                   /locus_tag="CNA00680"
FT                   /product="vacuole protein, putative"
FT   CDS_pept        join(195523..195827,195886..197009,197055..197130,
FT                   197178..197526,197577..197669,197731..197869,
FT                   197920..198018,198069..198201,198252..198451,
FT                   198501..198825,198880..199043,199094..199564,
FT                   199621..199676)
FT                   /codon_start=1
FT                   /locus_tag="CNA00680"
FT                   /product="vacuole protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40673"
FT                   /db_xref="GOA:Q5KQ28"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ28"
FT                   /protein_id="AAW40673.1"
FT                   /translation="MPARDPNASPHVPSTFPNRPVSPINSQHPNTLSPNASGFSVRTVQ
FT                   SNNGVLSLPSPDHQQPHGYFTQALRRVSGTGGHNLPRMEAPASAGQDVPAERNGWDDTS
FT                   FHIQAGSTTSQAIRDSTARLASVSFSTRPRAFSSASQGDSSYSHSALSSRHASVNHGPT
FT                   HSVATSATEHRPIYPSHLNPAISKPGPTPVLEDDERDEVSPSKGLQALPASPFTGAKSG
FT                   LSMMLERDKEERRVRGLTEAASLRSKRSGSSIGKLASDEEESGERTPMPRRSSLVDDIL
FT                   EVPTTEGNARMSHAGSSSSLRRFLANEVNEEELGQAPDERSLLLGDGRERKKRSWAGEA
FT                   LSNIEGWKNNLLKVTPKDVVEGIILEPIRTLPSVILGLLLNVLDGVSYGMILFPATPIF
FT                   VDFGSLGVSMFFVSCIVSQLVFSLGGSIFPGGNGSMMIEAVPFFHILINTFEQVCGDDD
FT                   KAIIATTMVAFAFSSILTGLVFFALGAFKLGSLIGYFPRHILVGCIGGVGVFLIETGLE
FT                   VSRGLKEEGFEYNLATLKLFFESGHAIALWTIPLALAILLRVITHFWHHQLIFPAYFFI
FT                   IPVIFYIVIAIGRWDLQHLRKMGWVFDVGTNTQAWWKFYTLFDFRKTNWEAFWAAMPTQ
FT                   LALVFFGILHVPLNVPALGVSLSEDNVKLDRELVAHGASNMLAGLTGTVPNYLTYVNTV
FT                   LFYRVGGGSRLSGLMLAMGTAAIMMIGPAVIASLPVMVVGALIFVLGIDLLMEAVWDTR
FT                   HRVNKMEYITIWAIAIGMTVFDFVIGLLFGIILACIFFVVQSSRRRAIRAVFNGATARS
FT                   TVRRPKWQRSFIQQVGSQTYVMKLQGFLFFGTITTVEDEIRKLLDLAKWQHNPIRFLII
FT                   DFALVHGLDFSSAEAFVRVQRLLAAKDVLLIMCGAKSDGLVGTALQGVGLWADREGTRV
FT                   EVFESLNDALEWTENVYLTAFLENQQLMDCETTTKVMDFPKIAKPPFSLSESFQNSPRR
FT                   SHLVKAGGDTIFQTSYASKDDDEPSTPPPEEPLAQPIPVLLQTFGAYSASSVSSISTSF
FT                   CKSLAPYFTKSSIMPGDTLWMQGDPADGMYIIEVGCLRATYAYNDTTNLVQETMVAGTM
FT                   AGDMSALSETTRNCSVVAERESVLWKLSQERLDQMVKEQPEVAQAFIKMVLKAVAEEQD
FT                   VLSSHLIAVLS"
FT   gene            202164..204336
FT                   /locus_tag="CNA00690"
FT   mRNA            join(202164..202733,202784..203853,203898..203941,
FT                   204084..204336)
FT                   /locus_tag="CNA00690"
FT                   /product="expressed protein"
FT   CDS_pept        join(202638..202733,202784..203446)
FT                   /codon_start=1
FT                   /locus_tag="CNA00690"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ27"
FT                   /protein_id="AAW40675.1"
FT                   /translation="MATVTATMDDLIASLSGNMHVSQEGYDLKALHEFLAQNLPLSFPS
FT                   PTAYAYPVAPRPPPLSRKPSSLPSYTHPSPTPTSLPLPYTQAPHPPVSYERPQSSQTPA
FT                   QRPALPRRASSFGTVPHSYAPAASNYQAPEPSYAAFESDAFAPFWQGAVEETGREDPWA
FT                   RIRGAPTGDFGFAAAQEQPQITDGGGKHEYQWGLQLGGCGQSQRKVMAAQSNEDVGMDM
FT                   DEDEDMEDNELVESMMECGDEDDTWRRDKW"
FT   gene            complement(204280..206381)
FT                   /locus_tag="CNA00700"
FT   mRNA            complement(join(204280..205180,205261..205911,
FT                   205972..206060,206109..206381))
FT                   /locus_tag="CNA00700"
FT                   /product="expressed protein"
FT   mRNA            complement(join(204280..205180,205239..205911,
FT                   205972..206060,206109..206381))
FT                   /locus_tag="CNA00700"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(204530..205180,205239..205911,
FT                   205972..206060,206109..206174))
FT                   /codon_start=1
FT                   /locus_tag="CNA00700"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40676"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ26"
FT                   /protein_id="AAW40676.2"
FT                   /translation="MSSASSASGGGLSALVQAYKNNSEAGAQAAVSQSSDQSFGSQTLS
FT                   QLDKSVRSAFEPGAALVQISFMRSCPDHLVYTNGHIEPVTDPMKRAWVFKNREAFLANR
FT                   VIHSLDDQSVLMSDEDYEAVRKLVSAAMVDTGEQASRVIQDYSKALESLEEARRRQLAT
FT                   SQDSKFALDLSKQPYSMRRQTKPSWPRDDASRAFCSWAWRQVHEEHSRVPGTTVSLSLE
FT                   NSDLDLAPFTTDNGRRLRSRLQESAKLYWNAREIEDECFNSSAMPLKYVHLQSHGYKED
FT                   DDSVRFQRTDHHLMHLWRSDVLLTSLATGRSLTADETWSLIPLSLYQDFIQHQSKSRTN
FT                   FNERKITRKKPTSFLALNDPEWRSWFQEMVTISHGKKRFLTMSELPTSGHESLFNAVRD
FT                   IRAGKGKRFIRSRYGEESEPLTIQKYLEDIDPLQRFMDVNKSLVSSSLTDDEVVSRLPP
FT                   KAYHRWKEISGANEGLSIKEMIRDSYKVERELRE"
FT   CDS_pept        complement(join(205096..205180,205261..205911,
FT                   205972..206060,206109..206174))
FT                   /codon_start=1
FT                   /locus_tag="CNA00700"
FT                   /product="expressed protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHU6"
FT                   /protein_id="ALO60289.1"
FT                   /translation="MSSASSASGGGLSALVQAYKNNSEAGAQAAVSQSSDQSFGSQTLS
FT                   QLDKSVRSAFEPGAALVQISFMRSCPDHLVYTNGHIEPVTDPMKRAWVFKNREAFLANR
FT                   VIHSLDDQSVLMSDEDYEAVRKLVSAAMVDTGEQASRVIQDYSKALESLEEARRRQLAT
FT                   SQDSKFALDLSKQPYSMRRQTKPSWPRDDASRAFCSWAWRQVHEEHSRVPGTTVSLSLE
FT                   NSDLDLAPFTTDNGRRLRSRLQESAKLYWNAREIEDECFNSSAMPLKDTRRTTILFVSN
FT                   GPITTLCIFGAAMCC"
FT   gene            complement(206616..210019)
FT                   /locus_tag="CNA00710"
FT   mRNA            complement(join(206616..206812,206874..207139,
FT                   207198..207835,207887..208965,209021..209107,
FT                   209156..209426,209482..209724,209779..209819,
FT                   209874..210019))
FT                   /locus_tag="CNA00710"
FT                   /product="pre-mRNA splicing factor prp1, putative"
FT   CDS_pept        complement(join(206669..206812,206874..207139,
FT                   207198..207835,207887..208965,209021..209107,
FT                   209156..209426,209482..209724,209779..209819,
FT                   209874..209933))
FT                   /codon_start=1
FT                   /locus_tag="CNA00710"
FT                   /product="pre-mRNA splicing factor prp1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40677"
FT                   /db_xref="GOA:Q5KQ25"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR010491"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR027108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ25"
FT                   /protein_id="AAW40677.2"
FT                   /translation="MSNVGTVKHIPKEVRYNFLNMAAPASYVAGLGRGASGFTTRSDIG
FT                   PARAGPSAEVVAEAQARRGEEEIPDPDAFQDPDDERNLFAGTVYEADDEEADRVWDSVD
FT                   ARMDARRKARRDAAEAKAAAEERARNPKLQTQFADLKRSLSSLNDADWDAIPEAGNLTG
FT                   KRRKANLRLEENQNGRSYNVSDTVIADAVKRNAMVGELDPAEAGIGIDGTETDLVSIGN
FT                   ARDRVLSLQLDQATRDASNGSSTSIDPKGYMTALNSQIVQTDAQIGDIKQARQLLQNLI
FT                   QSNPKHAPGWIAAASLEVHAKKMVAARKIIAEGCEKCPKNEDVWFHAAELNTPENAKVI
FT                   LGRAIQHVPQSVKIWLKAASLETDINAKKRVLRKALEFVPNSVGLWKETVNLEDDPEDA
FT                   RVLLTRAVEVIPNSVELWLTLARLETPENAKQVLNSARKRIPTSHEIWIAAGRLAEQSP
FT                   SAVAVKPEVKMEDEAEYEAEQRKKLAQQVNKLMAGAVNSLRKNQVILSREQWLQEAEKC
FT                   EQDGSPLTAQAIVKATIAQDVEEEDRRSVWIEDAERATKGGFYEVARACYAVTLEAFPN
FT                   TPSVWRKAAEFEKAHGTPDAVQEILAQGSQHCPHAEVLWLMAAKEKWVGGDIPGAQAIL
FT                   AEAFKQNEDSESIFLAAAKLAAETGEMEAAIQILEKAKAQADTERVWMKSAVLLRQLGK
FT                   LDEALSTLEVAIKKFASFDKLHMIRGQIYESRNEVALARNAYAQGCRSCPKSIPLWILS
FT                   ARLEEKAGVTIKARALLEKARLHNPKNDELWAESIKIEERTGSPQQAKSVLARAMQECP
FT                   ASPLLWSMAIFMETPQQRKGRSVDAIKKAGEHPAVILAVARNFWSERKIEKTRQWMANA
FT                   ITADEDWGDAWGYWLKFERQHGEKERQEAVVEKCIAASPRHGPVWQSVSKDLANVGKST
FT                   KEILELVADKLE"
FT   gene            210135..211342
FT                   /locus_tag="CNA00720"
FT   mRNA            join(210135..210250,210305..210652,210703..211342)
FT                   /locus_tag="CNA00720"
FT                   /product="nucleotide binding protein, putative"
FT   CDS_pept        join(210172..210250,210305..210652,210703..211271)
FT                   /codon_start=1
FT                   /locus_tag="CNA00720"
FT                   /product="nucleotide binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40670"
FT                   /db_xref="GOA:P0CO90"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028600"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO90"
FT                   /protein_id="AAW40670.1"
FT                   /translation="MADIIETPVSRRLSTVKNIIIVLSGKGGVGKSSSSVQLALSLLAQ
FT                   SPTNRVGLIDLDITGPSLPRMVGLDTPTATVHQSSAGWVPVYVDQGRRLGVMSIGFLLK
FT                   DRGDSVVWRGPKKDGMIRQFLSEVRWGDLDYLVIDTPPGTSDEHISLLTHLHPLFTPTM
FT                   SNATTPTSILISTPQTTALNDTLKSLSFTRKLSLPVMGLVENMAGYVCPCCGEISDTFG
FT                   KGGGEAMAHKEGVGFLGRVPIDTVLVSLLDAVSKGEVLGEGAVEHTSDEAAEGQTNGST
FT                   EHFPLLDKYLETTSSKVWKDITQKLVDKIEQHKSDIRARLESSSETLAIA"
FT   gene            complement(211382..214618)
FT                   /locus_tag="CNA00730"
FT   mRNA            complement(join(211382..211561,211613..214065,
FT                   214119..214618))
FT                   /locus_tag="CNA00730"
FT                   /product="plasma membrane protein, putative"
FT   CDS_pept        complement(join(211496..211561,211613..214065,
FT                   214119..214530))
FT                   /codon_start=1
FT                   /locus_tag="CNA00730"
FT                   /product="protein complex assembly-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40672"
FT                   /db_xref="GOA:Q5KQ23"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008672"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ23"
FT                   /protein_id="AAW40672.1"
FT                   /translation="MAASYRGSEEPSPEIPSTQFIPEANDADNLYEAVEIMDERGAPVD
FT                   GEYLIKWSGTDEYGRPWKPSWEKKSGCTDALIMEWKEKKRRHPTIVGKEGEKLKKLEKQ
FT                   ERAPKTKKRKRKSEITVKREPGVTPVKKSRTSVGKVAARSTASVDSPASTSKAGRKSRV
FT                   SLASISAGTLSESPAPVAGPSRSRSSVNDHEDVSEDSEGSTHATRRGGMTRFRSRESQI
FT                   EPNSPEVQRSRAPLLKSLSAKATSPPKSDQRPKKSVTTLSGPKSRESPSQSSLQRTVIP
FT                   SHLLSPNSRARNGDKSPLFLPNSSLESNDTVEPSHTIGSAVTSQIEAIERFSSPPFMRH
FT                   ELLARGQEEVRRLAEGGRSGVYRAGDSDDEELQVIAKPPNKGKGRANENIDDDEEVVEA
FT                   DNILSSPNFNLNEFPSSKRPASVARGPSPYGQHPAVVDLENAKKKVTLLEGELTYSEKA
FT                   RKKAEERPKDFIDPAELSKAKKDIERLKAELKDAQDARISAEDLLAHSGNDEATKISKL
FT                   REQINGLRERLMAVQAEKGDLEEKLKENPGSKELAEVQKELDEQLKEKKGLELEKESFK
FT                   LLLSSLNDDLDAVKKELQISNAQNAKLEKKVNDSDSAELVKLRKEIEDLRAKLGSVTME
FT                   KEELKHQLMNHPDTAELAKVREQVKDFNSVINQALFEKKKLEEYLANHPDTAALADARS
FT                   ELKSLSSQLEEAKQSLSSSDAEVELLRERIASAERSHKNLVEDNAFMRKQYDEASNRAV
FT                   AEVQQANLLRDQIKHLTGQLKFGLKQREIFNATVAAQRNDETRKLRAQVKVLLDQSRRT
FT                   DDDIRHKAQFYKKYKAEYDNIVRTASEQSDKIERLEERVETLVDKLETLRAVKMGAFDV
FT                   DESEHEEGNRRKTVSPIRFHTPDEGPTAARLPFPDTSADGNVFNVPVQQEAQANGPVIK
FT                   EGGEGYVCKWRVGDETCQVVCDTVEEIHTHAIAHQRAELEAKGIII"
FT   gene            215405..218722
FT                   /locus_tag="CNA00740"
FT   mRNA            join(215405..215726,215824..215898,215951..216083,
FT                   216134..216553,216785..216966,217019..217258,
FT                   217308..217365,217417..218722)
FT                   /locus_tag="CNA00740"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(215432..215726,215824..215898,215951..216083,
FT                   216134..216553,216785..216966,217019..217258,
FT                   217308..217365,217417..218590)
FT                   /codon_start=1
FT                   /locus_tag="CNA00740"
FT                   /product="glutamine-tRNA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40674"
FT                   /db_xref="GOA:Q5KQ22"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR007638"
FT                   /db_xref="InterPro:IPR007639"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR042558"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ22"
FT                   /protein_id="AAW40674.1"
FT                   /translation="MPPKFDPNSPENAPLIQLFQSLGLASNSATELVRQPKSGKAFKSL
FT                   IDEYGLTNNKYDEKQAGALVKLSSVSAKLGSEQKDFLVQKIVKGDVKTPDQVTAAVKFA
FT                   EKNPDLKANEEAFDKECGVGINITLADLPELLKSYITSLPSPPEGWNSLGPILGGIKGG
FT                   ASDLRWANATEVKSTLESIFVSLFGTKEAAAAAAAAKPKAKAPKAAEKPVKPVSTTAAV
FT                   ATKSSSATPAIPTNIFEEGFLSEFHKVGENPQSDPKLKEEHLAWTKGQVYTRFPPEPNG
FT                   YLHIGHVKAIMVDFGYAKYHGGRTYLRYDDTNPEAEEGRYFQSILETVRWLGFEPWKIT
FT                   YSSDNFDRLYELAVELIRRGKGYVCTCDAEKIKEDRGMGKGNPIPCVHRDRPIEESLHE
FT                   FERMKNGEYKEKEACMRMKMDLNSGNPYMWDTVAYRVKKAPHHRTGDKWKIYPTYDFTH
FT                   CLCDSIENITHSLCTIEFIPARESYEWLCDALSVYKARQYEFARLNLQGTFLSKRKIAK
FT                   LVQNGHVKDWDDPRLYTIIALRRRGIPPGALLSFVSELGVTNIPSTTEIQKFESCVRGY
FT                   LESSAPRLMMVLNPIKIIIDNVPDDYRVQVEVPLHPKIPAMGTVQTIFTKEVYIDADDF
FT                   REVDSPDYFRLAPGKSVGLFKAPYPVTCTSFTKDPVTGRVTEVHCTLAGEGFKKPKAYI
FT                   QWVNAPEAVKIDEVRYFKKLFKSDPPPADYEADVDPDSLEVYSNAVIEPAFYELAKKQI
FT                   SDARKDSEERTKKAVEQAAKPDTSSAPVEGSAAAQHKDEEPVATAEQLVGNENIRFQGM
FT                   RLAYFTLDRESKLGCLEKEDVKGRSEGDKIILNRIVSLKEDAGKSA"
FT   gene            complement(218705..219795)
FT                   /locus_tag="CNA00750"
FT   mRNA            complement(join(218705..218974,219023..219290,
FT                   219353..219427,219542..219641,219692..219697,
FT                   219751..219795))
FT                   /locus_tag="CNA00750"
FT                   /product="histone binding protein, putative"
FT   CDS_pept        complement(join(218800..218974,219023..219290,
FT                   219353..219427,219542..219641,219692..219697,
FT                   219751..219753))
FT                   /codon_start=1
FT                   /locus_tag="CNA00750"
FT                   /product="histone binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40678"
FT                   /db_xref="GOA:P0CM26"
FT                   /db_xref="InterPro:IPR006818"
FT                   /db_xref="InterPro:IPR036747"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM26"
FT                   /protein_id="AAW40678.2"
FT                   /translation="MSIVNIRNIELLNNPAKFDDPYNFRIKFEAIAPLVEDLDWRLIYV
FT                   GSASSEEFDQELDNCSVGPIPAGINAFDFSAPAPAHHLLPSVEPDEILGVTVIIITASY
FT                   REKEFVRVGYYVNTYYEDEELKENPPSVVQWDKLHRNVLIEKPKVTRFQNNWDSAPQLN
FT                   TFDGQQPAAELPPSGGNPELFNAPLPPPVQRATAAGGMDVDQPMA"
FT   gene            219997..222388
FT                   /locus_tag="CNA00760"
FT   mRNA            join(219997..220499,220550..221319,221375..221549,
FT                   221601..221818,221867..222388)
FT                   /locus_tag="CNA00760"
FT                   /product="tRNA (guanine-N2-)-methyltransferase, putative"
FT   CDS_pept        join(220020..220499,220550..221319,221375..221549,
FT                   221601..221818,221867..222290)
FT                   /codon_start=1
FT                   /locus_tag="CNA00760"
FT                   /product="tRNA (guanine-N2-)-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40680"
FT                   /db_xref="GOA:Q5KQ20"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ20"
FT                   /protein_id="AAW40680.2"
FT                   /translation="MPRPSFGSRQFIATATRISSRKMTTQPRYTVPLKEPHPDNHSLHT
FT                   ESTTTIFLPNEGAFLNPVQHYNRDMSVAVIRAWNEMRKEELEEKWRIRLERRGGKPRPK
FT                   KKKNKKATEGEAKAVTIDAEEEKAEKEGTMEVEGNALAEVKEGEEPVAGPSNGAGVSKF
FT                   RAPSINILEALAATGLRSIRYAKEIPNVKYVLANDLSPSACEAMRRNVEFNGVGMDYEA
FT                   PVKEEQEPKAEVVEMPRDEANEEIKEGGAVEHVEKKQEVQPEVKDEVGRRPGCRGRVKI
FT                   NEGDACAFMYNHRSAVGPSARVDVVDLDPYGTAAPFLDAAIGCISDGGLLAITCTDLAV
FT                   LAGQQYPEKCYSNYGGTNVHAEYTHEAALRLVMHSLASVAARYGRYITPLLSFSIDFYV
FT                   RLFVRIDTRPEQVKHLASQTGVVFTCQYCQTAVNQPFGKVISKETAKGKEMTAFKTVAG
FT                   PTAGNGSACEECGGTMHLGGPLWLGPLQDNEFAKRVIKEIESTEKEYKTYNRMLGMLTL
FT                   ASQELPHPWFFTANRIAKSVHAPSLPMNKILSALLNAGYKISRSHCSPGAVKTDAPRSF
FT                   IYDIMREEAKENPVRMDKIAEGSPARKILAKPITHTIDFTPHPDASLERQGKETFYQVN
FT                   PLPNWGPAPRAKSLGEKRKAEVDAENGEGDAVVGGEGVKRIKVVVEEEEMMNA"
FT   gene            complement(222721..225077)
FT                   /locus_tag="CNA00770"
FT   mRNA            complement(join(222721..224637,224694..225077))
FT                   /locus_tag="CNA00770"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(222853..224637,224694..224954))
FT                   /codon_start=1
FT                   /locus_tag="CNA00770"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40682"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ19"
FT                   /protein_id="AAW40682.1"
FT                   /translation="MALFPSTRSLIFPQFETYRLRSLDPSTDLSFSPLPQPGATQSRMG
FT                   YNQQHLSFKEVRSRIGWDHLSVSGRRGVYIDKVWGVVGFVIQDDLTPTFVKLADLPEPI
FT                   SISEQQSEFPSVLPLSSTQWAISTGNGSIYILQSSSPESENFTGEIIARYDLHVDGQSG
FT                   VEPAPFLLRAHHDLSDSDVRLLLTRSLHPNQGKVGYKSVQSTQFQLLEISLNPSVRNGV
FT                   DSQPGKLEVKWALQGKDLPVWCAWQEDGWLILGEEEFREKVDESGQEETEDEKSKRERE
FT                   EKIARLGLGASLPADESALVNDKKDESMEVDEARGNPYSWTQDAEYLHLTIPVPDSVSR
FT                   AVINIGFTSTNFSFTLSQTPSDLSPQLMELLSKPTRQLWTSIDVDASTWTFDSSKHIIE
FT                   VDLKKIDENTRWPSVFFPAEDDDDAYEEVPETLSASTLAAVRETFNTIKTRGPDEPEMM
FT                   HPAMPALLREEMDFDLDDGEDFGEGSGAYGELGGGNRVGRDVLVGYVEAGSGKASWSKS
FT                   TNSVLSVPINGSDGNSIIVKQAVDGLVFRPTTDLSKKPWTHISTNPALAFVISSKHDLR
FT                   FVRHLITSPTSHDPTSPSAFKKPKIDPEPVQSTVLAFDSGSSSAGQGNVYIYYPATSKT
FT                   NAQQGVLSISGGERGALLGVGCVKVDGKDVVVALCENELVVLKGVL"
FT   gene            complement(225482..227010)
FT                   /locus_tag="CNA00780"
FT   mRNA            complement(join(225482..225654,225714..225934,
FT                   225997..226007,226060..226163,226226..226293,
FT                   226348..226435,226495..226600,226695..226798,
FT                   226939..227010))
FT                   /locus_tag="CNA00780"
FT                   /product="prohibitin PHB1, putative"
FT   CDS_pept        complement(join(225566..225654,225714..225934,
FT                   225997..226007,226060..226163,226226..226293,
FT                   226348..226435,226495..226600,226695..226798,
FT                   226939..226972))
FT                   /codon_start=1
FT                   /locus_tag="CNA00780"
FT                   /product="prohibitin PHB1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40684"
FT                   /db_xref="GOA:Q5KQ18"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ18"
FT                   /protein_id="AAW40684.1"
FT                   /translation="MAAAQRISRLIVPLAIGATVVQSALYDVPGGYRAVLFDRFSGVRP
FT                   DATGEGTHFLIPWLQRAILYDVRIKPRNISTTTGSKDMQMVSLTLRVMSRPDIEHLSKI
FT                   YQSLGLDYDERVLPSIGNEVLKATVAQFDASELITNREIVSARIRDDLLNRAKEFNILL
FT                   EDVSITHMTFGKEFTSAVEQKQIAQQDAERAKFVVEKAEQERQASVIRAEGQAEAANTI
FT                   SKALSKAGDAFIQFKKIETSREIANTLSQNKNVSYVPAANGNMLLQVPSQQQ"
FT   gene            complement(227195..228676)
FT                   /locus_tag="CNA00790"
FT   mRNA            complement(join(227195..227516,227569..227781,
FT                   227835..227912,227973..228165,228243..228344,
FT                   228394..228676))
FT                   /locus_tag="CNA00790"
FT                   /product="exosome complex exonuclease rrp4, putative"
FT   CDS_pept        complement(join(227301..227516,227569..227781,
FT                   227835..227912,227973..228165,228243..228344,
FT                   228394..228587))
FT                   /codon_start=1
FT                   /locus_tag="CNA00790"
FT                   /product="exosome complex exonuclease rrp4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40686"
FT                   /db_xref="GOA:Q5KQ17"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR025721"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ17"
FT                   /protein_id="AAW40686.1"
FT                   /translation="MFSVKAVAPSISQAFTEIVPSTHRKHQAELDAMDLDEDEFGGAGP
FT                   SKRSIVSPGEVITSSKEYMRGHGTYVEESNVVSSVAGTIERVNKLISVRPLRSRYTPEV
FT                   GDLVIGRIVEVGAQRWRVDANGRQDAVLMLSSVNLPGGVQRRKIESDALKMREFLAEGD
FT                   LLVAEVQAFFGDGAMSLHTRSLKYGKLRNGFLLTVPPQLIRRLKSHFYHIPPPCGPTGV
FT                   DVILGLNGYVWVSNGTSQARREGGEGFDSEGVYSNQNDEIPPQGREAISLVANIIKALA
FT                   SEGVPLTETLIGESYAWAEKNVPSGSGPFDSETERKMLNEIVGLEFLEFA"
FT   gene            228857..231217
FT                   /locus_tag="CNA00800"
FT   mRNA            join(228857..228995,229057..229097,229167..229252,
FT                   229304..229419,229473..229567,229636..229649,
FT                   229701..229718,229779..229787,229839..230338,
FT                   230393..230836,230888..231217)
FT                   /locus_tag="CNA00800"
FT                   /product="expressed protein"
FT   CDS_pept        join(228949..228995,229057..229097,229167..229252,
FT                   229304..229419,229473..229567,229636..229649,
FT                   229701..229718,229779..229787,229839..230338,
FT                   230393..230732)
FT                   /codon_start=1
FT                   /locus_tag="CNA00800"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40688"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ16"
FT                   /protein_id="AAW40688.1"
FT                   /translation="MAKEPRDLLLLVWVHGFKGNDVTFETFPGRICHLLRATHPSLRVE
FT                   SRVFPMYQTRGELLAATLAFVDWLTELVVNLENDHGQGGGAGKAKVVLMGHSMGGLLCA
FT                   DTVRDIAANTREGDPMWPRVVGIIAFDTPYLGLHPHTFKHHLTQAASYFDQARSIASTI
FT                   GMVSPTSFGLGFGNSGKKTESTTSEAGFSKPQPSASTKGKKKETTTTVSDMSTSAEQQA
FT                   ATSKSFWSSLSSVPSPSSKTLYGLGAAALGAAALGTAYYRREDFITGWRWGYDHMTFVK
FT                   NLWDEDGSRKRLEAIDALVREQNVLYRNYYTHLPVEPPVHLVGRTFAILPPASHPLFPL
FT                   WRPATNSLAKDEVSAHMGMFNPKTNDGFYDLGLAVVKEIGERIESEGVGRKEGLEERMD
FT                   EDGEGVWRIEKDKDGKEIWVEA"
FT   gene            complement(231631..233980)
FT                   /pseudo
FT                   /locus_tag="CNA00810"
FT   gene            231837..234071
FT                   /locus_tag="CNA00820"
FT   mRNA            join(231837..232147,232205..232685,232740..232976,
FT                   233026..233352,233410..234071)
FT                   /locus_tag="CNA00820"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(232095..232147,232205..232685,232740..232976,
FT                   233026..233352,233410..233955)
FT                   /codon_start=1
FT                   /locus_tag="CNA00820"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ15"
FT                   /protein_id="AAW40690.1"
FT                   /translation="MSGITNKLENKVDKTFFSGGPGTTGREPFEDSTTSGTTGTHSSNT
FT                   TNPATSLHGGITHDENVRSGMGATGTPDRTTGSTGSYTGTGVGNENIPAPHSSSTGTNV
FT                   PGTHTGGGAPIGAQGTSFGQTGEQRGVGGVTAGGVTGSGNPTHAGYGSGATTGLDSSRH
FT                   GQGIGSGTDKHSSTGYGAHESSFAPPISSTTGSGAKVADYGTGSHTSSHHTGAAATGAA
FT                   AAGTGAAAYGHHENKHAGSGHTGSHSHDTSGNHGVGTTDSYGSGLPSALDNKQSVGAGA
FT                   RDSRDRTGHLEEGSALYERSTDQGPVTGGAANTDKFDTDKPRNTSGLTGHGTGKTHNYD
FT                   GTSSRTAPHSGTEDPYKQQSGGAAGIFATSDKDFTSNTDRLGKGAYHDDQGLFKDNTSG
FT                   PGGRSALTGREGNYEKNPISGVESAGQKHHTGATSGAGTGATGGAAYEAEKAENKLAGS
FT                   HSTTGAYDTPTSSHGIAGRDGTTATTGQSGYGTGDRTGTYNETGTTGTHSSSTGESGTA
FT                   IGGHDTDTGRTTEGTHEKKGIIEKIKEAIH"
FT   gene            234939..235789
FT                   /locus_tag="CNA00830"
FT   mRNA            join(234939..235089,235173..235302,235385..235789)
FT                   /locus_tag="CNA00830"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        join(235007..235089,235173..235302,235385..235525)
FT                   /codon_start=1
FT                   /locus_tag="CNA00830"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40691"
FT                   /db_xref="GOA:Q5KQ14"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ14"
FT                   /protein_id="AAW40691.1"
FT                   /translation="MSAPLGNAAAQQTTSKFQAFLNHPAGPKTIFFWAPIAKWGLVLAG
FT                   VKDLSRPAEKLSVSQNVALAATGFIWVRYSFVITPVNYSLAAVNFFVGSTGVAQLYRVW
FT                   DYRRKNPGAVSSA"
FT   gene            complement(235743..238683)
FT                   /locus_tag="CNA00840"
FT   mRNA            complement(join(235743..236085,236146..236297,
FT                   236350..236413,236474..236680,236739..236766,
FT                   236828..236920,236980..237210,237265..237581,
FT                   237645..238154,238232..238683))
FT                   /locus_tag="CNA00840"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(235852..236085,236146..236297,
FT                   236350..236413,236474..236680,236739..236766,
FT                   236828..236920,236980..237210,237265..237581,
FT                   237645..238154,238232..238630))
FT                   /codon_start=1
FT                   /locus_tag="CNA00840"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40692"
FT                   /db_xref="GOA:Q5KQ13"
FT                   /db_xref="InterPro:IPR021709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ13"
FT                   /protein_id="AAW40692.2"
FT                   /translation="MSNSPTAEPIPPAPPAAQQPVEAHEIPVPDAPSTTIPTAPLDNPE
FT                   AQTQAPTASIDPNKPSKESAPTALPTNPATHPEEQKEAIKEEHPQVIKREVEKTKAEER
FT                   DLKGEKPQGTVVAGLEDDRLWAMLRRFDVQITHVLHPARNLPAAEPDLRPSTLPNLPSH
FT                   TDVLRSNLERCIAAVGPSSLRGARELQRLMSWSPEERWRTGTYCVVYFTAWIFGYAVAA
FT                   IMIFLSILVCFPRTRRFLFPPVPPAPFTPPSATDPTNQKGDESLLGNIDGKTVHRTKAE
FT                   QAEEQAFEATSILKAFTTRLLFDGKKKGKEAGNSNVGEKEEEPESSSSEDEAAVETAPV
FT                   DGKPQGLESADIVIGGEKITPAEPLNDKEKKKLAQREAKRKRDEMVSKMTKLSEDGLGT
FT                   VADSIERFANALSPPGPYPDNFARFKIAGAFLIPPAFLLTFVPAWVFGRLATLGFGVGM
FT                   WGQPLIIKGINKFVEVVPNWQELLDMRNSILSRVPTDTQLTLHLLRVTEALGKPLPRPP
FT                   PPPLSGTPKEAIKDTTPAAVTADDDAEVLEAAQEGATAEVAAKTKHKTKSHITGVFKSA
FT                   GKHMAGFRGDVKVDGARKQIGDKVDKVLFRGNIKDDGNIDSYPAKLNGTSGHIIIDSRE
FT                   EGISMPTISFVPVSGTKAHFVRPVDDIVEIKKSHVSMPRMALGWASGADVEGLGLTIRF
FT                   KSGVQQAKEFAAGPDAPKDDGETMHFRRVGRREGLFTRLISIGRQRWEVL"
FT   gene            239200..240716
FT                   /locus_tag="CNA00850"
FT   mRNA            join(239200..239361,239419..239620,239674..239960,
FT                   240022..240337,240388..240716)
FT                   /locus_tag="CNA00850"
FT                   /product="expressed protein"
FT   CDS_pept        join(239289..239361,239419..239620,239674..239960,
FT                   240022..240337,240388..240589)
FT                   /codon_start=1
FT                   /locus_tag="CNA00850"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40693"
FT                   /db_xref="GOA:Q5KQ12"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ12"
FT                   /protein_id="AAW40693.1"
FT                   /translation="MVAPTYDALKLPAHVKTILVTGAGGFVGQQLVKLLLELHPTVKLI
FT                   TTDIVQPPSHGVTDTNRLKSVKADLGKQEEIDGLLKGETIGGVFALHGIMSGGAEANFP
FT                   LGYAVNVDSNLNLLKSMYNHSLSLPADAPRPLYVFVSSLAVYGGPKCKPTDYVVPKDTP
FT                   IIPGSSYGVQKTIVELYVYDYGRKGYLDTRSVRLPTVAIRPGAPSSAASSFISGLIREP
FT                   LQGMEAICPIAESIDDPALDNMPFWCSRTKTVVRNIAYAMCMPESNFKEGEGRSINIPG
FT                   IKISPRQIIDALIEHGGKDKFNLIKFQKDQAVINICKTWAGEYDNSDFLAMGFEADDPK
FT                   TGFALAVQDFKDELTASQK"
FT   gene            complement(240740..244567)
FT                   /locus_tag="CNA00860"
FT   mRNA            complement(join(240740..241497,241554..242114,
FT                   242173..242459,242544..242780,242835..244104,
FT                   244153..244567))
FT                   /locus_tag="CNA00860"
FT                   /product="ER to Golgi transport-related protein, putative"
FT   CDS_pept        complement(join(240740..241497,241554..242114,
FT                   242173..242459,242544..242780,242835..244104,
FT                   244153..244534))
FT                   /codon_start=1
FT                   /locus_tag="CNA00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40694"
FT                   /db_xref="GOA:Q5KQ11"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019414"
FT                   /db_xref="InterPro:IPR019451"
FT                   /db_xref="InterPro:IPR039600"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ11"
FT                   /protein_id="AAW40694.2"
FT                   /translation="MPRSPTPSGHQGSPTLKQILKAADILLKPPKALPSNPPELLPRLR
FT                   ACSKALPKEWRRIIPEWSEDDEMDHVGDNDGSDISEERKKKRRDELVFVVGKRCFAMAK
FT                   AMQSWLEKEFWPKEQRDGLEDKDFLLGTADLRLIRLMLSHTTFSYLLPLTVQYAESLPI
FT                   IPAETANALAQVLEATLKLLKVATPPAPDAGPSSRMPTSPTAITQSLLSSHLIPVFLST
FT                   LILAYTPSIPAEHYGLLRMAFLQALMSLTPGHAISSLVNVLKLLVQGRRENAKVNGWVR
FT                   EWPKYPEGIINGLLTAQVRRPGGVRGLMENVLGDTARTDDVTSIEGKRLDHIFNVLVRI
FT                   PRQVTPEIYYPWLLSELFSMIPLDESSSHHPVAYVNTACYCIQRLWRSNPSIGEWLKNK
FT                   LHSPWYPKSLFAPADGPAIEVTSWLAIQRSVQNIRLLLIHNPASPDFVEFLVGSILPPL
FT                   FSLHTFLFFSSQAPNPVLIRPVGSLDASRSRSLADDVSFILTSWGKTVEKDVGVIGLWS
FT                   LVDAGKGWKPDENGVVPEFFWERQGDGVRLMSGSQGIPDITPEIVFPSLNRDELDPDAI
FT                   AQRIRDQTEAMPDPTLLCKLIKDINRPDIACQVILRALHLWRIKSPMEKEPSVEAMLHL
FT                   QLTMKLMTHLGSELFTEPEQLLEWVELTLSGQADCLEDDLIDEEAEETNQKPLITEVGG
FT                   EKGKGKKDDDVPPDGNRGLIELACRLLAAEEVKKALSEKDLAILHPILAHLEVISELSP
FT                   SSSIRLATREAMLILLSIQASANSSAPTDSKKSSKEAFDKALELIKDKAVPVRAHGLNM
FT                   LKDLVYQPYYDSSLTPVILNTFMSSIEDDDSFVYLCALKGLNGMVDALGGEVFEKLMDS
FT                   YAGMAKELRRLNDADEVDKMLRLAEAVDQVIERTGDALGLYADKIIPVLMSIFPDTSLS
FT                   TAIRSSALSLLTTCAKVSYISLLPWSTDLTNSAIDLIQIESVAVSPFRPGAIQTVEGPP
FT                   QPSWKGDKKPRNVQLIEDEQPEQEDEEEERKVPDPWIEDTDPLAYDDSKHPALRRAAIA
FT                   FLNWVFSVITFKIMSDHSECTGLEAGEILYKEHPAPDTDADLQEGGIPPGLLERAETVL
FT                   GYVKSTDEDEVARGHAESAERMLGMLKASIMIRSGGAVEGSGLEDLSESLEKLKVDV"
FT   gene            244888..246685
FT                   /locus_tag="CNA00870"
FT   mRNA            join(244888..245713,245776..246685)
FT                   /locus_tag="CNA00870"
FT                   /product="expressed protein"
FT   CDS_pept        join(244949..245713,245776..246576)
FT                   /codon_start=1
FT                   /locus_tag="CNA00870"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40695"
FT                   /db_xref="GOA:Q5KQ10"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ10"
FT                   /protein_id="AAW40695.1"
FT                   /translation="MPHRPSPKPPSSLPSPSRPQESQIEVLYNTAVQSFVRRDHVKTQA
FT                   TLARLLESLKKKRIGPYRTWYKLDGAKPDNENSEAAANDDWMVKTLKLLISSTASLYAD
FT                   PPNNTTALPELLVSMLPPKSPKEILSYLQHRCMSAYYSKGATAHLLPPQLVSTLILASL
FT                   KLSPQRSALDFAHSMTESWIASLPDSLILSISPTSSYRPKDPIERKRVESAREGYLKVV
FT                   ELFIGEVLSREEEWEMARGFLEGEVVMSSKKKETLYKHLRTLESKASLPSLAPSPSSSL
FT                   ILPSSSDSLSIEEEKESKIRSRLSRSSSTSSSSSSSSEATARPGTSQNGGLLGTGLALG
FT                   QRMEQLRQIRKAGKDRGEESPRPGSIASQASGSGISESTYRLVHSNFRRNSSSRRGNDV
FT                   PTSRPDNLHHILQSLLGRLPTSLSTTLQSLSPVVLTVITIPLPLLIIFTIIRLRRSRFA
FT                   RQQTTVVGGARGGSRNTVLQVQHRLQRVRTQQRGWWDWVLWYLRWWLAKFAGVWKLGTT
FT                   ITYV"
FT   gene            complement(246684..249421)
FT                   /locus_tag="CNA00880"
FT   mRNA            complement(join(246684..247028,247100..247436,
FT                   247497..247587,247644..247804,247861..248067,
FT                   248116..248226,248277..248669,248733..248791,
FT                   249152..249421))
FT                   /locus_tag="CNA00880"
FT                   /product="ITR1, putative"
FT   CDS_pept        complement(join(246911..247028,247100..247436,
FT                   247497..247587,247644..247804,247861..248067,
FT                   248116..248226,248277..248669,248733..248791,
FT                   249152..249378))
FT                   /codon_start=1
FT                   /locus_tag="CNA00880"
FT                   /product="ITR1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40696"
FT                   /db_xref="GOA:Q5KQ09"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ09"
FT                   /protein_id="AAW40696.1"
FT                   /translation="MSAGPAQPNIYAPIRTSHSGYPSPTHSGSSTPASLEFSDGRLPES
FT                   NVERDMSKVAERVALLGEVDDGAVIVEGEDKITKFVWTLVLAAAISGLLFGYDTAAISG
FT                   MLVIIKDDLGTILSSWQKEAITSATTLGALLGGLAAGCISDFTGRRLVIVFANVAFIGG
FT                   SICQAACHTVAVMIAGRFIVGLGVGLASCIVPLYIGELAPTMIRGRLVTINCVAITLGQ
FT                   VVAYAIGASFQNAHNGWRWIVGLGAMPSFVQLASIGFLPESPRILLLRSDVAGARAITA
FT                   KIYPLAKVEQVDRKVEIMKAAVDQSIEYNANSTWFERLKSLVMVGTNRRALIIGCGLQA
FT                   AQQLCGFNTLMYYSATIFAMLGFKNATAVGLIVATVNVLFTLVALKIVDPVGRRRTMLF
FT                   TLPIMTLALVLAAIFFYYLTLSTNGILIEDHDYPRSLSIPVLLSMLLYVAGYATGLGNI
FT                   PWQQGELFRLEVRGIGTSICTAVNWSCNMLIASTFLSLMDAATPSGAFGIYAGFCVIGW
FT                   LFCWMLYPETSGLSLEEVYFVFEEGFGIEKSQQLRKQKLEESAKLKAIFE"
FT   gene            250461..251820
FT                   /locus_tag="CNA00890"
FT   mRNA            join(250461..250656,250706..250847,250898..250969,
FT                   251026..251443,251507..251820)
FT                   /locus_tag="CNA00890"
FT                   /product="palmitoyl-protein thioesterase, putative"
FT   CDS_pept        join(250535..250656,250706..250847,250898..250969,
FT                   251026..251443,251507..251739)
FT                   /codon_start=1
FT                   /locus_tag="CNA00890"
FT                   /product="palmitoyl-protein thioesterase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40697"
FT                   /db_xref="GOA:Q5KQ08"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR030294"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ08"
FT                   /protein_id="AAW40697.1"
FT                   /translation="MRLRFTFTLALLFSNWTLAAPASDQLVLSNSNAKPRPLVIWHGLG
FT                   DTALSTGIENFINMTQTIHPGIFVHSVQIPEGGRPDDERKAGFWGNAGEQGEEGCEQIK
FT                   RIPELAEGFDGIGFSQGGLLLRHYIQYCNGPPVHNLITFGTPHYGISALIPCPTPPTLS
FT                   CLLAARAARAGIYRPWAQDHLVQAAYFRDTERLDEFYEVNEFLRDLNGERPFAERNSIE
FT                   EINRRKGKRGEGKGLKGLDNLVAIIFDEDRTVSPAQSSHFATYAPNNKTEIIPLHEQPL
FT                   YKEDWIGLKGLDEKGGLRLEHCPGEHMDLGGKRGCGESMVRKWVGWV"
FT   gene            complement(251782..254743)
FT                   /locus_tag="CNA00900"
FT   mRNA            complement(join(251782..252541,252599..252900,
FT                   252968..253136,253187..254280,254336..254558,
FT                   254612..254743))
FT                   /locus_tag="CNA00900"
FT                   /product="ATP dependent DNA helicase, putative"
FT   CDS_pept        complement(join(251858..252541,252599..252900,
FT                   252968..253136,253187..254280,254336..254558,
FT                   254612..254710))
FT                   /codon_start=1
FT                   /locus_tag="CNA00900"
FT                   /product="ATP dependent DNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40698"
FT                   /db_xref="GOA:Q5KQ07"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008046"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ07"
FT                   /protein_id="AAW40698.2"
FT                   /translation="MADQQLSQGNLPVFIDDLIADRTRQFVEFLDDETQAAYNYRESIK
FT                   RMLDDEQVRLIVDINHIRSYERSYADGLLLQPMEYVPALDAALMQLVQSLHNPTKHKIE
FT                   DKQFYVGLIGSFGQQHCNPRTLRSHQIGKMVSLEGIVTRCSLVRPKMLRSVHWSPRTQK
FT                   FHARTYNDSTIIAPSANLTGTTTVIPKDDGDGHPLLMEYGLSTFRDYQTIGIQEMPERA
FT                   PAGQLPRSIEVVLADDLVDCCKPGDRIQLVGVYKSSGGGAGARGFITSIIANNIILLSS
FT                   KQGGGIAQTPLTDTDIRNINTQARRKNVFQLLSQSLAPSIFGHDYIKKAVLLLLLGGEE
FT                   KNLDNGGHIRGDINILMVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGLTAAVTTD
FT                   KDTGERRLEAGAMVLADRGVVCIDEFDKMSEIDRVAIHEVMEQQTVTIAKAGIHTSLNA
FT                   RCSVVAAANPIYGQYDVHKDPHRNIALPDSLLSRFDLLFVVTDDTDEQRDRMISEHVLR
FT                   MHRYIQPGAEEGAPPIENLEQNLDVGGDAVESRISETPVFEKFNPLLHSGVTTTSGRGA
FT                   NKKKEVLSIAFVKKYIQYAKSRIHPVLTKGAADWIVNVYSSLRNDDMAANQKRTSPLTA
FT                   RTLETLIRLSTAHAKSRLSTRVDERDAMAAEEILRFALFKEVVRPERRKRRKINHAGQS
FT                   VEVDSDEDEEGEEELQAGVERMSMNGDVGVTESQRERAREKNRRVERQAAGPVPEDDED
FT                   FEMREAEESLALQEAPRSPPTAPEVAVELSNERLDLFRSKLSHVFEESLDDNGAIEFVE
FT                   LMPKINEGMAEGEVFSVGEMKQALVRMDEKSEVMFGEDQTIYKI"
FT   gene            254915..257137
FT                   /locus_tag="CNA00910"
FT   mRNA            join(254915..254966,255015..255194,255241..255648,
FT                   255697..256006,256056..256787,256839..256900,
FT                   256964..257137)
FT                   /locus_tag="CNA00910"
FT                   /product="chaperone, putative"
FT   CDS_pept        join(254958..254966,255015..255194,255241..255648,
FT                   255697..256006,256056..256787,256839..256900,
FT                   256964..257017)
FT                   /codon_start=1
FT                   /locus_tag="CNA00910"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40699"
FT                   /db_xref="GOA:Q5KQ06"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ06"
FT                   /protein_id="AAW40699.1"
FT                   /translation="MSDAVALKAEANKAFAAKDYTTAAKLYSDAIALDPSNHVLYSNRS
FT                   ATKAGLKDYEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAEPN
FT                   NAACVKGLSEVKRAMDTDSSSPFAPGGDMGLGKIFSDPSMISKLENHPKTSALMKDATF
FT                   RANMLQLQASGGRNMSTLMGDPRTLTALGVLMGIDIDAMERPEGSNEYPPSSSSAPEPT
FT                   PAPAPKAEEPKKQPAPVPEPEAEPMEVEEDEEAKAKKEAEEFKAQGNTSYKARKFDEAI
FT                   EFYSKAWDLYPKDVTFLTNLSAVYFEQGEYQKCIETCEKAVEEGRDLRADYKVFAKAYG
FT                   RIGSSYSKLGDLAQAIKFFQKSLTEHRTPDILTKLREAEKAKAEADRQAYIDPEKAEKA
FT                   REEGNEAFKKGDFAGAQKHYSEAIKRLPTDPRAYNNRAACYTKLLALPEALKDAETAIS
FT                   IDPTFIKAYIRKALVQEGMKEYTAALETLQKATEADVEKKHTRELETNMMKVMNEIQQQ
FT                   RSSETEEETYARAMRDPEVAEIMNDPIMRQILSDAQQNPRALNDHMKNPMIAQKIQKLI
FT                   NAGIIRTR"
FT   gene            complement(257479..258572)
FT                   /locus_tag="CNA00920"
FT   mRNA            complement(join(257479..258163,258210..258344,
FT                   258397..258422,258467..258572))
FT                   /locus_tag="CNA00920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(257594..258163,258210..258344,
FT                   258397..258422,258467..258539))
FT                   /codon_start=1
FT                   /locus_tag="CNA00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40700"
FT                   /db_xref="GOA:Q5KQ05"
FT                   /db_xref="InterPro:IPR013862"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ05"
FT                   /protein_id="AAW40700.1"
FT                   /translation="MRINFSPQRAAIFTSFLGLLDIKLGAEIILLFGLINKVAGLYGLI
FT                   TIFVGGSFAQLLYYAYSVGTLFAFLWGLRVVKSESSAPTLLLSHLYALDHLIVSLFHYI
FT                   FYLHYWYTVPHDGRRTINSQAQQDLINLALSRGEISEPTDEGGQGADDLRMALAGEIWE
FT                   RERGFAVWTLVAGWILKIYFILVLYSYAAHLASSTYHTLPLTARGKATKLAHPDPGQGA
FT                   SSPRIPGESEDDIELRRAEQAARDGPSKKGKGKRTEGDDEDFSWE"
FT   gene            complement(258825..260533)
FT                   /locus_tag="CNA00930"
FT   mRNA            complement(join(258825..259241,259311..259716,
FT                   259793..259912,260002..260257,260314..260379,
FT                   260430..260533))
FT                   /locus_tag="CNA00930"
FT                   /product="pelota, putative"
FT   CDS_pept        complement(join(258881..259241,259311..259716,
FT                   259793..259912,260002..260257,260314..260379,
FT                   260430..260468))
FT                   /codon_start=1
FT                   /locus_tag="CNA00930"
FT                   /product="pelota, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40701"
FT                   /db_xref="GOA:Q5KQ04"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ04"
FT                   /protein_id="AAW40701.1"
FT                   /translation="MKLINKHIEKDGSGYVTLRPEDDEDMWHVYNLISEGDRVRAMAVR
FT                   RVQTVSSTGSSDSYRVRTNLTLEVTKTTFSPAASSSQGNGQGEKKEPTASLQISGKVVE
FT                   ENEFVKMGAYHTLDLEANRDFRLTKETGWDSVALERIQESTQEGRGAEVGAIVCGEGTA
FT                   ALCLLSEHMTVIRQRIDMPVPRKRKGGTSGHDKAVENFLSTVYQAILRLIPFQTLKAIV
FT                   IASPGFTRDALYEYIFQQATLQSNKPLLASRSKWIKVHSTTSHVHGLVEALKAPEVAKM
FT                   LAGAKFAKEGLGLDKFHKMLATDELRAWYGPEHVALAVDRGAVGTLLISDDLFRSSDPA
FT                   TRTHYVKMVESVRAVGGEVLIFSSMHESGQQLNMLTGIAAILTYPLDIEVVEMEEKEEK
FT                   ERIEREKAEKELAEES"
FT   gene            260668..261708
FT                   /locus_tag="CNA00940"
FT   mRNA            join(260668..260836,260902..260969,261095..261279,
FT                   261341..261708)
FT                   /locus_tag="CNA00940"
FT                   /product="expressed protein"
FT   CDS_pept        join(260704..260836,260902..260969,261095..261279,
FT                   261341..261647)
FT                   /codon_start=1
FT                   /locus_tag="CNA00940"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40702"
FT                   /db_xref="GOA:Q5KQ03"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ03"
FT                   /protein_id="AAW40702.1"
FT                   /translation="MSIPTTSTPTSGSSPTSSPINRWIPSNPFDLPETRELIAQKVAMG
FT                   EITDHDVAIMEKGYKWMIYTPPATAISFTFLIWQLMKKQYPRPRMITRLFWGGLSAGAG
FT                   GLLGFGAAGVAAAMEVEDKVEDVERKSRVFEEITEHSHALQESRLALSRPAPPLAVTSP
FT                   SLTPAMRQAANRGDSRLPRDFEFPNETEEERKERERRMLEGLKLGKERVEEETKGTLGW
FT                   VKGLFGSK"
FT   gene            262344..266298
FT                   /locus_tag="CNA00950"
FT   mRNA            join(262344..263122,263172..264376,264433..265446,
FT                   265514..265983,266051..266298)
FT                   /locus_tag="CNA00950"
FT                   /product="mRNA export factor elf1, putative"
FT   CDS_pept        join(262541..263122,263172..264376,264433..265446,
FT                   265514..265983,266051..266082)
FT                   /codon_start=1
FT                   /locus_tag="CNA00950"
FT                   /product="mRNA export factor elf1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40703"
FT                   /db_xref="GOA:Q5KQ02"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ02"
FT                   /protein_id="AAW40703.1"
FT                   /translation="MSPVVAPSTALPPSTHLEKLTALANAPSNVEAKSIADGIALDLKK
FT                   APRTLDALQDARIVDVVLAWASSKSGYERESSVVLVERICRSLGSGIEGVFLPLIPAIL
FT                   NLAMDKGQPVRSAVNSAMTSLIKATAPEGARKVFEVLTRVLEETKGWRTKIAALKAMEG
FT                   LVKPGAEDYVANELGTVIPVVEHAMHDTKAEVSTAARKAATTLCGILPNADVLKHVNLL
FT                   VSAMASPAAVPSTIKGLSSTTFVAEVNGPTLAVMVPLLTRALKERSTDTQRMTCVVIGN
FT                   LVKLVRDPTVAARYLGPLFGGVQQIATGAAFPEIRAFAQTALDILIGAGASASATPLPP
FT                   RDVILSVTEALTVMAPHLQIPGFPAHPSIPLSASLPNSPVIAHAVEYQANVVADLVDLR
FT                   RWDAYIWEGKALGSFMKLLQGAEEGAKATAEIRKAFMDIDKAKYSPPEEDDGSEGQLLC
FT                   DIQFSLAYGGLLLLNHTNLKLRRGRRYGICAANGAGKSTLMKAIRDGKVEGFPPQEELR
FT                   TIMVEHALQGEDTSMAIIDFIAADPKLTHKTRAEMAAMLLSLGFSEEKQQDPVASLSGG
FT                   WKMKLELAKAMLIGADILLLDEPTNHLDVQTVAWLEEYVCSLHDITCMIVSHDSGFLDN
FT                   VCTDIIHYESKKLVYYPGNLSKFVEKVPSAKSYYTLAATSIKFTFPPPGNLVGVRSNTR
FT                   AILKLTNCTFTYPGAPRPSIKNASCSLSLSSRVGIVGPNGAGKSTLIKLLTGETVPQEG
FT                   SVHKHPALRVGYVAQHAFHHINQHLDKTAVQYIQWRYQDGHDREMMEKATRVLTDEDKE
FT                   MMERPIEGKNGELRKIEYILGRQKLKKSFQYEVKFRGYDHRYNAWIGRDVLIEKGFQKL
FT                   ITQFDDLESSREGAGMRDTGANAVREVLEAVGLDGDIAQYNEMSGLSGGQKVKVVIAAS
FT                   MFNRPQCLFLDEPTNFLDREALGGLAVAIKEWGGAVCIISHSTEFVTALCPEIWHVDGG
FT                   VLTHQGKVALVEDAFDDPSRPGSRVASKAGTPRTMPSTPGTATGTATPAESVATDGTVD
FT                   DVADGLAKLMEKKKKKKKMTRNELKAQEERRRLRKLNWLNYGGEREPDTDDE"
FT   gene            complement(266334..268023)
FT                   /locus_tag="CNA00960"
FT   mRNA            complement(join(266334..266429,266483..266644,
FT                   266709..267029,267083..267284,267346..267534,
FT                   267591..267674,267730..268023))
FT                   /locus_tag="CNA00960"
FT                   /product="pyridoxal reductase, putative"
FT   CDS_pept        complement(join(266421..266429,266483..266644,
FT                   266709..267029,267083..267284,267346..267534,
FT                   267591..267674,267730..267872))
FT                   /codon_start=1
FT                   /locus_tag="CNA00960"
FT                   /product="pyridoxal reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40704"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ01"
FT                   /protein_id="AAW40704.2"
FT                   /translation="MHKESFNHRPRNEDHYHHIQAILTYFGTMSATTSPTTLVAGKTVG
FT                   RLGYGLMGLSSWNLLVDPVPFPQEDAFAAMKTAVDSGANCWSTATFYGPPTDPTANLKL
FT                   IRAFFDKYPEYISKVVLIVKGGMDVRSRSPAKGDDIEFFRNEIEQVKAILGDKELDVYS
FT                   LARIGGTAVETTFTNMAQLIKEGAVKAIGVSEMSAASLEKAHKICPISINEIEVSLFSY
FT                   EPSIRDSVAWCTAHSVPILAYSPLGRGQLTRRYRSLEDIPAGDFRTMFPRFQGQAFYDN
FT                   QKLVDQVEEIAKKKGVTAGQLSLAWVLAQSEFAIPIPGSRNVDRVRENASATDVKLNNE
FT                   EVEALNKLASAFEVQGARYPEMFQKDLMK"
FT   gene            complement(268410..273413)
FT                   /locus_tag="CNA00970"
FT   mRNA            complement(join(268410..269018,269072..269177,
FT                   269236..269385,269448..269790,269848..270461,
FT                   270518..270958,271014..271189,271247..271434,
FT                   271494..271609,271665..271716,271770..272244,
FT                   272298..273413))
FT                   /locus_tag="CNA00970"
FT                   /product="two-component sensor molecule, putative"
FT   CDS_pept        complement(join(268830..269018,269072..269177,
FT                   269236..269385,269448..269790,269848..270461,
FT                   270518..270958,271014..271189,271247..271434,
FT                   271494..271609,271665..271716,271770..272244,
FT                   272298..273083))
FT                   /codon_start=1
FT                   /locus_tag="CNA00970"
FT                   /product="two-component sensor molecule, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40706"
FT                   /db_xref="GOA:Q5KQ00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KQ00"
FT                   /protein_id="AAW40706.1"
FT                   /translation="MPAEDVDNATLAPATPLAIAMQSNDQIKANTKANSKSRTRFAPSR
FT                   LSSVWRSLVSHLTPPSHPSTTSESALGSSLRNTTDNMYYEDGSAVRHLPLELLNPKVGT
FT                   DSRHKRKGVSDTKNSGSRGGLRHRLRGSQANSNSRYGDDDDMSAKPSEPVSRIVVDNNF
FT                   EHFTPAVPRSDSGYGSGRTPATNGTPGGGEIGDDEDEEGTRGQRSDGASTTQRRSSAAA
FT                   QWIQKNVVVEWVTDRLWPNVKHFLDSSYPEPSKEHSFQKELWFTQKQGALASSLFFLIN
FT                   YALTVGLLPRPFSNFDWIAYLGIGGVFTLPILPLIVLDWPRRHPRIWQPIIFLACWVFA
FT                   YILIVEMHLCGFFTDNNQCGSRNFLNLLGFAFGQPTLALLTMKEDRGMAVAGASIWIIL
FT                   TGGLTMTQKNSPTLFYRNIVFFALFHAFLIGASFLKERSDRQMFALRQQLKIQYRATQS
FT                   AQVMERRAADSKKRFVSYIFHEVRVPLNTALLAVQNLQGERVFENVQQDQAEMVDGLIS
FT                   SLSMMEKVLNDVLSFNRMESGKFAQARKPFDFHKSIQLVALSHRTQAQMAGISLEVELD
FT                   SDIDKIGGIFVGDEMRLRQVASNLVSNSIKFTDQGSVRIVTKLLYPRLEPTPATEPDDP
FT                   LRQAAINLQRQQEIEESEKARSGTPTRSFPANPHSLPSHPRSRPDSAKGTHGHTLMDLE
FT                   KGSVTMEQKRMSRESGRDKEKEEEKKKVQKAVVRVEIHDTGVGLKKTDVMDGDLFSPYV
FT                   QTEIGRRQGGKGSGLGLALVRQIVKLSGGRLGVESEFGKGSMFWFELPYSLPPPPKARP
FT                   GSSKGDRMGGIGIGGGAPGVSHPVASGSGGKPAFGLVMPLSSSSNSTFVPLSLNTGIPH
FT                   GPNLGVMGTDAASAGEGVGGDDERGPPKRPGTMVRIMSGATMMSSTMEKGTSPTSANSE
FT                   RPAIGTTDSTMPLLPVEPRMSAEEAITAGGVPQSPSTSSHSTTQEPFIDPFSPISYTTL
FT                   RERRSSEWSEEMGRAAASVEKLESERAVTGMGLGMGVGQAAEIKLKTRGMQEQPETKED
FT                   PPAEMPLSSLVVDDDKLTRMLMSRMLTRLGHHVTTAENGKIASEMIKDMFENKEGAIKF
FT                   DIVFLDNQMPLMSGVEVARAVREMNCPIYIVGCTGNALREDQDEYMAAGADTILTKPIH
FT                   QKHLIEMIRDARRRVAGETQPRYMDYADESPMSPVHMRDPLPRMS"
FT   gene            274160..276146
FT                   /locus_tag="CNA00980"
FT   mRNA            join(274160..275105,275159..275250,275304..275394,
FT                   275463..276146)
FT                   /locus_tag="CNA00980"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(274231..275105,275159..275250,275304..275394,
FT                   275463..276075)
FT                   /codon_start=1
FT                   /locus_tag="CNA00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40708"
FT                   /db_xref="GOA:Q5KPZ9"
FT                   /db_xref="InterPro:IPR006769"
FT                   /db_xref="InterPro:IPR039055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ9"
FT                   /protein_id="AAW40708.2"
FT                   /translation="MRFPPLLCPRTSPSALRSLRPLPALSSSRPLHTSLAHPNSSQSQS
FT                   DLPVDGATDLSHSHFISSASPSSDFNPAQTPNAGQDIAHALKAQWEGKLSPTTSHLFKL
FT                   IVPLPAPGCQPGQTPTPRPTAFLLHPSQPLSHLSRLISGSLPPPYTHSDISYLALTGSE
FT                   SDVDTHLRNAEKSSDNSSTNENDYAGRDEGGPFLTERKGEGGRWQEVAWSQSTDLSDFI
FT                   KQSCLNEKFKIVISPERDRDGAQLKGKETELRELVLQVLIPSFASRTHYIRKRLLSLTK
FT                   DLDTLNKEKRRIDYAAHKGAQRLAVMALGGGVVYWGTIIRFTFFTDAGWDMMEPVTWAT
FT                   GFAALLGSAAFLIYHNREVSYSSLLDLSITARQRKLYAEAGLDLEKWTEMVAEAKALRK
FT                   EIERIAADYDIEWRGELEGLEKVGSREGAGGGSPRVGLPGVEIGEKKEDVRENVDAKDG
FT                   SKEGERKEMEEENETKLQGEEGKVETEKIDVDKTIDEASELAEESGEQRSRTKAAQRNG
FT                   EVMDSSDDDKGSKTRKGEEQESDSVTKGRAAAKKVINEK"
FT   gene            complement(276115..277791)
FT                   /locus_tag="CNA00990"
FT   mRNA            complement(join(276115..276664,276721..277268,
FT                   277321..277791))
FT                   /locus_tag="CNA00990"
FT                   /product="RVB1, putative"
FT   CDS_pept        complement(join(276170..276664,276721..277268,
FT                   277321..277732))
FT                   /codon_start=1
FT                   /locus_tag="CNA00990"
FT                   /product="RVB1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA00990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40710"
FT                   /db_xref="GOA:P0CR26"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR027238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037938"
FT                   /db_xref="InterPro:IPR041048"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR26"
FT                   /protein_id="AAW40710.1"
FT                   /translation="MSMAASSSTATVQPSGIITQPPPPSTLREQRIATHSHIKGLGLAD
FT                   DGTAMSSSQGFIGQILAREALGLHLSLLKGGKYSGRPLLLVGPPGTGKTALALALSQEL
FT                   GSKVPFCAMVGSEVYSGEVKKTEVLGSCFRRAIGLRIKETKEVYEGEVTELTPSEAENP
FT                   LSGYGKTISHVIVGLKTVKGTKQLRLDPSVYESIQKERVVVGDVIYIEANTGAVKRVGR
FT                   SDAYASEYDLEAEEYVPLPKGDVHKRKELVQDVTLHDLDMANARPQGGQDIMSVMGQLV
FT                   KGGRTEVTDKLRREINKVVDRYIEQGVAELVPGVLFIDEVHMLDMECFTYLNRALESPM
FT                   SPYVVLASNRGISTIRGTEYDGVAGSASEGIRAPHGLPVDLLDRCMIVKTQLYTRDEIR
FT                   RIVEMRCKVEGIAISSEAVDKLADEGERSSLRYALQLLTPAGIVSKNKGKGEVGVADVE
FT                   ELGELFLDAKRSAGVLRSTEDFEKRY"
FT   gene            277910..278635
FT                   /locus_tag="CNA01000"
FT   mRNA            277910..278635
FT                   /locus_tag="CNA01000"
FT                   /product="ribosomal protein, putative"
FT   CDS_pept        278049..278438
FT                   /codon_start=1
FT                   /locus_tag="CNA01000"
FT                   /product="ribosomal protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41413"
FT                   /db_xref="GOA:Q5KPZ7"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ7"
FT                   /protein_id="AAW41413.1"
FT                   /translation="MPRLARVLAVPLPPRARLAPLSLPRATLSAPAPAPQSSILSSLRT
FT                   PTSTFVASRPMALSSPPIPTHILPSLPAFSPLGALRHVAMGAFYQPSQRKRKNKHGFLS
FT                   RLKGGKNGRKTLLRRLLKGRKFLSH"
FT   gene            complement(278521..280964)
FT                   /locus_tag="CNA01010"
FT   mRNA            complement(join(278521..278889,278940..279056,
FT                   279105..279228,279276..279640,279694..279763,
FT                   279820..280469,280521..280964))
FT                   /locus_tag="CNA01010"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(278677..278889,278940..279056,
FT                   279105..279228,279276..279640,279694..279763,
FT                   279820..280469,280521..280928))
FT                   /codon_start=1
FT                   /locus_tag="CNA01010"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40712"
FT                   /db_xref="GOA:Q5KPZ6"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ6"
FT                   /protein_id="AAW40712.2"
FT                   /translation="MSKVASQPANNPPRRPSGGRQPPGPMGGPKETPKHTPQRSQPYAQ
FT                   QQQRAAMSMPPPQGKPIYSHIKSVHQPQRAYPASVSRSQHGAPQQQPPHLRETSRTNMP
FT                   PPRQTGATMPHKRETWKNQEGDKLEEQFDHLLDSLQVPETVRLKFSTVSPAIKSSILSS
FT                   TLTSNPSILSSLGLPLPTSPLQSPKAKKKLSTPLLRKSKSSGELKGDHSTTVNVGGEGF
FT                   VIVASPRSGEGGIMSPPLQPGGMRGQSLDLGRPSHSSRPSSRLFGHNPSPSLGNKNFAK
FT                   GLGIAVGEQPEAFISWLSTYKGTDLRMDVARCKKLRMLLRQESTDWVGAFVEMGGYGLI
FT                   IDKLQDLLDIEWREEQHDDQMLYELLRCIKALSTSEIGKAALRKLYPRPFPALSVLLFS
FT                   EKKPGDLASRQLIVELWLFIFELFTPLPQTPNKRPTSIRFDEKANPSPRDVTVFIRSLL
FT                   VPDLPDPTKDQHEFVTQAHRPRVFKAWVGELSDICRDYFWIMCHASNTLWALEQVDESL
FT                   VEKPVAPGGATGGVEFEAMNYVTTHFKLLNAFAARQAKENMDKARQLHYDLMASGMDRI
FT                   LVTFRKASTTYYPCVHLELARYVRLLQEASPNGKLPYLISKMVGPPPEEVTKAQYRSGY
FT                   AWLPMPSVTSGRI"
FT   gene            281115..283674
FT                   /locus_tag="CNA01020"
FT   mRNA            join(281115..281322,281372..281675,281730..282403,
FT                   282453..283674)
FT                   /locus_tag="CNA01020"
FT                   /product="pre-mRNA splicing factor, putative"
FT   CDS_pept        join(281127..281322,281372..281675,281730..282403,
FT                   282453..283564)
FT                   /codon_start=1
FT                   /locus_tag="CNA01020"
FT                   /product="pre-mRNA splicing factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40714"
FT                   /db_xref="GOA:Q5KPZ5"
FT                   /db_xref="InterPro:IPR000061"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022030"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR035967"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ5"
FT                   /protein_id="AAW40714.1"
FT                   /translation="MSALNLPKPVNTYAGEDELRNPNGVAGVANGQAVQENEDAEEEWV
FT                   PPKASDKLKIGIIYPPKEIRNIVDKTAIHISKSPTPLLLEEKIREHQKTDPKFAFLNDA
FT                   DPYHQYYRYMIVKSQEDAEDAAKGIVKPQEEKKMEKKDEGPKATEPKPWEFKVDLPGVT
FT                   AMDLDILRLTALFHARRGRSFLSSLSVKEGRNYQFDFLRPTHSLYGYYNRMVESYQKIM
FT                   QPPPGLIDGVIKEANDPDWKWHILDEARNRAEWEKTRRKRENERAKEEEEEAKAFAAID
FT                   WQDFVTVETIEFTQNDEQLELPPPTSVEKLKSMSMAEKRMAAMVMEETGAGPTGETAPP
FT                   AEEMEMEEDEEEEEARLQRIKAEQEQARAREVQRAAMEQRGMKIKKDYVPRGIQRTNAV
FT                   ATAICPNCGQSIPENELTEHMRIELLDPKWKEQKKQLELRRAQAQQLQQGADVVSSLKN
FT                   LASARTDIFGDDVDEAERKRREEEERQKRREREKIVWDGHTASAAKTAETFQSQFSLDE
FT                   QIKKLHNRAGLTDQPSNAPGPQIGPGITQQAHVPTPLAAGLSTPGGGTAYAGATISAAP
FT                   TGPTTKEYISTPYDPSFGGTPPPPPGSAPSIHPSRLAAMGGNTPYLGSATPPMAGQVHP
FT                   RAEDEGAGDRPVFKRPKIEKLPYGQLYTEIDWQSLHPEPISIAVQLPSMPEKPEWKLDG
FT                   SIITVPDLPVSTLFSTIRERIRRILDTDVPISRMRLDYNNKPMSNSSTLASVNLDEGDM
FT                   LSLVVKKK"
FT   gene            complement(283586..285691)
FT                   /locus_tag="CNA01030"
FT   mRNA            complement(join(283587..285171,285218..285691))
FT                   /locus_tag="CNA01030"
FT                   /product="transcription regulator, putative"
FT   CDS_pept        complement(join(283616..285171,285218..285518))
FT                   /codon_start=1
FT                   /locus_tag="CNA01030"
FT                   /product="transcription regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40716"
FT                   /db_xref="GOA:Q5KPZ4"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR037353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ4"
FT                   /protein_id="AAW40716.1"
FT                   /translation="MSLENRLSPPLSRSETPALGTVGTVLDNATASLPLPNQNFPGEGL
FT                   AGPGPSTTENHTKKVIREDVERRQYARMGTIMPGTGDGLGIGEECFSWTDIPNVKNFRY
FT                   HPCALSPTPSPHPVFPFYRTIPYPPPIPPVHLSLLDRSSYLRISPSLLTIYNDRGFRSC
FT                   RTNVSVREGTWYYEVHIDRGDGEQGARRGAGGEGGNPHVRLGWGRREANLDTPVGCDAY
FT                   SYAIRDVGGEKVHISRPKPYANKGFRTGDIVGCLISLPRRPSLEDKPVSDPARIKRQRR
FT                   AFNYKSQAYFESAEYTPSKEMDALIDRDGKLAAAAKVESQAQEINGGDMPKKQMGATTK
FT                   NTKKGKKQPEKAHEPVARKLEKLSSSSISFFINGESFGEAFTDLYDFTPLPSLYPPVGG
FT                   HGKKHHPGDEVLHDDGTLGYYPMVSCFGRAKATCNFGPDFAHPLPEGARPMCERYAEFK
FT                   EEERLLDEKDEVEDAERLRQILEAEKKMLSKVKPRNQKANSATASGENTPKRKKGPAPK
FT                   RKREGRDGTEMSTPGVESVRGLTATPAPEAPMSEAGIEWREGTRERSMSVAASLGGQGW
FT                   GTVKEEISDEREEKKIKKDKEVEVKQENGGNSEDGEFEGINW"
FT   gene            286052..287327
FT                   /locus_tag="CNA01040"
FT   mRNA            join(286052..286293,286347..286527,286583..286634,
FT                   286679..286957,287021..287327)
FT                   /locus_tag="CNA01040"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(286173..286293,286347..286527,286583..286634,
FT                   286679..286957,287021..287116)
FT                   /codon_start=1
FT                   /locus_tag="CNA01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40718"
FT                   /db_xref="GOA:Q5KPZ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ3"
FT                   /protein_id="AAW40718.2"
FT                   /translation="MSTIRQLLDSQSRALMAAGAVVVAAAALWITSDYRDWITFGTGGT
FT                   PSNPKGYLKMRKFWFKRLFINNDDLTDGSSLPDEGPSYLPGYVTPRRGGRPERMPRTLP
FT                   HRQKPEAIDAKSKKVLHHLGSKLQSEHPDILNLAPSKTEGGTGDAIYAKEDLPTLNPKA
FT                   KQVAYEIAHVHPADNSLHVHLSPRDAKMLIEKSWAERFPVHELGPPQWVMVYAPRNKEE
FT                   VDLVEKIMKAAVGWVTGVTI"
FT   gene            complement(287322..288903)
FT                   /locus_tag="CNA01050"
FT   mRNA            complement(join(287322..287723,287787..287956,
FT                   288010..288351,288417..288689,288754..288903))
FT                   /locus_tag="CNA01050"
FT                   /product="sorbitol dehydrogenase, putative"
FT   CDS_pept        complement(join(287441..287723,287787..287956,
FT                   288010..288351,288417..288689,288754..288825))
FT                   /codon_start=1
FT                   /locus_tag="CNA01050"
FT                   /product="sorbitol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40720"
FT                   /db_xref="GOA:Q5KPZ2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ2"
FT                   /protein_id="AAW40720.1"
FT                   /translation="MSTELNPDNTSFVLHGVEDVRFDQRPIPEVHNDQVLIKVVKTGIC
FT                   GSDVHYLQHGRIGSFVLEEPMCLGHESAGVVVKLGPNVREDLGVEVGTRVAMEPGVCCR
FT                   SCANCKAGLYELCPYMSFAATPPTIFGTLCRYYVLPADLVHPLPESVSFEDGAMMEPLS
FT                   VGVHSVATLGGCKSDQTVIVFGAGPVGLLCMAVAKALGARRIIAVDINKERLEFAKSYA
FT                   ATDVCIPGSKLDGEDGEAYTARIAGELRQELGIPERGKGAIDLAIEASGAPTCVQIGLA
FT                   VLKPAGTYVQVGMGAKMTVPVPLFHIISKQLHVVGSFRYGSGDYPLAISLVERGLIDLK
FT                   PLVTQRFKFENAKEAFETTKVGKDKNGKGVIKCIIDGPE"
FT   gene            290328..291424
FT                   /locus_tag="CNA01060"
FT   mRNA            join(290328..290752,290810..291022,291078..291149,
FT                   291213..291424)
FT                   /locus_tag="CNA01060"
FT                   /product="ribosomal protein S3, putative"
FT   CDS_pept        join(290397..290752,290810..291022,291078..291149,
FT                   291213..291330)
FT                   /codon_start=1
FT                   /locus_tag="CNA01060"
FT                   /product="ribosomal protein S3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40727"
FT                   /db_xref="GOA:Q5KPZ1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005703"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ1"
FT                   /protein_id="AAW40727.1"
FT                   /translation="MSASQIISKRRKFVADGVFQAELNDFFTRELAEEGYAGCEVRVTH
FT                   ARTEIIIRATHTQEVLGDKGRRIRELKALIEKRFKFPENALELYAEKVQYRGLSATAQA
FT                   ESLRYKLLGGLAMRRACYGVLRFVMESGAKGCEVVVSGKLRAARAKSMKFTEGFMVHSG
FT                   QPARDFIDYAVRHVLLRQGVLGIKVKIMKPSDPAGRQGPAKNLPDDVQITEPKAEGVIE
FT                   IRSDHKNPPVQAIPPAAAPAPEAQAAEAQY"
FT   gene            complement(291852..294190)
FT                   /locus_tag="CNA01070"
FT   mRNA            complement(join(291852..292143,292223..292261,
FT                   292382..292520,292581..292606,292678..292751,
FT                   292850..293090,293146..293361,293436..293653,
FT                   293715..294190))
FT                   /locus_tag="CNA01070"
FT                   /product="C-14 sterol reductase, putative"
FT   CDS_pept        complement(join(292138..292143,292223..292261,
FT                   292382..292520,292581..292606,292678..292751,
FT                   292850..293090,293146..293361,293436..293653,
FT                   293715..294135))
FT                   /codon_start=1
FT                   /locus_tag="CNA01070"
FT                   /product="C-14 sterol reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40729"
FT                   /db_xref="GOA:Q5KPZ0"
FT                   /db_xref="InterPro:IPR001171"
FT                   /db_xref="InterPro:IPR018083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPZ0"
FT                   /protein_id="AAW40729.1"
FT                   /translation="MDAQEESTTTVITATTHLDLPAHPHIKTYQELNPRSKPTEFFGPC
FT                   GTGAITLFTPLFTYFFFFACNDAVGCTPTSVQGWKDAFALVGNYPSSAGRLWDWKAAGV
FT                   YLGWYAFCMICEVVLPGQRVEGNLLRDGRRKVYRMNGLYTLLLALGLLTGVLVQPRGIQ
FT                   AFTWLHDHFVPLISASLAMATFQAVWVYVWSFFSGELLALGGNSGNVVYDFFIGRPLNP
FT                   TIPGFPSFDLKTFNEVRPGMILWFLLNISCACEQYVRIGKLTDSMWIVLVFEGWYVLDC
FT                   LLQEHTILNQMDITTDGFGFMLAFGDLTWVPFTYGLQARFLASTPVELGPVATALIVGV
FT                   EVAGMYIFRVANNEKADFRAGKNPKNLEYMQTERGTKLLTSGWWGRSQHPNYFGDWLIA
FT                   LGWCLPTGFNTPLTYFYLVYFVILLLHRQKRDEEACKLKYGKDWDRYCEKVPYKIIPYV
FT                   Y"
FT   gene            complement(294348..295187)
FT                   /locus_tag="CNA01080"
FT   mRNA            complement(join(294348..294598,294702..294777,
FT                   294850..295187))
FT                   /locus_tag="CNA01080"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(294432..294598,294702..294777,
FT                   294850..295089))
FT                   /codon_start=1
FT                   /locus_tag="CNA01080"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40731"
FT                   /db_xref="GOA:Q5KPY9"
FT                   /db_xref="InterPro:IPR032157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY9"
FT                   /protein_id="AAW40731.1"
FT                   /translation="MSLQPQISTYHTSIPSPIPSSPSFNFHLTRMVNTLMIWVGTGLPT
FT                   DTAGNVAGGVASMGSVEQVDNKLAGDWSVAMPSRGNIPVTATPLFRSGSTDIALPMSQR
FT                   LAKKFPSNQIHLSLSLPPSLTNQTGQSIDPYASKMMLVMEKKLGKWIEEILLQEKA"
FT   gene            295221..296041
FT                   /locus_tag="CNA01090"
FT   mRNA            join(295221..295606,295667..295817,295876..296041)
FT                   /locus_tag="CNA01090"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(295292..295606,295667..295817,295876..295958)
FT                   /codon_start=1
FT                   /locus_tag="CNA01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40733"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY8"
FT                   /protein_id="AAW40733.2"
FT                   /translation="MADITPPSSQQNTPQRTIDNSLANPDPAAMDVDLDEDLESIASEG
FT                   SDKISVPSGAERANQVRQAVEADADESGDEGDEEVEAEDEAGAEEKGKVEKKDKAPLGG
FT                   PTKKRTKRPFKGQSLSTHPHSHAARPRPRTEGPHKADGSLFDSEIVARWNADFGDVLSP
FT                   SPPCSNTRAAPVPAQAAQS"
FT   gene            complement(296020..297197)
FT                   /locus_tag="CNA01095"
FT   mRNA            complement(join(296020..296459,296540..296831,
FT                   296900..297197))
FT                   /locus_tag="CNA01095"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(296131..296459,296540..296831,
FT                   296900..297115))
FT                   /codon_start=1
FT                   /locus_tag="CNA01095"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHV0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV0"
FT                   /protein_id="ALO60290.1"
FT                   /translation="MSLSDLAETPQSGDNTTIPGAISLTVPTNLIMLPAAAGLVGLSIG
FT                   FIRGGSRARLRFLVENAHRKPKTVQGWYFYTKTRNYRVFFGALKAGGKYALGLGGATAG
FT                   FVLVDESVGWAREQVFGPAGEIQGVAQGGPEGSAVKRKAGWRKGEVKWEDGGVAGGLMG
FT                   LVVGTAYKLPRPLFIRSLVMGIVLGSLTSGMQTVQARIGRMREEEERKAKLTDNQQLSS
FT                   PAAEAAATSALVTEEVAPVMSLSEETKPTEEIVVGGVPGEEEPRGWWESVKSWVGA"
FT   gene            complement(297277..299357)
FT                   /locus_tag="CNA01100"
FT   mRNA            complement(join(297277..297615,297673..297692,
FT                   297748..297787,297854..298026,298091..298184,
FT                   298240..298274,298363..298546,298602..298672,
FT                   298729..298885,298948..299044,299107..299203,
FT                   299275..299357))
FT                   /locus_tag="CNA01100"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(297277..297615,297673..297692,
FT                   297748..297787,297854..298026,298091..298184,
FT                   298240..298274,298363..298546,298602..298672,
FT                   298729..298885,298948..299044,299107..299357))
FT                   /locus_tag="CNA01100"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(297493..297615,297673..297692,
FT                   297748..297787,297854..298026,298091..298184,
FT                   298240..298274,298363..298546,298602..298672,
FT                   298729..298885,298948..299044,299107..299147))
FT                   /codon_start=1
FT                   /locus_tag="CNA01100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41269"
FT                   /db_xref="GOA:Q5KPY7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY7"
FT                   /protein_id="AAW41269.1"
FT                   /translation="MGKEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYEE
FT                   EFEGKKLTEIINSEHENRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGKVL
FT                   DTLEGNVRKDAKAITLIKGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVARDTF
FT                   SETTIGYRNKEDGELWLKLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDGLGYG
FT                   SNSKAAIMRIGLLEMKHFCQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVAAAFVG
FT                   ANKSFDQLEAEMLNGQKLQGIHTAKDVHNFLSAKNRSRAYPLFDKVYQISWEGVPVEQL
FT                   TEGL"
FT   CDS_pept        complement(join(297493..297615,297673..297692,
FT                   297748..297787,297854..298026,298091..298184,
FT                   298240..298274,298363..298546,298602..298672,
FT                   298729..298885,298948..299044,299107..299147))
FT                   /codon_start=1
FT                   /locus_tag="CNA01100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41270"
FT                   /db_xref="GOA:Q5KPY7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY7"
FT                   /protein_id="AAW41270.1"
FT                   /translation="MGKEKVAVVGSGNWGSAISRIAGINTKKHPDVFDDTRVSVWVYEE
FT                   EFEGKKLTEIINSEHENRKYLPGVKLEDNVVAVPDLKEAVKDATALVFVTPHQFLGKVL
FT                   DTLEGNVRKDAKAITLIKGVEVQGDDIHIFADVIEQRLGIPCSALSGANIANEVARDTF
FT                   SETTIGYRNKEDGELWLKLFQTPKFKVQLIDDVAGVSLCGALKNIVAVAAGFIDGLGYG
FT                   SNSKAAIMRIGLLEMKHFCQEFFVDVKEESFLQESAGVSDVITSCLSGRNYKVAAAFVG
FT                   ANKSFDQLEAEMLNGQKLQGIHTAKDVHNFLSAKNRSRAYPLFDKVYQISWEGVPVEQL
FT                   TEGL"
FT   gene            299540..302916
FT                   /pseudo
FT                   /locus_tag="CNA01110"
FT   gene            complement(299868..302849)
FT                   /locus_tag="CNA01120"
FT   mRNA            complement(join(299868..300363,300417..300504,
FT                   300555..300628,300679..301210,301259..301778,
FT                   301841..301932,301991..302080,302142..302849))
FT                   /locus_tag="CNA01120"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(300178..300363,300417..300504,
FT                   300555..300628,300679..301210,301259..301778,
FT                   301841..301932,301991..302080,302142..302245))
FT                   /codon_start=1
FT                   /locus_tag="CNA01120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41268"
FT                   /db_xref="GOA:Q5KPY6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013777"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY6"
FT                   /protein_id="AAW41268.1"
FT                   /translation="MRSHLSLSLLFSSLVAISVVSAASADEWKGKSIYQLFTDRFAPVS
FT                   DTAPARSSPIPDECDPIDQTWCGGTWLSIIDKLDYISDMGFDAIWISPVSQNIDRDTPY
FT                   HYAYHGYWVNDPRALNPRFGTADDLKALSKALHDRGMYLMVDIVVNNIPGTTVNDSFST
FT                   SDLVADGSIWTDPSEFHPQCWIDYSNQTSVENCWLGDDKLPLMDVNTENEAVVSTLQAW
FT                   ISNLTAEYEIDGLRIDAAKHVPGEFWTGFCGAAGVFCMGEVYTDDINFAAKFQTQNWMD
FT                   SVLGYPLYYGIVDGFGTPNGNMSRFVDIATQVLGTFPTPGLIGNFIENHDLPRWRNTTA
FT                   DSQLAYNAMTVQFIFEGLPVVYYGQEQDFASGAGDPYNRQALWTSEYANTTSYNHIKRL
FT                   NEIRHAVISNNTLFDGKNFLDSQTKIVASTDYDVAFRKGPLLAVLTNRGSPSQNVGFGV
FT                   PTSGWPSQSSVVDLLSCKQFTVGSGGAMLVSYSASGYGGMPYVFAAQSDASAMGICGDA
FT                   GMSTYVSPNITSAAFPALAPATGLGSALSLPAAVAGALGLMFIL"
FT   gene            complement(304225..305620)
FT                   /locus_tag="CNA01130"
FT   mRNA            complement(join(304225..304619,304687..304808,
FT                   304875..305620))
FT                   /locus_tag="CNA01130"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(304392..304619,304687..304808,
FT                   304875..305484))
FT                   /codon_start=1
FT                   /locus_tag="CNA01130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41272"
FT                   /db_xref="GOA:Q5KPY5"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY5"
FT                   /protein_id="AAW41272.2"
FT                   /translation="MTISTVAFLYPGAMGASLARVLAVRLPHLKLLTSLQGRSQATISR
FT                   AESCGLTNVPFADLIAQSDIILSILPPSSAVSLAKEVVAHVATEKKPIFVDANAVSPET
FT                   AAQISSIFEAKEIPFIDGCIIGFPATEDFSSIPKLYLSASPEREDLMREVTQTLSGGEE
FT                   GKGMRVRPMEGSGVGGASALKMCYGGINKAVSGLAAAMVLSAQAHSPGTAKAFLDELSE
FT                   SQPALTKKLSRAIPDMIPKAYRWVGEMEEISSFITSSILQSASITHPNPADMYQGLAQM
FT                   FQRVADDVKHSQAGQRGEEVKILLDWAKRGEKELAKKE"
FT   gene            305835..308275
FT                   /locus_tag="CNA01140"
FT   mRNA            join(305835..306452,306495..306575,306625..306741,
FT                   306798..307029,307082..307186,307235..307927,
FT                   307983..308111,308166..308275)
FT                   /locus_tag="CNA01140"
FT                   /product="expressed protein"
FT   CDS_pept        join(306161..306452,306495..306575,306625..306741,
FT                   306798..307029,307082..307186,307235..307927,
FT                   307983..308111,308166..308172)
FT                   /codon_start=1
FT                   /locus_tag="CNA01140"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY4"
FT                   /protein_id="AAW40735.1"
FT                   /translation="MIPLGSPRRSHILLAALLSLVLVLFLHTHHHPQSHFLSGPISKLK
FT                   VQFGLYSSSDGLETKDKGIRKRIDKIRGYCEAEDAFEREYGRTNLRLSRAYEGSHERMR
FT                   LLLQKIMRGEPLTISAIGGSVTKGHQVWQNEIWFHKFWEWLTEFAGEGVEIKQVNGAAP
FT                   ATGSDYFSFCFPLHIPSDSDLVLVELAVNDEGIPEHVENMENLLRGLLDLPNKPAVMLI
FT                   EAMAFSNGGMGGGGGRMHLPVAQYYDVPVINQRLPLVNHFARHPQLVGPYFAQDWWGNP
FT                   DTRHINSHGHRDLGMLVASFVKDVACEMISQPTFHVQSPSAFEALSIVALAQPPQTEDK
FT                   EDAKIEDELLAAEQKWWPEQSRSWRKDPTEEKPVGELMPGLWSTPIEYGILPRLRVLEG
FT                   WNPHLDYSVPPFHPTCLSTRAKEPHFNLTPSANEGWEYWVHPEHLDKPYLVARTPGARV
FT                   TFELETSVGIVKMYALKSKTFGLGTVECWADEERRKSVKIEGYWDNGNVNIGRFAPIRD
FT                   NLQPGKHTITCELLEETSDPGGGREFRMISMMSV"
FT   gene            309246..313475
FT                   /locus_tag="CNA01150"
FT   mRNA            join(309246..309522,309618..309675,309773..310003,
FT                   310062..310141,310274..310744,310797..310888,
FT                   310937..311723,311774..312299,312356..312588,
FT                   312654..312671,312772..312936,312988..313475)
FT                   /locus_tag="CNA01150"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(310682..310744,310797..310888,310937..311723,
FT                   311774..312299,312356..312588,312654..312671,
FT                   312772..312936,312988..313026)
FT                   /codon_start=1
FT                   /locus_tag="CNA01150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40737"
FT                   /db_xref="GOA:Q5KPY3"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY3"
FT                   /protein_id="AAW40737.2"
FT                   /translation="MSSTTNSHLMKTTRWGRPFVKDTHDLFCTLVASLNFDTHRNFFKT
FT                   YPNSFTTDDACLNLASLKFSQSTRTADPKDPTRIVTTTTTTTFSMSREMAKGICQHFMD
FT                   CHLVENATDIMAGFFKDRGIYMLTPKGLHILERFVSKNGITTDHLLKLFATQPITMKLL
FT                   HLERRSGDDEVIITRNVIEVLFRRFVGRIPNLTKLNEDEILAHYYSRFYTKTPSLPAGE
FT                   TLDRSEGIIVRKPGGGEKTTSSDDYIFSARAAVNWMLDFTSATGIDEAAEILAHFVRYG
FT                   LITLVSDKGKIKEENLIVSARGGGAGGGAGAIMQEAEFRVTERAIYKITKEGIAVAKWN
FT                   ETTTNHAAGASKANLSVETTPGNKARPSHEASPSVSVQRRTSLSDRFRGDFDISGVPGG
FT                   DNHIKDSHTARLKQILEEPALRSLFREFLRSNFCEENLSFWLDVQDFKRRFQTTSSAVA
FT                   APGSKQAKVSGHAAMEKHQQDLVAMAFVIYNTYLAPASPCELNIDHNLRAELVGYMNQI
FT                   TSDKEAGVKGHIEPGVGDTLHASQLQTMVKLYERIQVYIFRLMATDSVPKFCKTELFLT
FT                   LMEQFSEYTKDEFAVTDLETKAAALTVDSRKTTAHVDGRQPSPTRSYLTISQAANEKQA
FT                   AKQKN"
FT   gene            complement(313134..314621)
FT                   /locus_tag="CNA01160"
FT   mRNA            complement(join(313134..313549,313609..313783,
FT                   313843..313920,313986..314508,314565..314621))
FT                   /locus_tag="CNA01160"
FT                   /product="LSDR, putative"
FT   CDS_pept        complement(join(313545..313549,313609..313783,
FT                   313843..313920,313986..314508,314565..314611))
FT                   /codon_start=1
FT                   /locus_tag="CNA01160"
FT                   /product="LSDR, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40739"
FT                   /db_xref="GOA:Q5KPY2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY2"
FT                   /protein_id="AAW40739.2"
FT                   /translation="MSYLQDLFGLTGKTALITGATRGIGARMALALAKAGADIILVQRN
FT                   TSNTATRDDIIAAGGKADIVVCDLGDAASVAKLIPHVTKELGRTLDIVVNCGGIQRRHP
FT                   VENFPENDWNDVLQVNLNTVFTITRDAGRHMLESRGGVAGEPVPEGGAAGNPRGFGKII
FT                   NISSLVAYQGGLNVVAYAAAKHGVQGIVKSFSNGWASKGVCVNAIAPGYIATDMNEALI
FT                   ADKDRARQILERIPAGRWGSPEDFEGAIVFLASRASDYVTGECLVVDGGWMAR"
FT   gene            315050..317059
FT                   /locus_tag="CNA01170"
FT   mRNA            join(315050..315340,315397..315885,315947..315981,
FT                   316034..316301,316350..316498,316551..317059)
FT                   /locus_tag="CNA01170"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(315254..315340,315397..315885,315947..315981,
FT                   316034..316301,316350..316498,316551..316842)
FT                   /codon_start=1
FT                   /locus_tag="CNA01170"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40741"
FT                   /db_xref="GOA:Q5KPY1"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY1"
FT                   /protein_id="AAW40741.2"
FT                   /translation="MTAFNSANWGLASEREYVPMTTRESGRPSSRLKSTAIRLLPTVVI
FT                   LALGILIGSNVPWYLSIYSRRPSGAISLLPRALPPIASSTVTDQLVSLGLPPPEEPIPN
FT                   VVHYVYGLADDQPDFPYFAYLAMRSALVSLKPDVVYFHCINEPKGYWWERVKNWEGWID
FT                   DQGNRRGMMEIKRARDVQWIGTSKRPVVHFAHKADIIRLEVLLQYGGIYLDIDTFVLRS
FT                   FSSASLLQYDTVLALEAHGLTFLRKPASDDEMRPKGLCNAVIIARRGAEFLKRWLDSYE
FT                   GFREDKWTEHSVEMPWTLAQMYPTLVTVLSERTFFWPLWTDDHIHAVYATKEYDFEESG
FT                   QLAYHAWESKAQPYLSALDPSTITQIETSFTRMARRFREPDELRRWLAVGKEDGAGSGT
FT                   GLVEGDEEANRKRLLQDRTRRGEWGFIKGKGIKVNRESIE"
FT   gene            318093..322491
FT                   /locus_tag="CNA01180"
FT   mRNA            join(318093..318397,318610..319032,319738..319944,
FT                   320005..320108,320161..320295,320547..320603,
FT                   320804..320915,320968..321100,321157..321470,
FT                   321522..322491)
FT                   /locus_tag="CNA01180"
FT                   /product="serine/threonine-protein kinase, putative"
FT   mRNA            join(318093..318397,318610..319032,319738..319944,
FT                   320005..320108,320161..320295,320804..320915,
FT                   320968..321100,321157..321470,321522..322491)
FT                   /locus_tag="CNA01180"
FT                   /product="serine/threonine-protein kinase, putative"
FT   CDS_pept        join(319014..319032,319738..319944,320005..320108,
FT                   320161..320295,320547..320603,320804..320915,
FT                   320968..321100,321157..321470,321522..322297)
FT                   /codon_start=1
FT                   /locus_tag="CNA01180"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40744"
FT                   /db_xref="GOA:Q5KPY0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPY0"
FT                   /protein_id="AAW40744.1"
FT                   /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAAV
FT                   QQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQSE
FT                   KMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQHGNKHLNA
FT                   NFKKRGPRVTERANILKEVQIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGELFHQI
FT                   VKLTYFSEALSRHVILQVAEGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNPVHRPY
FT                   DEEKEDEGEFQPGIGGGEIGRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIVKDERYS
FT                   KSVDMWALGCVLYTLLCGFPPFYDESINVLTEKVARGYYTFLSPWWDDISHSAKDLISH
FT                   LLCVDPAQRYTIDEFLAHPWIRDAAPPPPPPTSRAVPSESPMYSPLLASIRAGNREARS
FT                   PGVGALKEAFDVTYAVHRMEEEGARRRAYNGPGGAGQRGFLQGLNEEAEEEDEQAQVEE
FT                   ARRKHGEAVARQIQEHRGRAAANAAAGIKEPPVANYVGRGGANRREAEAVIYDGRAGQR
FT                   DRGKGGKSAGGFDLDLNNATLLGRRGKKVAPSPLAQQVQAGQ"
FT   CDS_pept        join(319014..319032,319738..319944,320005..320108,
FT                   320161..320295,320804..320915,320968..321100,
FT                   321157..321470,321522..322297)
FT                   /codon_start=1
FT                   /locus_tag="CNA01180"
FT                   /product="serine/threonine-protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40743"
FT                   /db_xref="GOA:Q5KPX9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX9"
FT                   /protein_id="AAW40743.1"
FT                   /translation="MLSSFKQILRHGKHAQQASPSPQPDTKNGRSKTTQAQQPLPPAAV
FT                   QQQPQQPSQPQQQQQHRRKDEYSAKLTTSTTGQNKIPAASPNYREEAEKIVADERAQSE
FT                   KMPVYAGLEEFTLIEKMGDGAFSNVYKAIDRRSGQKVAVKVVRKYELNQSQRANILKEV
FT                   QIMRGIDHPSIVKLLKFFESDEHYFLVLELMEGGELFHQIVKLTYFSEALSRHVILQVA
FT                   EGIRYLHEERGVVHRDIKPENLLFERIPIIPSRNPVHRPYDEEKEDEGEFQPGIGGGEI
FT                   GRVKIADFGLSKIVWDEQTMTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLYTLLCGF
FT                   PPFYDESINVLTEKVARGYYTFLSPWWDDISHSAKDLISHLLCVDPAQRYTIDEFLAHP
FT                   WIRDAAPPPPPPTSRAVPSESPMYSPLLASIRAGNREARSPGVGALKEAFDVTYAVHRM
FT                   EEEGARRRAYNGPGGAGQRGFLQGLNEEAEEEDEQAQVEEARRKHGEAVARQIQEHRGR
FT                   AAANAAAGIKEPPVANYVGRGGANRREAEAVIYDGRAGQRDRGKGGKSAGGFDLDLNNA
FT                   TLLGRRGKKVAPSPLAQQVQAGQ"
FT   gene            322732..324656
FT                   /locus_tag="CNA01190"
FT   mRNA            join(322732..322878,322964..323047,323112..323140,
FT                   323199..323294,323346..323460,323529..323581,
FT                   323649..323714,323784..323893,323980..324120,
FT                   324196..324262,324337..324656)
FT                   /locus_tag="CNA01190"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(322763..322878,322964..323047,323112..323140,
FT                   323199..323294,323346..323460,323529..323581,
FT                   323649..323714,323784..323893,323980..324120,
FT                   324196..324262,324337..324539)
FT                   /codon_start=1
FT                   /locus_tag="CNA01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40747"
FT                   /db_xref="GOA:Q5KPX7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX7"
FT                   /protein_id="AAW40747.2"
FT                   /translation="MFAVRSLPEIQLQRYSTRSPTMMKAFQITELVHPSKVNVSQIEPP
FT                   KPDAEKGEVLVDVHAAALNFFDILQSQGKYQTKPPLPFILGAELAGTISKSSPIPPGCP
FT                   YKPGDRVFGITQGAFAEQAVAEWKRLLPVPKNLSLAEASTVPLTATTSYLAIVNRAQAK
FT                   AGEWVLVHGAAGGVGIAACQIAKSLGCKVIAAASSEAKRQFCKDHGRVDEVVDYTKEGW
FT                   QNDVKKITGGKGVDVVFDPVGMIVPSLKCVNFNARILVVGFAGGTIEKIPANLLLLKQA
FT                   SAVGVYWGATELREPETAKQISSSVLKLLSTGDIRPIVHSTPYKGVEGVVQGLKDIEER
FT                   KVWGKGVVIIREEETKAKL"
FT   gene            complement(324596..328165)
FT                   /locus_tag="CNA01200"
FT   mRNA            complement(join(324596..325042,325110..326558,
FT                   326621..327579,327662..327760,327813..328165))
FT                   /locus_tag="CNA01200"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(324902..325042,325110..326558,
FT                   326621..327274))
FT                   /codon_start=1
FT                   /locus_tag="CNA01200"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40749"
FT                   /db_xref="GOA:Q5KPX6"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX6"
FT                   /protein_id="AAW40749.1"
FT                   /translation="MGSGRKKLPDDEARHERKGVGGGPGETRRGSVMGSGMQHQDHDRA
FT                   SERKEVFLCKRASMGMGGGAIRGGGTSLFDRRPSLLTNTPAKHVMLSQAIDPPASPLSA
FT                   APGATEQPLPPAAGRRRTTVSLHSLADAALADASHRPQLTHRSSITLPPISSLLPGASA
FT                   PVPASKSSAQKLPSRNQATSGQPSVKGWSPATLSPKNTGAPVVLPRTRAVYRPIEAPVH
FT                   PLVPDQHVALEYNVRRYTRADSSGRPSSSSQAQSSCCNIAPAAPTSRPTCRGKAPAEQP
FT                   MPQPHPQTQLHRRYPLQGLQLDKTYPEWSIHGWHEDAQRLLQPPRTLTPPSVYAKSRSI
FT                   SRGAYSSGSEFDKPARPPPGWGDNVHGTSQAYAPPFLQANTLYPPPLRPINSEAKPRQR
FT                   SYRFITHDTEPSTEQKNHAVTRALGTEEECNGPQTKAKESSSLGNKCSIGSAPSSPPSC
FT                   HPIKGIIPSASPTPVINNHPLTRSTPSTWSITSHLNITTYRSNSHQSSQSPITPKAAFE
FT                   NELDSTSNSSSSSSAPSEYEDDGFELSDMSDRGHEPGRALVHGGMGSRENIGEDEKGEN
FT                   LSAKLRLQIPPFYSTPSGSPLKSVSSENVTPSSSNYTPTSSTKRARILTSTSTCNPMST
FT                   SSWDAERENGVLKGCTSGNTVTVESTGRNDGKVRQKEQRRNRERRREQNAVAQKKFRWK
FT                   KKQMAEKMAADLESANETTLKLQEQLEERDSLVSNLQSELSLYKRKFGECTLI"
FT   gene            328337..329313
FT                   /locus_tag="CNA01205"
FT   mRNA            join(328337..328453,328659..328703,328785..328868,
FT                   328979..329113,329193..329313)
FT                   /locus_tag="CNA01205"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(328388..328453,328659..328703,328785..328868,
FT                   328979..329113,329193..329255)
FT                   /codon_start=1
FT                   /locus_tag="CNA01205"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHR3"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR009044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHR3"
FT                   /protein_id="ALO60291.1"
FT                   /translation="MPPSKRSKRAVSDEASDEASDESREEKPAIISEPKAKKAKASELT
FT                   ESSGEGAEIEKNDDGEEFFKLSEYRRLTVRTFKGKTLVDIREMYKDKSSGALKPGSKGI
FT                   SLTAEQWEILRNNIQNVDEMVKKVQK"
FT   gene            complement(329815..332642)
FT                   /locus_tag="CNA01210"
FT   mRNA            complement(join(329815..330069,330145..330594,
FT                   330650..331327,331381..331684,331733..331884,
FT                   331934..332401,332449..332642))
FT                   /locus_tag="CNA01210"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(330004..330069,330145..330594,
FT                   330650..331327,331381..331684,331733..331884,
FT                   331934..332401,332449..332607))
FT                   /codon_start=1
FT                   /locus_tag="CNA01210"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40751"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX5"
FT                   /protein_id="AAW40751.1"
FT                   /translation="MSSSIITKPKPHRRSSAMSSISIEQPPLLGLPHEILEQIFLALSL
FT                   PGRSKLARTCSALRDIYAASAQLQYLAILETSAYLDYPRVLKAVEPVEEEPLSAMSSPP
FT                   SSPEAALTTVPIAFRSPHTGNLRSTIPSVSLAPWPKQPPEVSPFDHVGSLAAKNRRLRD
FT                   REERWETMEFKEKRTFKVQGQEGVYELQEGIFLLCNDTSTDDEERRPDTIRLIPLPSAD
FT                   DPDLEDPPISVKGHKLPMSIADLTMDPSQDLIVVSEYNPAPSDPSRPLPTHRYHLLTMS
FT                   SFTPHPLASLPTLDFPPVTQTLPRTRQLLQVMGDTLAVLVAKYIPVWILDALNIDPEVL
FT                   GHRTQEEEIVVWNWKSGRVLSRLPFTEKQWFSSFAMLSPTTFMVTSTMSSIPSGGPAFP
FT                   WKRDEHRPTIQIYSILSDPKRSVIPVQPLQSEIMDDTTPRPVCVAVLEMPTLQEDVRVT
FT                   EFDVRPDPAYPPRSGQTKDDEVEYTLLKHKPFTQDPLKGILVFDYRLQERIPMNPNTRD
FT                   VVRNWPFEVFVRRETLVKLGQEGEKRLGQAWESGSVLKMGVRDVQQTFTWDEWGEKEAR
FT                   MVDRIMTIRSWVCSCSGYRYISILSEDKSPFAEYDLDEPPEDDQPTLDGHYPYRPEKSH
FT                   ILLYDFNPYTISKELSRQEPYPESDDVDPPRRRTVCGETFVPPFTEGKGWKSRVVTSPT
FT                   ILSKKSIFEEDVRSELPYREVWREYGGWANGIMIDDQRIIVVNTNARRNGDWSSISQEM
FT                   TVLCM"
FT   gene            332820..333668
FT                   /locus_tag="CNA01220"
FT   mRNA            join(332820..333017,333078..333257,333315..333668)
FT                   /locus_tag="CNA01220"
FT                   /product="cyclophilin, putative"
FT   CDS_pept        join(332855..333017,333078..333257,333315..333379)
FT                   /codon_start=1
FT                   /locus_tag="CNA01220"
FT                   /product="cyclophilin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40753"
FT                   /db_xref="GOA:Q5KPX4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX4"
FT                   /protein_id="AAW40753.1"
FT                   /translation="MNKTTDQAASSNLNKKSSVYVSGFAPEVDEEQLLQAFVTFGDIIE
FT                   IKIPHEPHDPKKHRGYAFITFSSAADAQEAIDNYDLNQLPGYQGSGKFLKCSLAQPSKY
FT                   VDESGRNDRAIWETEEWKAEHAGERPEEATE"
FT   gene            complement(333433..337375)
FT                   /locus_tag="CNA01230"
FT   mRNA            complement(join(333433..333689,333747..334282,
FT                   334333..334522,334573..335171,335219..335972,
FT                   336022..336119,336172..336304,336358..336779,
FT                   336853..336918,336971..336990,337043..337064,
FT                   337127..337132,337190..337375))
FT                   /locus_tag="CNA01230"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(333534..333689,333747..334282,
FT                   334333..334522,334573..335171,335219..335972,
FT                   336022..336119,336172..336304,336358..336779,
FT                   336853..336918,336971..336990,337043..337064,
FT                   337127..337132,337190..337235))
FT                   /codon_start=1
FT                   /locus_tag="CNA01230"
FT                   /product="ubiquitin activating enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40755"
FT                   /db_xref="GOA:Q5KPX3"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR032420"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR038252"
FT                   /db_xref="InterPro:IPR042063"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="InterPro:IPR042449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX3"
FT                   /protein_id="AAW40755.1"
FT                   /translation="MAAPMQVDEAVPGDSIDEGLYSRQLYVLGHEAMKKMATSNVLIVG
FT                   MKGLGVEIAKNVALAGVKTVTIYDPSAVEIADLGTQFFLREEDIGRPRAEVTAPRLAEL
FT                   NSYVPIKILPGAGEITPEMIEPYQIVVLTNATVRKQVEIDEYCRQKGIYFIAADVRGLF
FT                   GSVFNDFGKDFACVDPTGENPLSGMIVEIDEDEDAIVTCLDETRHGLEDGDFVTFSEIK
FT                   GMEGLNGCEPRKISVKGPYTFSIGDTRGLGKYKSGGLFTQVKMPKILQFKTLKESLTNP
FT                   EFFITDFAKWDRPAALHVGFQALSAFYEKAGHLPRPRNAADAEQVISLAKEIHSAAGGE
FT                   DVLDEKILTELSYQATGDLSPMVAVIGGFVAQEVLKACSAKFHPMQQNMYFDSLESLPA
FT                   TLPSEADVQPLGSRYDGQIAVFGKAFQEKISNTREFLVGSGAIGCEMLKNWSMMGLATG
FT                   PNGIIHVTDLDTIEKSNLNRQFLFRAKDVGKFKAESAAAAVADMNPNLKGKIIAHDDRV
FT                   GPETENVYGDEFFANLDGVTNALDNVSARQYMDRRCVFYCKPLLESGTLGTKANTQVVV
FT                   PHLTESYSSSQDPPEKSIPSCTVKNFPNAIEHTIQWAREAFDSFFVNPPTTVNLYLSQP
FT                   DFVETTLKSSGQHHEHLKQIEKYLVKERPMSFEECIMWARLQYENNYVNEIKQLLFNLP
FT                   KDQVNANGTPFWSGPKRAPTALAFNIDDPLDMEYLIAAANLHAFNYGLKGERDPALFRK
FT                   VVESMNVPEFTPKSGVKIQINENEPVENNGNDDEDDIEAIVSSLPPPASLAGFRLQPVD
FT                   FEKDDDSNHHIDFITAASNLRARNYGITLADRHKTKLIAGKIIPAIATTTALAVGLVCL
FT                   ELYKLIDGKNKLEDYKNGFVNLALPFFGFSEPIAAAKQKYGETEWTLWDRFEIEGNPTL
FT                   QQFLEWFQENHKLEVQMVSQGVSMLWSSFVPSKKAADRMRMRMSELVEHVGKKPIPPHV
FT                   KNLLVEVMVNDENDEDVEVPYVLVHI"
FT   gene            complement(337533..339337)
FT                   /locus_tag="CNA01240"
FT   mRNA            complement(join(337533..337884,337939..338016,
FT                   338068..338089,338144..338307,338366..338626,
FT                   338697..338818,338878..339337))
FT                   /locus_tag="CNA01240"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(337800..337884,337939..338016,
FT                   338068..338089,338144..338307,338366..338626,
FT                   338697..338818,338878..339120))
FT                   /codon_start=1
FT                   /locus_tag="CNA01240"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41273"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX2"
FT                   /protein_id="AAW41273.1"
FT                   /translation="MVPLSVSATAFFLASHLLIFLPQASASPSPIDVAGASEASVILDH
FT                   VGRDPVERAVLGSATTLSKRASGYTNPEDNGGYMLTIVNGTYPAGMGEPLNVILSGDSD
FT                   AEVLVKSADDGGFLNYMLSAGLGEECLGQHLGADQQANLGDDQGNVTEVEELRYNYGNP
FT                   YIGTCQETFNGGLHLRYWIQNTTGAYFMAVSVEKSLTEGHDIVVNGYNIGRDELVGNLT
FT                   GQSIDTRTLSNTSTLSGSATYNNYTYQTDVEYVPGLLENSSDGINHYLTVEEDGYPAID
FT                   GLVAVLTVRITDRPASSSFAFPTLSITPVALLVPLLSAILTLF"
FT   gene            339453..340821
FT                   /locus_tag="CNA01250"
FT   mRNA            join(339453..339687,339757..340092,340143..340350,
FT                   340401..340529,340583..340821)
FT                   /locus_tag="CNA01250"
FT                   /product="ubiquinone biosynthesis methyltransferase,
FT                   putative"
FT   CDS_pept        join(339498..339687,339757..340092,340143..340350,
FT                   340401..340529,340583..340691)
FT                   /codon_start=1
FT                   /locus_tag="CNA01250"
FT                   /product="ubiquinone biosynthesis methyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40757"
FT                   /db_xref="GOA:Q5KPX1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX1"
FT                   /protein_id="AAW40757.1"
FT                   /translation="MASTKSLLRSTRAFPCITSSHVRYIATSVPRRESQSTPGQTPPSS
FT                   KTTHFGFREIPEEQKETLVGGVFSSVASSYDLMNDSMSLGIHRLWKDSFVSSMLPRLPP
FT                   SFHRNPNDPVTEKPVFKCLDVAGGTGDIALRILDRAKDKFACRDIEVEIVDLNEGMLNE
FT                   GRKRVAKTMYYNTPQIKFTHGNAQHLPSHIADNSIDLYTIAFGIRNCTSLPAVLSEAYR
FT                   VLKPGGKIGVLEFGKVTNPLFREIYRQYSFQFIPVMGKILAGDSESYQYLIESIERFPS
FT                   QPEFAKLVQEAGFKTGQMREGRGGAWTDYTNGIATVWTGVKV"
FT   gene            complement(341238..342964)
FT                   /locus_tag="CNA01260"
FT   mRNA            complement(join(341238..341464,341521..341659,
FT                   341718..341959,342013..342137,342200..342280,
FT                   342437..342529,342591..342703,342848..342964))
FT                   /locus_tag="CNA01260"
FT                   /product="diphenol oxidase, putative"
FT   CDS_pept        complement(join(341419..341464,341521..341659,
FT                   341718..341959,342013..342137,342200..342280,
FT                   342437..342529,342591..342703,342848..342866))
FT                   /codon_start=1
FT                   /locus_tag="CNA01260"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41430"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPX0"
FT                   /protein_id="AAW41430.1"
FT                   /translation="MAGDKIQLYEFEGSVWSNAPKIALEEGGLKKDKDVRWTTINLPEG
FT                   ENFEPSYLKINPAGTVPTLVVGNDTFTDSISAVAEIVKIAPQRPRGKVSSGASIIEEIH
FT                   SAAIDPNATFLIATDDEDRKTKINGVPKGFLAGRQKTLNKLVENPPEEFKEFLTKKQAD
FT                   NKQLLEFFIAEPDEQTRKAHYAQGQQLWNSVGNALRGFITEALTKNNQGPYVGGNEPSE
FT                   VDFHLITWLARTITNTGVEPGTNADQAIKKLQAKTGGGALDDSIKLYWETWSARESFKT
FT                   LGVH"
FT   gene            complement(343412..345796)
FT                   /locus_tag="CNA01270"
FT   mRNA            complement(join(343412..344416,344470..344941,
FT                   344991..345132,345188..345252,345300..345796))
FT                   /locus_tag="CNA01270"
FT                   /product="U1 snRNP 70K protein (short form), putative"
FT   CDS_pept        complement(join(344221..344416,344470..344941,
FT                   344991..345132,345188..345252,345300..345714))
FT                   /codon_start=1
FT                   /locus_tag="CNA01270"
FT                   /product="U1 snRNP 70K protein (short form), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40758"
FT                   /db_xref="GOA:Q5KPW9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR034143"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW9"
FT                   /protein_id="AAW40758.1"
FT                   /translation="MSHLLPPNLLKLFAPRPQPPFLKPLTRDERIRGPNNLGGVAGLAK
FT                   RIKEEAEDAEVKQGMGMNPEKALDEQKEENVKMELKQDGEDGEVAEDSGKEKKKKTARD
FT                   KIAEMGIIGEEAVKMRKELRKKRQEEYKKNAESNYKPQDDAQAIGDPYKTLFISRLSKK
FT                   ANETDLRREFEMYGPIERIRIVRNRKGKSNGYAFIVYERERDMKAAYKDAEGIPIHHKK
FT                   ILVDVERGRTVKGWKPQRLGGGLGGRPKPVAPEASPAPYVAPSNLRGGRGGFRGGGRGG
FT                   GAGFRGGFQGNRGGFGGGNRGGFGGGDDRGGFAGRGGFRGGFQNRGDRGPGGFGQQQGG
FT                   FGGPGGPGGYGGQGGGYGGGGGGFGGPGQQNGVQGGQGGGGFGGGGGYKRDYDNAGGPG
FT                   GYGGGGGGGGGGFGGGGGGYQDRDPKRMRY"
FT   gene            346020..347625
FT                   /locus_tag="CNA01280"
FT   mRNA            join(346020..346416,346473..347044,347108..347158,
FT                   347221..347625)
FT                   /locus_tag="CNA01280"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(346070..346416,346473..347044,347108..347158,
FT                   347221..347579)
FT                   /codon_start=1
FT                   /locus_tag="CNA01280"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40760"
FT                   /db_xref="GOA:Q5KPW8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW8"
FT                   /protein_id="AAW40760.1"
FT                   /translation="MSVDPIVIIGAGPSGLLLARYLQLHHIPVVIYERDSSPTHRPQGG
FT                   SLDLHDETGLKALKETGLLDEAKSYMRAEGEAMKIVDKSGKIWYDENGKEVKAHTEFQD
FT                   GEPVTGRPEIDRTDLRNILIKCLNSDTIKWDHAVSSCSKISSSHYQINFISQPYITTPY
FT                   LIGADGAFSRVRPLIHSTLPSYSGVSMYELTIPPKNMTPELKTYVGQGCLLALDEGMTV
FT                   LPQMNSGGLCKVYVGLRCPENWTDENPLPDKGKREWLANLFQGWHDQVRDVIMASEEDK
FT                   LVIRRIWQFDPDLKWDTDLTGVTVMGDAAHVMSPFAGEGVNQALADALELGISLVSLFT
FT                   VPTPRASSPPFPLSLLPISQPRSKPLISSPSPADLHHALRHFERKMMRRARKEMIGSKE
FT                   NMDMFFGENAARNLTHWMSTFMIRFVWQTVTEWPVDFLKAIWD"
FT   gene            348168..351005
FT                   /locus_tag="CNA01290"
FT   mRNA            join(348168..348392,348457..349378,349432..349581,
FT                   349633..349687,349746..350650,350698..351005)
FT                   /locus_tag="CNA01290"
FT                   /product="rRNA processing-related protein, putative"
FT   CDS_pept        join(348251..348392,348457..349378,349432..349581,
FT                   349633..349687,349746..350650,350698..350911)
FT                   /codon_start=1
FT                   /locus_tag="CNA01290"
FT                   /product="rRNA processing-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40766"
FT                   /db_xref="GOA:Q5KPW7"
FT                   /db_xref="InterPro:IPR012580"
FT                   /db_xref="InterPro:IPR039754"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW7"
FT                   /protein_id="AAW40766.1"
FT                   /translation="MSDPRFASVKTDPRFRRPKQKNLKVEIDERFRDVLESEEFGGKTK
FT                   GGAKVDKRGRPVTASHKADQLKRFYRLKSPEAAEGEGEGFIDYARGEGALYSSGSEDES
FT                   DEDESEVEEEELEVGGKKKVRLPAMSESESESDDDHLDIDLSENEETSVFPPETDEIPS
FT                   DNESETEPVDPTKRIAVVNLDWDNMQAADLYAVFNSFLTRPATKGEVKAPSALGKLLRV
FT                   RIYPSEFGKERMAKEEQEGPGGGIFIGSKKKRDNKKERISIARKEESDDEEGNEEEDDE
FT                   EEENEVSDEDSDEEDEGDTEEENEDNYDKPARKSNDKLHKEIDGLEIFSDVGSEAGSED
FT                   IDMDQLRQYQLERLRYYYAIATFSSVAAAEYVMNECNGTEFEQTANILDLSYVPEDMTF
FT                   DEDSVKDEADKEPKAYKGNDFVTDALRHSKVKLTWDQDDPNRIKMTRRTLTREEIEEQD
FT                   FQNLVAASGSEVEESDFDDDEGAGGESKKDKKKKMKERKEKLRNLLLAGGDDEDGVTDV
FT                   WGKAGTAWANELEDIKSAALKDRSKSASKKAKKGEDLEITFRPGLSVAKGDGGEENMTS
FT                   LERYQLRMKEKKQRKKEKMELKAAARERGDEEKTDGQDEFFGSDSSEEEEEQQPKPKSK
FT                   PKSLEPTLPDEDDLAAIVGTNEPDSNFSMKDIIKTEKEAGKKRRRRKGKKGEQERDVEL
FT                   GPDDWKIDVKDDRFKALHEEPEFAIDPSNPHFVKTKAMQDLLAERTRRRNNQKKIEPEG
FT                   RKSATGVKNVEQKEQDLDSLVASVKRKMDQNQHKAKRKRTRK"
FT   gene            complement(349383..350988)
FT                   /pseudo
FT                   /locus_tag="CNA01300"
FT   gene            351218..354148
FT                   /locus_tag="CNA01310"
FT   mRNA            join(351218..351438,351491..351571,351630..351631,
FT                   351684..352616,352668..353033,353085..353331,
FT                   353381..353536,353588..354148)
FT                   /locus_tag="CNA01310"
FT                   /product="phosphoribosylamidoimidazole-succinocarboxamide
FT                   synthase, putative"
FT   CDS_pept        join(351270..351438,351491..351571,351630..351631,
FT                   351684..352616,352668..353033,353085..353331,
FT                   353381..353536,353588..354084)
FT                   /codon_start=1
FT                   /locus_tag="CNA01310"
FT                   /product="phosphoribosylamidoimidazole-succinocarboxamide
FT                   synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40768"
FT                   /db_xref="GOA:Q5KPW6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW6"
FT                   /protein_id="AAW40768.2"
FT                   /translation="MAAPSETTIQLSPEAEAQYERITRNLQEVTSGEVIRKVLSEGKVV
FT                   KAYWGTAPTGRPHIAYCVPLLKIADFLTAGVNVKVLLADLHAFLDASKSTLETVQYRVK
FT                   YYSKLLITVFTVLGVPTDKLEFITGSSYQLKPDYTLDVYRFHALTSTREAEHAGADVVK
FT                   ESESPLMSSLLYPGLQALDEQYLDVDFQFGGVDQRKIFMYAATFLPKLGYSKRAHLMNA
FT                   MVPGLSGGKMSASDPKSKIDFLDTAADIKSKIKAALCPPGEVENNGVIAFIKTVLIPIQ
FT                   ALRIEQAERRGEKAPVGEGSFVKPGAPEGTIFSISRPEKFGGDIHFKSYEDLEKAYVAG
FT                   DIHPGDLKTGVQEALIQFLGPIRKSFDEDKEWQEVERTAYPSSSVAPTAEEPKKAKKKD
FT                   VRSKPPTEEERAALRAAKEKEKAAKAAAKAVNEGTAPPVPPVEDITASQLAQSSKEAVQ
FT                   ITTSNATSSCVTSTNLSKLKLLAKGKVRDIYALPGKEDEDKLLFVATDRMSAFDVIMNN
FT                   GIPSKGITLTTLSLFWFDKLKNIIPNHVLHPSPSACFSTPAQAWEQFPRSLDEYRDQLE
FT                   GRSMIVKKCEVVKIEAIVRGYITGSAWSEYKKSQTIHGIQMPAGLVESQKLPKALFTPS
FT                   TKADQGEHDENIHPDKVKDICGPELAAKIEKAAIQLYTEAAAYALERGLILADTKFEFG
FT                   LLPDPSSPNKTTLILIDEVLTPDSSRYWAAADYVVGQPQPSFDKQYLRDWLIKEGLRGK
FT                   EDVTLPEHVVSETRSKYEEARDRVMGLGEFGKHGQKGKIAGDEVALQTDQATDAIEEEA
FT                   RKQL"
FT   gene            complement(353298..355335)
FT                   /locus_tag="CNA01320"
FT   mRNA            complement(join(353298..354080,354151..354284,
FT                   354336..354549,354603..354862,354924..355129,
FT                   355179..355335))
FT                   /locus_tag="CNA01320"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(354256..354284,354336..354549,
FT                   354603..354862,354924..355129,355179..355270))
FT                   /codon_start=1
FT                   /locus_tag="CNA01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW5"
FT                   /protein_id="AAW40770.1"
FT                   /translation="MGKFSEFLASSKGDHKADVPPPPSYGESSTSARPLTPPPPFPHSF
FT                   GCIHLARSDRIRLIGLPPVVYDDVEQAILRVWVPGLQGKFPMYQSLEWKLSGYPWSGQG
FT                   AEAVQARRLLCHVLHALSKHGWYLHMSVDLSKKQFDKDTLILHSVYPQERYFFSISFNE
FT                   GDKVRIIDPPNDHVKQAFMTAVRTWPRGIQNEREKEPGCYQFKLKGLPWYTSDGDQIIH
FT                   ARLLSCTILAAMDSVGFELKGSVDMSTGTSEHANDMDTWFFASK"
FT   gene            355979..357593
FT                   /locus_tag="CNA01330"
FT   mRNA            join(355979..356045,356096..356126,356174..356238,
FT                   356289..356487,356536..357054,357113..357292,
FT                   357339..357593)
FT                   /locus_tag="CNA01330"
FT                   /product="actin ii (centractin-like protein), putative"
FT   CDS_pept        join(356023..356045,356096..356126,356174..356238,
FT                   356289..356487,356536..357054,357113..357292,
FT                   357339..357455)
FT                   /codon_start=1
FT                   /locus_tag="CNA01330"
FT                   /product="actin ii (centractin-like protein), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40772"
FT                   /db_xref="GOA:Q5KPW4"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW4"
FT                   /protein_id="AAW40772.1"
FT                   /translation="MATEFDDVLTNQPVVIDNGSGNIKAGFAGEEQPSCYIPSFVGRPK
FT                   HPRVMAGAIQDNLFIGRRAQEFRGLLKIKYPMEHGVVMDWDDMERIWGWVYGEGLKALS
FT                   EEHPVLLTEAPLNPRQNRDIAAQIFFETFNVPAFFTSVQAVLSLYSSGRTTGIVLDSGD
FT                   GVTHAVPVFEGFSMPHAVRRIDLAGRDITDHLQLLLRKAGHNLHTSAEKEVVRTIKEKT
FT                   CYLALNPAKVEKDQGGAWEEFKLPDGKVIQLGTERFLAPEILFNPELVGQEYPGVHQVI
FT                   VDSINRTDLDLRKSLFSNIVLSGGSTLCTGFGDRLLNEVKKLAVKDVKLKIYAPPERKY
FT                   STWIGGSILAGLSTFKKMWVSADEYKEDPDIIHKKAF"
FT   gene            complement(357466..359409)
FT                   /locus_tag="CNA01340"
FT   mRNA            complement(join(357466..357959,358212..358602,
FT                   358653..358731,358786..358871,358932..358990,
FT                   359047..359162,359236..359348,359398..359409))
FT                   /locus_tag="CNA01340"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        complement(join(357587..357959,358212..358602,
FT                   358653..358731,358786..358871,358932..358990,
FT                   359047..359162,359236..359283))
FT                   /codon_start=1
FT                   /locus_tag="CNA01340"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40774"
FT                   /db_xref="GOA:Q5KPW3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW3"
FT                   /protein_id="AAW40774.1"
FT                   /translation="MPQLKTYSEKPVVLLTNDDGPPCASSPNIYAFCKLLQSRLGWDVR
FT                   VVIPDCQKSWVGKSYAISDIVTANYFYPLEPDGLKGEITQTRRPLKEGESMEWVLLSGT
FT                   PATCANIALHNIYPGQIDLVISGPNHGRNSSTAFALSSGTLGATLAASLSVPIPGPLTS
FT                   PSLHEDHMPCIAISYGVVTRPVSDRVLELATETAVDVCQQLFDNWGEDKEVGGKGLVPI
FT                   YSINIPLVEAALEKNERKIVSTEMWRNAYGRLFKTTKLSKALYDPGDDPVQIAHGYMKS
FT                   QDKPNTVQTSTSLPSHPHTSKTSTAGPAALPTPAPPSPITPKNTKDEEQQLKFHFAPNM
FT                   HPLLFPPEGSVPEGTDAWAFAKGWISVTPMRAEYACLGAASIE"
FT   gene            359633..368152
FT                   /locus_tag="CNA01350"
FT   mRNA            join(359633..359891,359956..360111,360167..361947,
FT                   362000..362643,362693..362787,362839..363059,
FT                   363114..364266,364316..364467,364522..365229,
FT                   365282..365496,365553..365602,365653..366573,
FT                   366622..366796,366847..367892,367952..368152)
FT                   /locus_tag="CNA01350"
FT                   /product="splicing factor Prp8, putative"
FT   CDS_pept        join(359679..359891,359956..360111,360167..361947,
FT                   362000..362643,362693..362787,362839..363059,
FT                   363114..364266,364316..364467,364522..365229,
FT                   365282..365496,365553..365602,365653..366573,
FT                   366622..366796,366847..367892,367952..368020)
FT                   /codon_start=1
FT                   /locus_tag="CNA01350"
FT                   /product="splicing factor Prp8, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40776"
FT                   /db_xref="GOA:Q5KPW2"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="InterPro:IPR027652"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR042516"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW2"
FT                   /protein_id="AAW40776.1"
FT                   /translation="MSTVPPGFGAPPPGFTPQPNGNGDGMEGDFFGQLSQEEIDKKARK
FT                   WRQSQKRRFNSKRRQGGGGGVDFGKADLPPEHIRKIIKDHGDMSNRKFRNDKRVHLGAL
FT                   KYVPHAVMKLLENIPMPWEQVREVPVLYHISGAITFVNEVPRVIEPVYHAQWASMWLAM
FT                   RREKRDRRHFKRMRFPPFDDEEPPMDYGDNVLDVEPLEAIQLELDEEDDEAILEWFYDP
FT                   KPLVDTPQVNGSSYKYFQLALPQMANLYRIGRQLLSDYSDNNAFYLFDKKSFFTAKALN
FT                   IALPGGPKFEPLYRDMDAFDEDWNEFNDINKIIIRNVIRSEYKVAFPHLYNSLPRSVYI
FT                   GVYHEPKNVYIKTDDPDLPAFYFDPLINPISQRVVQEAHTPLVSHEDQVFGFGNDEDVE
FT                   FELPEEVEPFLGERDLENENTSDAIALYWAPYPYNLRSGKMKRAQDVPLIKNLYLEHCP
FT                   DGQPVKIRVSYQKLLKVYVLNALHNKPPKAMVKRNLFRSLKNTKFFQATTLDWVEAGLQ
FT                   VCRQGYNMLNLLIHRKNLNYLHLDYNLNLKPIKTLTTKERKKSRFGNAFHLCREILRLT
FT                   KLIVDAHVQFRLGNVDAFQLADGLQYMFAHVGQLTGMYRYKYKLMKQIRMCKDLKHVIY
FT                   SRFNTGPVGKGPGVGFWAPGWRVWLFFMRGIVPLLERWLGNLLARQFEGRNSKGIAKTV
FT                   TKQRVESHFDLELRAAVMHDILDMMPEGVKQNKAKTILQHLSEAWRCWKANIPWKVPGM
FT                   PAAIENIILRYVKSKADWWTSVAHYNRERIRRGATVDKAVVRKNLGRLTRLYLKAEQER
FT                   QNGYLKDGPYITSEEGTAILISTAHWFESRKFAPIPFPPLSYKHDTKLLVLALEKLKEA
FT                   YSVHGRLNQSQREELALVEQAYDNPHECLSRIKRLLLTQRAFKEAGIEFFDTYDKLIPC
FT                   YDVEPLEKLSDAYLDQFLWYEADKRRLFPSWVKPSDSEPPPLLVYKWCQGINNLTDIWD
FT                   TSEGESVVMMETVLARVYEKVDLTLLSRLLRLIMDHNLADYITSKNNTTLTFKDMSHIN
FT                   TYGMIRGLQFSSFVFQYYGLVLDLLILGLERASEIAGLPEAPNGFLQFKNREIETKHPI
FT                   RFYSRYVDRIHMLFRFTAEESRDLIQRYLSVQPDPNNENVIGYNNKRCWPRDCRMRLIK
FT                   HDVNLGRAVFWNVKNSLPRSLTTIEWEDTFVSVYSKDNPQLLFSMCGFEVRILPRVRTQ
FT                   HGEAYSLKDGVWNLTQESTKERTAQAFLRVSDQGIQDFNNRIRQILMSSGSATFAKIIN
FT                   KWNTCLIGLMTYYREAVVHTNELLDSLVKAENKVQTRVKIGLNSKMPSRFPPCVFYSPK
FT                   ELGGLGMLSMGFVLIPQSDLRWSKQTDSGGITHFRSGMTHEEDQLIPNLYRYLQPWEAE
FT                   FLDSARVWSEYALKRKEATASNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWR
FT                   VRQYFSQFFRLRNQPFIWTNQRHDGKLWQLNNYRVDVISALGGVEGILEHSLFKGTAFP
FT                   TWEGLFWEKACLQNGTRLLRADGSEVLVEDVQEGDQLLGPDGTSRTASKIVRGEERLYR
FT                   IKTHEGLEDLVCTHNHILSMYKERSGSERAHSPSADLSLTDSHERVDVTVDDFVRLPQQ
FT                   EQQKYQLFRSTASVRHERPSTSKLDTTLLRINSIELEDEPTKWSGFVVDKDSLYLRHDY
FT                   LVLHNSGFEESMKNKRLTNAQRSGLSQIPNRRFTMWWSPTINRANVYVGFQVQLDLTGV
FT                   FMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQEMEALQIETVQKETIHPRKS
FT                   YKMNSSASDILLFSSYKWQISRPSLLTDNRDTMDGTTSNKFWLDIQLRWGDFDSHDIER
FT                   YARAKYLDYSSDSQSIYPSPTGNLIAIDLAYNLYSAYGCYFPGLKPLLQQAMAKIMKAN
FT                   PALYVLRERIRKGLQLYSSEPTEPYLNSSNYSELFSNQIIWFVDDTNVYRVTVHKTFEG
FT                   NLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALVRSLPVE
FT                   EQPKQVIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQATLKMEKFGDLILRATQPQM
FT                   VLFNLYDDWLKSISSYTAFSRLILILRALHVNNEKSKIILRPDKNTITESYHIWPSLSD
FT                   DEWMKVEVALKDLILADFGKRNSVNVASLTASEIRDIILGMEIAAPSVQRQQMAEIEKN
FT                   TEAAAQVTALQTKTTNIHGDEIVVTTTTQYEQQTFASKSDWRVRAISATNLPLRVNHIF
FT                   VGNDDVKDDAGSYTYVIPKNVLRSFIVNADLRTQVVAYLYGTSPPDNKQVKEIKAVAWI
FT                   PQRGTNNGVDLPVTLPKHDFLLKDLEPLGWIKTQSQELNHLSPQDVTTQAKIMAAHPEW
FT                   GPQSICVTCSFTPGSVSLNAWDLTVAGFEWGRKNEDVTGQNPGFNPSMANRVQLLLSDR
FT                   ILGMTLVPEGGIWNYGVGLTQSWSEKIPYTMTLDKPEAFWAPCHRPNAFLNFASMEGDD
FT                   AADVENSLE"
FT   gene            368358..374979
FT                   /locus_tag="CNA01360"
FT   mRNA            join(368358..369529,369580..372019,372069..372454,
FT                   372504..372672,372721..372972,373021..374021,
FT                   374077..374210,374270..374979)
FT                   /locus_tag="CNA01360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(368410..369529,369580..372019,372069..372454,
FT                   372504..372672,372721..372972,373021..374021,
FT                   374077..374210,374270..374752)
FT                   /codon_start=1
FT                   /locus_tag="CNA01360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40778"
FT                   /db_xref="GOA:Q5KPW1"
FT                   /db_xref="InterPro:IPR024298"
FT                   /db_xref="InterPro:IPR024340"
FT                   /db_xref="InterPro:IPR024880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW1"
FT                   /protein_id="AAW40778.1"
FT                   /translation="MEDNHVSEHPPESTTPASHLFDSIDSEGGAADDPFAQFGSEQDDY
FT                   APQRQVQEEEHKPGFQATTEGEAPTPVAQVEGSRTPIPANVLEKQTEEKAAYAPEETEE
FT                   VQGGGKTQEFIGEQQGSHITSSPVQEPTAGHLFGPVSDGSGEDLFAQLAESEKDEFTQP
FT                   EQSQDILKSEGIDQSEAQGQTEVSVPHEEKDYSDLLAEFEAENGMLEPPIGGPVKSHSE
FT                   SKGEGIQSLLGQSDTKNDQTPAASSLFIDDPNDSVFDNIIPESDSEPQEAPLSTTAGTL
FT                   TNPSIQGLFSNDTTDFLNQGQIITEAQEAGGLDQSGVEPLDFDIPQGWYDDDGQWQWYT
FT                   EEEKEQVKFAMMGPTSWQETEQAPPPLTAGAGATLTPVVPRSPALQSQAAMSENAARRT
FT                   PQPEPIAAFDSSIYEPPVPASTQLATSTASYFPANQSGYTSAPPANVPPQVTRSATLPA
FT                   SSFSVTAAAPSPHVSSNPKSYNAYDPPVSTKPYHHRSYAPATQPTPSPYNPASLGNVFT
FT                   SPTDATLAKSEPPKPRPQPQRAVSTAYDPPFLRTQEKISRPASAVSTGVSSAFGVSPIV
FT                   PSHQIQAPPLPPSGPPKRSKGESRPPSRGPAFAPPPITPFGSPPPVPPLSVPPSGPPRR
FT                   PTGTSRPPSRGPAYAPHPKPQSSVPPVPPLPTLPVEVPGSHTEDNSVAHGRDSLNFPGS
FT                   SEVNEPSFTRPNVCSPEGGDEDRPPSRGSQAISPSLAPHTLSVSAEPIQAPPSAPPGQS
FT                   IGTTELRGHNQTSAPSPMTHIPASSLSEKPTSYAPPEFQQKAQQPQPSSYEQVPYTHDG
FT                   WEADRSLISAQLSSYEPTPHAPSDSHSDHEAETFKAIASAPAAESYEPSSYAPTQSDYY
FT                   KPGPEATTQPTSYKPDPYAPSSTSAVGLQSQSSPYARTTSPAHSSAYGTSPPTNHIPSM
FT                   AASGNTFVHAPYAGQSAYQSQNESSVRQSNLSMNRSSMPSSTSLYVPSQSSSNYNPVGS
FT                   PAQSPTYGMSPPSTNYFQSMPAQRSASIDTSYVPQQVLEQKPISEDPLARTTLASRNAP
FT                   IAVFGFGGVLITAFPGASESDNFAKGHARIPSYGYASGRGQLWIRNISEVVAPGALKSD
FT                   QSAFPGPLVNDISGPKGAAGEKKKKEAVLAYLRDRAEEVERGLPYLKSSASRARREDEG
FT                   RLVLLRLLEALVIGEGKLAGNPKVEDAIRVALSNPSSPNVPTAPGHVTTLSNGLYPSTS
FT                   SKSASPVAANPSQLSRLSTLLAQGQKKEAAEYAIDHGLWSHALVISSAVGAELWKDTVM
FT                   RFTAAELSARSEGTAGIRASYALIGGMSHSSLDDLINAATITEDPSQDQWREVISSVLF
FT                   HAKPADLACLDELGSRFLQMGLVNAAHACFLLSPLSPFLDTTPASYERGIMMTHNTRDE
FT                   ESTIFVEIAEYARSLVPVPKGQEQITVGLPQLLPYKLARAWRLAELGEVALAKRYCAAI
FT                   EAGAKPLTKSAQIQSLLPPAFMASLEDLLERLTGTPSIDPANVLGGGRKSSKPGFDKLG
FT                   SWIEGRLTKFIAGEEGEKAIPKPAASSGKAEGPFAHFSSVSPDPSGSISRNPSMADVGS
FT                   YSASNGFLGVQPMSRTTSPAVQGQYNPYGQQSQPYGAPPKSTLDVRSLSPATSHSAQAH
FT                   NNLYTSQSQPSSSTSSSYGDSQGRRTDFGGGFTPWASNAGSEVQAEDGEMTPHAYEAPV
FT                   GDDQAEFITPMAGLSIGPSTSGTLNYTPRASQPAYDLGDEGEDLGFGNTSLSKGRPTKT
FT                   VGEGEGKGEASGGKPTKGGKEEPKKEEPTQPAKQEQHQSSSWLGRLWGKKEGGPVKANL
FT                   GEETSMVYDPDQKRWVVKGAKGASAAPAAPPPPPRAQTASPSHTSRPAPSTRAMSAAPP
FT                   PPGPSSSDGSFSTLPRSANVPPPPAGMSASTFAEGPDGGIRRMKSSLTMSQGQGPPSGP
FT                   LSGPPSGPPSQPPSRTSSASATSASLDDLLSGSRPASKRPGSAMKKGARNRYVDVFQSE
FT                   GS"
FT   gene            375851..376708
FT                   /locus_tag="CNA01370"
FT   mRNA            join(375851..375939,376155..376207,376271..376325,
FT                   376392..376460,376529..376708)
FT                   /locus_tag="CNA01370"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(375931..375939,376155..376207,376271..376325,
FT                   376392..376460,376529..376624)
FT                   /codon_start=1
FT                   /locus_tag="CNA01370"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41408"
FT                   /db_xref="GOA:Q5KPW0"
FT                   /db_xref="InterPro:IPR010530"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPW0"
FT                   /protein_id="AAW41408.1"
FT                   /translation="MPVNRAVMKKWFPVEVMPIFGIVGIACVGATAYLWKLSQGPEVVW
FT                   DRSSDWRPWDKVKHDENLKYITVNPEFWAQRRAQAAGTKTGERAVDAI"
FT   gene            377183..380656
FT                   /locus_tag="CNA01380"
FT   mRNA            join(377183..377357,377408..377489,377547..377660,
FT                   377712..378306,378361..380229,380303..380362,
FT                   380422..380656)
FT                   /locus_tag="CNA01380"
FT                   /product="peptidase, putative"
FT   CDS_pept        join(377257..377357,377408..377489,377547..377660,
FT                   377712..378306,378361..380229,380303..380362,
FT                   380422..380453)
FT                   /codon_start=1
FT                   /locus_tag="CNA01380"
FT                   /product="peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40780"
FT                   /db_xref="GOA:Q5KPV9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR034187"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV9"
FT                   /protein_id="AAW40780.1"
FT                   /translation="MVAFHASSALLSFALLAPGFANAFNLDDIKRGSDSVLPGRYIVEF
FT                   DSDAHLTSAGLKRAATPHEYFYKELDARSSSYTVHQEYDCDLFYGASLSISSDVDLESL
FT                   LDIAGVIDLRAVHLLTLPAEPLSKENTQWSASSHSSSSSSASATASAASTSAPFSNLPQ
FT                   IQADVVQASGNKGKGIKIGIIDGGVDYTREPLGGCFGPGCKIAGGYDFVGDDYDGTNDP
FT                   VPDNDPYDNCYSHGTFISGIIGANENVYGAVGVAPESSLYVYRVFGCNGAASDDIVLAA
FT                   MQKAYDDDMDVINLSLGEPSGWTESTLSVFASRLVARGTILTISAGNQGQVGGFYSYSP
FT                   SAGKGVINVGSSDSSIYPAHLATVSTGYGPIAYYNYKAYSDKTLPLYTFDSDIYGCTLP
FT                   DDVPDLSPYLVVVRRGGCSLSEKAQNVYNAGGTAIFVVNDETSLPIYQNFPLIDFALIS
FT                   DDDGNYLLNQLNTSANTTVSFSFNPIALPNIWTANTTSYFSEIGPTNDLYFAPSVLAPG
FT                   TNVVGVTPTAFYNWTIADGTSYSSAYAAGAAALYLAAKGTNNVSPSDVLSAFEVTAQQL
FT                   PVSVSDSSLVSVAVQGAGRVQLSDAIYAVADISPSEITLNDTANFDKLHVLTIKNPGKK
FT                   WVTYKLSHEPAGTALAFQSGLNQSNDQPLPQVSNAASVNIFPSSLTLWPGQSLLTTVKF
FT                   TAPTGLDAQTFPIYSGFIKVTGGGSTVKVPYMGVAANMKDMPVLDPTDWYLGMNSPAIV
FT                   DVDGNVQQGPATYTFSNVSYPSVLYRLAGGTPLLVIDLIDANANLTFTPDYTTRKRSPT
FT                   FEQETENDERRRSLSARRLKSTGASFAATTKSKGLHSLWCHLTHYKASGCSKTGSTFQQ
FT                   VSIIGNLYVGEYLPRSTDNVDGQGGDYSTFELSSATFSNGTTIPNGDYKFLMRALHITG
FT                   DNTNESDYESWVSQSFTVAQ"
FT   gene            380876..382694
FT                   /locus_tag="CNA01390"
FT   mRNA            join(380876..381194,381266..382402,382457..382694)
FT                   /locus_tag="CNA01390"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(380984..381194,381266..382402,382457..382509)
FT                   /codon_start=1
FT                   /locus_tag="CNA01390"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40782"
FT                   /db_xref="GOA:Q5KPV8"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV8"
FT                   /protein_id="AAW40782.1"
FT                   /translation="MSGDPPGPPPGRPPVANVPYIPQPGAPAAPSFRPPAAPGFGFPPG
FT                   PSPGMPFSVGGFPHPLLPPGWSEHRAPDGITPYYYNAQTRESTYIRPTFPPFPLGTTPP
FT                   TGSPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKENKR
FT                   SEWTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDAERRK
FT                   KEEAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAVAAEFA
FT                   EKDAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEKDISPFA
FT                   PWDQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKAEPEKEYQ
FT                   ALLDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGERKRAAAQKA
FT                   EEDFNSSL"
FT   mRNA            join(381233..382402,382457..382694)
FT                   /locus_tag="CNA01390"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(381238..382402,382457..382509)
FT                   /codon_start=1
FT                   /locus_tag="CNA01390"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40783"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="InterPro:IPR036517"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV7"
FT                   /protein_id="AAW40783.1"
FT                   /translation="MKVLTHVSIAPDGITPYYYNAQTRESTYIRPTFPPFPLGTTPPTG
FT                   SPVHGAVTPGGTGAGEEKTKKKKKEKPKDKVPIPGTGWMRITTTEGNVFYFEKENKRSE
FT                   WTVPDEIKEAVTQLEEEERKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDAERRKKE
FT                   EAEKERKRKQGEGGEDDAPEEKKARVGDQEQVEEDVVGPEGEDDKEAWMKAVAAEFAEK
FT                   DAQTKKDLEEQDEKTKKEEAEAAKKVFAVPEKVNFSVEEGRALFKALLIEKDISPFAPW
FT                   DQSLPLFINDPRYVLLSSTKDRREVYEEYCREVGRAKRLKKGSSAEEKKAEPEKEYQAL
FT                   LDKEVTSTRTRWDDFRKKWKKDRRFYAFGRDDHQREKVFKQHLRDLGERKRAAAQKAEE
FT                   DFNSSL"
FT   gene            complement(382812..384548)
FT                   /locus_tag="CNA01400"
FT   mRNA            complement(join(382812..383465,383535..383685,
FT                   383763..383970,384024..384143,384205..384385,
FT                   384470..384548))
FT                   /locus_tag="CNA01400"
FT                   /product="expressed protein"
FT   mRNA            complement(join(382812..383465,383535..383685,
FT                   383763..383970,384024..384143,384205..384424,
FT                   384470..384548))
FT                   /locus_tag="CNA01400"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(382957..383465,383535..383685,
FT                   383763..383970,384024..384143,384205..384385,
FT                   384470..384542))
FT                   /codon_start=1
FT                   /locus_tag="CNA01400"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40786"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV6"
FT                   /protein_id="AAW40786.1"
FT                   /translation="MPDSDSDSSTDFFISKRKPNLKATNSEEDPEGSGRKKKKRLNSRK
FT                   PQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTTAAEDGGGKKKERRRV
FT                   ELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAISPVASSPQKEEVVDIV
FT                   VKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVMGDKLQRAPDDIILIYEG
FT                   KRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRIENFDLDFDRSPSPQLIPQ
FT                   AHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYTQNLARANSDSPAVAEDSIK
FT                   LVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDANKMELVFDGETMGKDMTVGD
FT                   MDCEDGDMLEVRIL"
FT   CDS_pept        complement(join(382957..383465,383535..383685,
FT                   383763..383970,384024..384143,384205..384424,
FT                   384470..384542))
FT                   /codon_start=1
FT                   /locus_tag="CNA01400"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40785"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV5"
FT                   /protein_id="AAW40785.1"
FT                   /translation="MPDSDSDSSTDFFISKRKPNLKATTPPPIRSPSPAPSDSEEDPEG
FT                   SGRKKKKRLNSRKPQSKLPEWARQTNEQRRERKRSSVARASTETRDRERSTSLFTTTAA
FT                   EDGGGKKKERRRVELTPPPVISEKKNQELRELVQRMYGGGSALDLLDDDDLEPQAISPV
FT                   ASSPQKEEVVDIVVKMELDPVKKANAPAAAVRMYERPTTLKLRREETMFRALEVMGDKL
FT                   QRAPDDIILIYEGKRVYSRDTARQLGILGGSSVEMKGYEKSYWDRLEAERLRRIENFDL
FT                   DFDRSPSPQLIPQAHAEVSAASKSKSQPQSVGASQLYAGLAPLVVEPPSNPYTQNLARA
FT                   NSDSPAVAEDSIKLVVRGADGKEARMKVAKTVTAHTVLRFYCKKIDRPKDDANKMELVF
FT                   DGETMGKDMTVGDMDCEDGDMLEVRIL"
FT   gene            384608..386896
FT                   /locus_tag="CNA01410"
FT   mRNA            join(384608..384685,384741..385518,385581..385960,
FT                   386052..386896)
FT                   /locus_tag="CNA01410"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(384953..385518,385581..385960,386052..386524)
FT                   /codon_start=1
FT                   /locus_tag="CNA01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV4"
FT                   /protein_id="AAW41271.2"
FT                   /translation="MEGAKAEGAGGDERDGRGKQAVEHHQVKKRFEAYRSVLRFPSLQI
FT                   TQDTTPTCNQMPPDPPWRTPLGRTFFHLPSPVGEYTQHESNKAEGESAKGSSYTDILKR
FT                   TFKDFSDVSVGSDVEIVHLHRQYPPKASAAAEEELEEGELEQDDWTVDIEPMRGYVEDD
FT                   SNSIIFDDDDDGEPPNEPADLPSFHGECWNCLQQGHSLTHCPYPRNHLQINHSRELFFY
FT                   ARDNLPPPRTERYLHDYLNMRVTVQEKERRLELLGKFRPGKIGKELDHAARMLVDDSDS
FT                   GEMLVDEIQWDKREYEWIQNIAKWGYPPGWTTALNPIEFLKDRISSLEAYDTAYRLTPE
FT                   PGEELVIFGADDDEDDEGSSMRDVTLGNADEREKSKEEGDDGSEMSIVSDSPSPSSLPL
FT                   SPASSRSPPTPSDIPPPPSPPPDLPPPPPPPPCDLPPPPPPNRWADYHTDMFASSRLVV
FT                   YDETRPFVLGTYAR"
FT   gene            complement(386614..388777)
FT                   /locus_tag="CNA01420"
FT   mRNA            complement(join(386614..386889,386972..387188,
FT                   387264..387382,387463..387676,387746..387904,
FT                   387961..388165,388232..388365,388427..388777))
FT                   /locus_tag="CNA01420"
FT                   /product="oxidoreductase, putative"
FT   CDS_pept        complement(join(386757..386889,386972..387188,
FT                   387264..387382,387463..387676,387746..387904,
FT                   387961..388165,388232..388365,388427..388625))
FT                   /codon_start=1
FT                   /locus_tag="CNA01420"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40788"
FT                   /db_xref="GOA:Q5KPV3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV3"
FT                   /protein_id="AAW40788.1"
FT                   /translation="MSNVFPYPARKVQGYPTFLPEQPQPIGSLLDDNEYKQNKNPPKLF
FT                   QPITIRGVTFHNRAFVAPMCMYSSDQGRATDHHFVHLGSMALRGWGSIMVEATAVVPEG
FT                   RISPEDMGLWDDSQIAELQRIVKYIHANKGIIGIQIAHAGRKASTPAPWNEREANEKGH
FT                   SKGSVVPEENGGWPSKVVAPSEISFLEGDYPDPIEASIEYLESLKKAYADTVERCSKIG
FT                   FDFIEIHGAHGYFLHEFVDPISNKRTDKYGGSLENRLRLPLEIAEIVRQKWDKPLFYRL
FT                   SATDWLEESLGKEKNANGEWVWWGIEQTTAFVGKLAELGVDLVDVSSGGNDLRQKIAPG
FT                   PSYQLPFAAHLKKTYPDLLIGSVGIITDAEQANDILEQGKADVILIGRQLLRNLDWPLD
FT                   AAVELGVAVAPAVQYERAWTRMLVKRETHDHTSKKHGVTELQGQEGQETKTPPGEHSSI
FT                   P"
FT   gene            388865..391048
FT                   /locus_tag="CNA01440"
FT   mRNA            join(388865..388944,388999..390591,390671..391048)
FT                   /locus_tag="CNA01440"
FT                   /product="expressed protein"
FT   gene            complement(388869..389784)
FT                   /locus_tag="CNA01430"
FT   mRNA            complement(join(388869..389590,389661..389784))
FT                   /locus_tag="CNA01430"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(388925..389590,389661..389705))
FT                   /codon_start=1
FT                   /locus_tag="CNA01430"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40790"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV2"
FT                   /protein_id="AAW40790.1"
FT                   /translation="MKNLIFRTSLTMTLGFLETLLDKKTKSRISETFVNISAKFVDEQM
FT                   LCGESLGVLDHCCRLFEIVGLPPPTAEVELDEYLYKAFFRGVIIILRDFKSNLPRNDRS
FT                   NNYTQIVHDNLGLLDAVWLFIHTADFYLLETFWDVAMMLVEVCEADAEGLVVALWCQAL
FT                   EVEVDKAEDEDRNGDMKWRELSRKRKQRFISNGNRLFDARDTRIGHEDLPRATMSDLNE
FT                   AWKYGKELLCPRMP"
FT   CDS_pept        390227..390532
FT                   /codon_start=1
FT                   /locus_tag="CNA01440"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40792"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV1"
FT                   /protein_id="AAW40792.1"
FT                   /translation="MYGAEDSELKAVRASKRPERRKKRPKEIVFPDLDLSKIRREVVNR
FT                   PHRRRSRGAVIQQLKLRCDGPEKSENQVVGVSEAGYEESGIGAGYEARYGSRSAKS"
FT   gene            complement(391036..395312)
FT                   /locus_tag="CNA01450"
FT   mRNA            complement(join(391036..391461,391512..391637,
FT                   391692..391799,391871..392229,392381..393997,
FT                   394082..395030,395088..395312))
FT                   /locus_tag="CNA01450"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(391247..391461,391512..391637,
FT                   391692..391799,391871..392229,392381..393997,
FT                   394082..394926))
FT                   /codon_start=1
FT                   /locus_tag="CNA01450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40794"
FT                   /db_xref="GOA:Q5KPV0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPV0"
FT                   /protein_id="AAW40794.1"
FT                   /translation="MADPASPPSFDAIFAQQPVRRSSSTSTSSFANYTYSALQQHQQFN
FT                   SDAPLVDEPQSLSEQTRKQQRDPSKDSSNKRYLDMMSGLADGYGVINGRRQESLRKESL
FT                   PFNPQEDSTLIATAPKRGERNGLGRNGYSSPIGDIMFGPEQIIRNQPQRPSQQPSWGEG
FT                   RISEQSVHYASVQQPQYSSFQSSGPGAGSTGMDYLPPGTASSMNDTMLSNQVSPYLSHD
FT                   AASEGRPQQQQQQQQGEWGQEFIGVEQQQQYAQGEGQSNGMEDMLTMGDESPFENELQR
FT                   VISNTSHPSQYPSRTTSPFPQQSQSNIVPTSTGNHVRTESFPASRSPSPFPPQQASQTE
FT                   APNHVVSPPSMGQPTYPRASSSPRTNPNSPFFNKPQSPPALIIPNSPVLPSIVTQSTSN
FT                   NHSKGLNQSHTRHANNGAGGLFPPSNPALEHLTGMAGISPIAPNADGPMICIQPSTPIS
FT                   GLKEGRGLFDAALRRAGGAQRQGPQGQGESQQDQQQDGFNVPPPQSHPLPRTSSSDQIN
FT                   QDVEMQGMDFAAQMQSYEQQGWASDTLRIAGPSRPRAKSDSIIPSPTADSFDRQAFLAF
FT                   IGAGNAQPPPSNVEMQPGYVDVSEQWRNTVSAWKAGLGGGELSSQPTLDPRLLPGRESN
FT                   EAVYQQLLMQQQTGQLPRLDPDQLHQLTQIEAQRARFSLNTNVAPPKYEPGEFSPTSMA
FT                   FYQSMGLYPHATPEMSGTVSAPWSQTAFGQVPGPGLVGHPATAGPAQQHFLTPTLSHAT
FT                   VRRRSFGGGEHPAMGAGTPGYGMEFSSPFMGKSVGQIRGVNMGHRRAARSEDFGRGGTG
FT                   WGVGAGGSTAEFLQSITGDDGSLLPPSNRGHAMSHSRHSSTSSIRSASPALSISSQGSS
FT                   FSHHSPRMDMPDSMYPGHPIIAPATPLQVSGLYEEQQAPARVAKMKVTSVATEVASTSR
FT                   RTNSGIFKCPVPGCGSTFTRHFNLKGHLRSHNDERPFKCLYEGCPKAIVGFARQHDCKR
FT                   HMLLHEGLRLFECEGCGKKFARLDALTRHHKSEQGQECAITHPLPTNFDGSPMSESQYK
FT                   TYKGIKSTPEGSGRRQSSTASGSGSGSGKKRSKKSETSEED"
FT   gene            395993..396620
FT                   /locus_tag="CNA01460"
FT   mRNA            join(395993..396092,396145..396159,396240..396348,
FT                   396419..396620)
FT                   /locus_tag="CNA01460"
FT                   /product="expressed protein"
FT   CDS_pept        join(396072..396092,396145..396159,396240..396348,
FT                   396419..396522)
FT                   /codon_start=1
FT                   /locus_tag="CNA01460"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40796"
FT                   /db_xref="GOA:Q5KPU9"
FT                   /db_xref="InterPro:IPR031833"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU9"
FT                   /protein_id="AAW40796.1"
FT                   /translation="MNTAGSVAYGWGALIVAAGVSFYYAKKEIDARRKEAQIKGTRPME
FT                   KLSWEERIAREQQQGVQPSSITDQLKQASANKPSGGT"
FT   gene            complement(396567..399079)
FT                   /locus_tag="CNA01470"
FT   mRNA            complement(join(396567..397020,397077..397261,
FT                   397315..397340,397390..397563,397621..397925,
FT                   397985..397989,398058..398092,398145..399079))
FT                   /locus_tag="CNA01470"
FT                   /product="glycosyltransferase, putative"
FT   CDS_pept        complement(join(396644..397020,397077..397261,
FT                   397315..397340,397390..397563,397621..397925,
FT                   397985..397989,398058..398092,398145..398960))
FT                   /codon_start=1
FT                   /locus_tag="CNA01470"
FT                   /product="glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40799"
FT                   /db_xref="GOA:Q5KPU8"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU8"
FT                   /protein_id="AAW40799.1"
FT                   /translation="MLSLLSSRYTRYSPLLLLFLLGSTFLLFERSSSSSSTLPRSSIYD
FT                   YTSPATHCFWPGTDASDESAATSQPKIPANKGNVGKMKEWIGWGDSEEVDEDVPSGEGF
FT                   AWEGQLPDVVPVRGIERYMLAHIEELQQGYDAKHDYEEYGLKIGNISLSAYTAELLETY
FT                   KEYLLPPGTPPPNPPPSFLPIVLSRLSLRPPIAPLPPRPNQVMTTEKSVDDLPWQFQRW
FT                   KEIMPEWEIKYYDDNALKNWVRGMFGGTKAEKIWKNLPRQVLKTDVFRYMAMLVEGGIY
FT                   TDSDTAPIIHADQWGHPYNHHTSPLLTHLSRILSISTSPHLPSSHPLSSFSPDDAGTID
FT                   EELDVDVSTGKSTIYDGPLVDDGAELGQPSLVVSVESDAIDFGWHNWREVGLSRAVQIT
FT                   QWTFMARPGHPVFLDALGRTLRKSEEMARKEKEAKKNGEEFIPETALEWTGPGVFSDCV
FT                   YRYLISRYGFKPDDLIHKKDPLRVGDVLILPAGSFSSVSPFGDEQQRNWAASWHGFFGR
FT                   WRGADPGVQEFERLKKLKKEAEEAEKKAKEEAEEAERKAKEAEQQANETSEQADKSAQD
FT                   AEEKAKEAAEEAARKAQEASDKVEALGEEVEKAKEVAEGKSDGQDGGNGEFTESREETE
FT                   EEMLV"
FT   gene            399278..401589
FT                   /locus_tag="CNA01480"
FT   mRNA            join(399278..399654,399707..400626,400676..400731,
FT                   400783..401589)
FT                   /locus_tag="CNA01480"
FT                   /product="expressed protein"
FT   CDS_pept        join(400043..400626,400676..400731,400783..401471)
FT                   /codon_start=1
FT                   /locus_tag="CNA01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41414"
FT                   /db_xref="GOA:Q5KPU7"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU7"
FT                   /protein_id="AAW41414.2"
FT                   /translation="MTRNSLPHIQSRPDVISAPPNAPHDTHKKEASSDSSNRGGPSVDA
FT                   NIGRNKQAARQYSGVFSPLGTTFGLETPQLATPEVTSPDTSMIAVHGSVLGSPFPPEMG
FT                   RGKHGRCPFSDWECFAVTQQKQVGIVNAGSTNPADTISDHDAEVEVSEAAKDSSPVHND
FT                   RIIAIDFDDVCTQNMLAMITEHNTEYGTDLTLDDLETYVFWQNRGWGSPADVARKVKIL
FT                   NQLLPKTAPIPGFAAALRTLHSFGHPIHIVTSRPESDREAVAEWLEQEGITIGLGPEDV
FT                   IAAAWFTGTYSSAYPEIGEKGDTESAIERENVLNDKLKDIWKEGVGKGKGGLGKLKVLR
FT                   RINAALFIDDHHGNLEPIVKAEPPIPCLLFGAYGWNRSRSGLTSPVELMDYDERMSRGL
FT                   AFPFEEIITGKDHGLHRTKTWSDVIKWVKEWDREAMDVVCYDT"
FT   gene            complement(401376..403107)
FT                   /locus_tag="CNA01490"
FT   mRNA            complement(join(401376..401629,401690..401932,
FT                   401989..402058,402107..402246,402300..402525,
FT                   402587..402687,402740..402851,402914..403107))
FT                   /locus_tag="CNA01490"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(401605..401629,401690..401932,
FT                   401989..402058,402107..402246,402300..402525,
FT                   402587..402687,402740..402851,402914..403001))
FT                   /codon_start=1
FT                   /locus_tag="CNA01490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40801"
FT                   /db_xref="GOA:Q5KPU6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU6"
FT                   /protein_id="AAW40801.1"
FT                   /translation="MATVTTTAATSLLFKQATIAGAQVPPMAIGTWSWGDKTWGYESKD
FT                   FENIKEAWSASVKAGLTFFDTAEAYGNGESERIIGRLIKEGTSEENKARLYITTKFLPF
FT                   PTRNGFFLFNPPVVEHLKASLERLGLDSVPLYQLHSSISLNSHEKIAAGLAQCVKLGLA
FT                   KAIGVSNFSKDELIKMSDLLEKHGVKIASNQIEFSLLRQLPEENRLLEEMKKRGIACLA
FT                   YSPLAMGRLTGKYNASNPIPPGRRFSSQYSWEQLEPLISELGTLANKYEVTHSAVALNW
FT                   VMCKGAIPLGGARNKSQAEQNAKAVTFKLTDEEVDRLSSLGFSGKNTWFWQRG"
FT   gene            complement(403123..404974)
FT                   /locus_tag="CNA01500"
FT   mRNA            complement(join(403123..403244,403303..403557,
FT                   403608..404018,404070..404431,404484..404563,
FT                   404621..404974))
FT                   /locus_tag="CNA01500"
FT                   /product="alternative oxidase 1"
FT   CDS_pept        complement(join(403467..403557,403608..404018,
FT                   404070..404431,404484..404563,404621..404882))
FT                   /codon_start=1
FT                   /locus_tag="CNA01500"
FT                   /product="alternative oxidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40803"
FT                   /db_xref="GOA:Q5KPU5"
FT                   /db_xref="InterPro:IPR002680"
FT                   /db_xref="InterPro:IPR038659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU5"
FT                   /protein_id="AAW40803.1"
FT                   /translation="MSAILLRSGNVARSTILAGGPSIGGPMTLRSAYSSTRTFSIFTKA
FT                   KIQSGNMNRASLSLRPSVREAEKSQGPVVGSEGKGVEGPHYQDQASHNVLSDASTTGAW
FT                   TMFNPIYTEKELNTVQVVGRAPVTFGDKAAHKTVKFLRKCFDLLTGYTPYEVPASVLAQ
FT                   KPIPIAELRSKGKLLSDQKWLFRIILLESIAGVPGMVGGTLRHLRSMRLLKRDGGWIHS
FT                   LLEEAENERMHLLTFMTIAQPGIFTRALVLAAQGVFYNAFFLTYLISPRIAHRFVGALE
FT                   EEAVRTYTHCISDMEAGLIPEWKDMPAPAIAIDYWRLPASSSLLDVIRAVRADEATHRF
FT                   VNHSLANLDQKRDFNPFALSEASPEERGSKWGYTREESARFALEQQQKLMTASEKSKGL
FT                   VE"
FT   gene            complement(406120..410222)
FT                   /locus_tag="CNA01510"
FT   mRNA            complement(join(406120..406912,407219..407552,
FT                   407610..407836,407891..408033,408096..408378,
FT                   408428..408572,408628..408800,408849..408958,
FT                   409014..409113,409175..409271,409323..409407,
FT                   409469..409559,409614..409869,409929..410222))
FT                   /locus_tag="CNA01510"
FT                   /product="hexose transport-related protein, putative"
FT   mRNA            complement(join(406120..406942,406993..407552,
FT                   407610..407836,407891..408033,408096..408378,
FT                   408428..408572,408628..408800,408849..408958,
FT                   409014..409113,409175..409271,409323..409407,
FT                   409469..409559,409614..409869,409929..410222))
FT                   /locus_tag="CNA01510"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(406641..406912,407219..407552,
FT                   407610..407836,407891..408033,408096..408378,
FT                   408428..408572,408628..408800,408849..408958,
FT                   409014..409113,409175..409271,409323..409407,
FT                   409469..409559,409614..409869,409929..410066))
FT                   /codon_start=1
FT                   /locus_tag="CNA01510"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:A0A0S2LHV1"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV1"
FT                   /protein_id="ALO60292.1"
FT                   /translation="MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTITI
FT                   LTPHIASSLPPPRNPLTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLEGG
FT                   GVQWWSTAINVEINEEREWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNLGSC
FT                   LLVVLTTSLQVSVYAPVENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLEMRAS
FT                   SISWSPSLPLSSMLGVDGSILAVSDRIGKLALWTYGHQKRFQRLASISIGSPANWIADI
FT                   SWSDWTVKGDTCEALLALVFTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPISVDDSDR
FT                   RPITAVKWVKDVLVWTKAGSVHMFANDESQSVPWKGMRNLRLERVGDWANANGLSACVG
FT                   IHLINSSTLMITLSSLTTHFVYSFDESPEIAPTVENLRLTWPLRQMSLEPLPISQPYLV
FT                   ERWRELTSNHAGWTLQTSGWAAVGEYGNSLTWITEPINLHTLHVSADADRNSHFFMANF
FT                   DNVIPPEKPVLSALEEIVEKPPNLLRISSKFALLPFLLHLSSSLQEDLAADLLQFLSSA
FT                   VDGTADLKSMVALKNWPVDVWESSALNSLRICLVLTIWCTSAFPAFANEFQTLRLKIST
FT                   CLHSYLITLTLSWLVTTEIASRPIGSFDRRFLHRLIKSVEGSPGPTVAPIISVAAEANQ
FT                   SRARHLAAELGMDGDAGLSGEPDEDKETSADGSPFAAETCSVTGLPITEARCRRCTTCS
FT                   ACSLIPERDFALQAVVGRDGKPEAPRNIQTGIGQTDWIVSTLLEGAIGCVICGSRWASS
FT                   AGYAL"
FT   CDS_pept        complement(join(407208..407552,407610..407836,
FT                   407891..408033,408096..408378,408428..408572,
FT                   408628..408800,408849..408958,409014..409113,
FT                   409175..409271,409323..409407,409469..409559,
FT                   409614..409869,409929..410066))
FT                   /codon_start=1
FT                   /locus_tag="CNA01510"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41321"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU4"
FT                   /protein_id="AAW41321.2"
FT                   /translation="MTFDTSPTLLSSRVFRGASPDPTYRGISWSNEGQCMVVTPRTITI
FT                   LTPHIASSLPPPRNPLTSQQSMKISEAQKLSNIKPGIQATDSGYNNNNQQLKARRLEGG
FT                   GVQWWSTAINVEINEEREWLYGWGDVSDNYLSMVETDSKGATVRQATWSPSGLSNLGSC
FT                   LLVVLTTSLQVSVYAPVENPLTQRWVEIADLTMLTKELLPPKEILNGLTSRGMLEMRAS
FT                   SISWSPSLPLSSMLGVDGSILAVSDRIGKLALWTYGHQKRFQRLASISIGSPANWIADI
FT                   SWSDWTVKGDTCEALLALVFTDGSVQLLKIQQHAKQKLDSLSGWSCTIGEPISVDDSDR
FT                   RPITAVKWVKDVLVWTKAGSVHMFANDESQSVPWKGMRNLRLERVGDWANANGLSACVG
FT                   IHLINSSTLMITLSSLTTHFVYSFDESPEIAPTVENLRLTWPLRQMSLEPLPISQPYLV
FT                   ERWRELTSNHAGWTLQTSGWAAVGEYGNSLTWITEPINLHTLHVSADADRNSHFFMANF
FT                   DNVIPPEKPVLSALEEIVEKPPNLLRISSKFALLPFLLHLSSSLQEDLAADLLQFLSSA
FT                   VDGTADLKSMVALKNWPVDVWESSALNSLRICLVLTIWCTSAFPAFANEFQTLRLKIST
FT                   CLHSYLITLTLSWLVTTEIASRPIGSFDRRFLHRLIKSVEGSPGPTVAPIISVAAEANQ
FT                   SRARHLAAELGMDGDAGLSGEPDEDKETSADGSRKS"
FT   gene            complement(410561..412903)
FT                   /locus_tag="CNA01520"
FT   mRNA            complement(join(410561..411414,411466..411847,
FT                   411907..411966,412023..412102,412151..412193,
FT                   412250..412524,412607..412903))
FT                   /locus_tag="CNA01520"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(410778..411414,411466..411847,
FT                   411907..411966,412023..412102,412151..412193,
FT                   412250..412466))
FT                   /codon_start=1
FT                   /locus_tag="CNA01520"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40805"
FT                   /db_xref="GOA:Q5KPU3"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU3"
FT                   /protein_id="AAW40805.1"
FT                   /translation="MVMFSLDAFIFSTICLLSHLPAAFAFGVQSYPNLFFDASTIVNNE
FT                   WFNGIDSRWARAMSEYWAQTLIQYGPWSVTNKSIAAKSGDKKDYLSWAVYHWPDCSNVQ
FT                   NTTELTTEEVWDECDYVVRDGQVNPDTELVKDKEALQNMSNSIYLSAMAYLHTGDSQYT
FT                   THINHALHTFFINNETRMNPNLNYAQVIRGPGDQMGRHTGVLDLACMAKIVSGVQVMRS
FT                   IKPVEWQQETETGMMQWASEQLDWLYTSELGLAELNATNNHGTFAVNQVCALNVLLNQS
FT                   DACATALDDFYNGIYLDQIDANGDQPLESARTRPYHYRAYNLMALVTNAQFGDFVGLSP
FT                   SAWERRSAANATIVDAVHYAMLQNYTTSDELNQEKALNPVVAAISAKYGDPDNKYADFL
FT                   KSTDPYFPGQPWFALNEGLSDAGIKQGLLETTYGPVPPQPTLGAGSPDDLEYGKKRDWK
FT                   PRGAGWPTGAPRAP"
FT   gene            complement(413626..415086)
FT                   /locus_tag="CNA01530"
FT   mRNA            complement(join(413626..413825,413886..414105,
FT                   414159..414270,414318..414760,414818..414875,
FT                   414933..415086))
FT                   /locus_tag="CNA01530"
FT                   /product="glutamate biosynthesis-related protein, putative"
FT   CDS_pept        complement(join(413766..413825,413886..414105,
FT                   414159..414270,414318..414760,414818..414875,
FT                   414933..415035))
FT                   /codon_start=1
FT                   /locus_tag="CNA01530"
FT                   /product="glutamate biosynthesis-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40807"
FT                   /db_xref="GOA:Q5KPU2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KPU2"
FT                   /protein_id="AAW40807.2"
FT                   /translation="MRLFHLSRHLIQSKTFSLNRITFPVYSKMENNEKVLVGCIGGSGL
FT                   YHLDNLTFVKTVHIETPWGKPSSPINISSLPSGALVAFISRHGSHHSITPSEVPCRANI
FT                   AALKHIGCEAIIAFSAVGSLREEIAPGHFIIPDQIIDRTKGIREDTFFRGEGLVVHSMF
FT                   GEPFSQKLNAFVAPRVEKILKETGDVVLHTGKTVVCMEGPAFSTRAESLMYRQWGGDII
FT                   NMSVIPEAKLAREAELDYTLICTSTDFDAWRTGYDPVTVEEVVKVLHTNAGNSRAVAAG
FT                   ILQDVHDVVVEGKTLTDIKGSMKFACVTRKDIQPEASRKKLSYILPYFSD"
FT   gene            complement(415915..418212)
FT                   /locus_tag="CNA01540"
FT   mRNA            complement(join(415915..416160,416228..416894,
FT                   416951..417355,417408..417531,417585..418212))
FT                   /locus_tag="CNA01540"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(416062..416160,416228..416894,
FT                   416951..417355,417408..417531,417585..418149))
FT                   /codon_start=1
FT                   /locus_tag="CNA01540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40679"
FT                   /db_xref="GOA:P0CR02"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR02"
FT                   /protein_id="AAW40679.1"
FT                   /translation="MAVSKKSRKSEPSAAFTAADGLVLDQSEIMRAMLAAQKGKQKEES
FT                   EGNDESDEEDDDVSNEGEDEGESSGSEAESSVAAQRNLKRRRSLSFELDAEGEEDKENE
FT                   ESEPRPQPSSGAGMLSRTALATKDMTPKPRSKPQPNGLASASKPSADVTFESLGLSHPL
FT                   ITALASINIKKPTEIQAACVEPILSGRDCIGGAKTGSGKTMAFALPIVERIARDPFGVW
FT                   AVVLTPTRELAYQLSEQFLVIGKPLGLTTATIVGGMDMMKQAQELEARPHIIVATPGRL
FT                   CDLLRSGGVGPGKLSRVRTLVLDEADRMLTPSFAPELAYLFSQIPAKRQTCLFTATVSE
FT                   AIMELANKEPPAGKQRPFVYRVASDTLTVSNLKQKYLFIPSQIRDPYLLYILQNPLEDI
FT                   DVALRVDPKKAKAREREAALGKKGKKPRQAKEEEDAPSVPSTVIFTQRCATAHLLHLLL
FT                   NSLDIPSVPLHSHLTQPQRLLSLARFRAHEVPVLVTTDVGSRGLDIPEVAMVINWDCPR
FT                   RSDDYVHRVGRTARAGRGGVAVTIITERDTELVKIIEDEVNVRLEELKLDEDKVLEGLN
FT                   KVSLARRMATMEMHDSGFGERQATNKAKQIKRMKRDAAAAGKA"
FT   gene            418412..420712
FT                   /locus_tag="CNA01550"
FT   mRNA            join(418412..418721,418780..420220,420274..420712)
FT                   /locus_tag="CNA01550"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(418477..418721,418780..420220,420274..420645)
FT                   /codon_start=1
FT                   /locus_tag="CNA01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40681"
FT                   /db_xref="GOA:Q5KPU0"
FT                   /db_xref="InterPro:IPR006614"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPU0"
FT                   /protein_id="AAW40681.1"
FT                   /translation="MSPQQPANPSAASHNAQLLQSHDLVASLPTPYLRLLVLFARPIAL
FT                   FKHVLQVFLWSPGRRVESWMVVGAWWALCLGSQPAFRFLLPPLVFLPLLPLATLRLKHT
FT                   QKTPTENSPSSPATHDTLLLTLSDLNEIYALLPISPLPAMSDVYARFRQLGPVRLIRGL
FT                   AVLWGTWLVLGQLVVGYKTLLALIGTVILLLPSPPLAHFINLLSGSLFFRQAVALAFLF
FT                   TFGSPPETSYRFKLNFSLWGWFKSKWTASRRPSLAFAFRPKMSGKVPSGSALEVEREKS
FT                   EGKEESHIKVESPIYFRFEIHENQRWWMGLDWTSALLPQERPSWCDSHLLPVSPPQAFT
FT                   LPAPVSVVINTATMKDRYARVMRSAEWKWLDDDWSIVRSGPGASAAPGTQTNPVLPPEN
FT                   DPDSGHSLHQGQHHNQPQSPQARTASRPSSFISAFGSPTAYSPSSTEDSTSSAGSRAQS
FT                   IAEQAFTKGLERLKARAVSGTAPPATASSPRRSGESVRGRTGSYDATDEEGSEGTPSTQ
FT                   IGQQPGSAPLPSETIPERDAATDADGWVYGDNKWENVGSKGGLGKFTRRRRWRRRAICI
FT                   ETVRKLSPSDDPAITISPSATESGANTPTPATFAAAPSSPLKSKPAIGLSEAQTKGTTA
FT                   SEEVLESVKESTIPEHKIGPYGASSSGSAPVSRDEMLRMRLKKAMGSVGA"
FT   gene            complement(420703..423228)
FT                   /locus_tag="CNA01560"
FT   mRNA            complement(join(420703..421740,421797..421839,
FT                   421890..421975,422030..422104,422166..422653,
FT                   422724..422960,423052..423228))
FT                   /locus_tag="CNA01560"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(420896..421740,421797..421839,
FT                   421890..421975,422030..422104,422166..422653,
FT                   422724..422827))
FT                   /codon_start=1
FT                   /locus_tag="CNA01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHR4"
FT                   /protein_id="ALO60293.1"
FT                   /translation="MFFAPMTLVQLCSALIFMLLPVSAHIALWDPAMYGWDDDPNQSGP
FT                   VTPLMDLTFDQWWFHGYINSPPANNSIMELPAGGTYHGQVACNKALTSYGQDPAKQTGI
FT                   YACDGTGPSGGIGAMHTSDAWESSDPQDVKGCAIGIAYESNVAKIQPENFTVISVNYTC
FT                   PWKKQVEFQIPSDLPPCPKGGCHCMWGWVHAADAGSEQNYFLGYRCNITGATGVKPLPQ
FT                   ANTANKCDYPTDTSNCTLGAKQPHYWFQKERNNNFQDTYDPPFYNGAYGFMNGAQTDLF
FT                   DAVNKSNPTNTNVTTSSGNVNVSEALGSSVAVSSATVSASEGRSSLVISSPIVSSVSSS
FT                   TNVMATTSLTSQSVPSATTFSADVVAALQTSSSPSDSTRSSSASQTSAPSSAAKTSHAL
FT                   DGTADPSTTLKTTLTRTITMYRSSTTSTTSASSSSDASPSNSSFMASTSVITSESSSVS
FT                   IPSSISVAILYSPLVSTLSLSTSSLSSTFTAAATSPATTEIPPIVADANLSSTKSSTCK
FT                   RKRSGIRKHGIKEGRRKERVLGRAIGGAT"
FT   gene            complement(423424..426325)
FT                   /locus_tag="CNA01580"
FT   mRNA            complement(join(423424..423458,423514..423868,
FT                   423953..424038,424103..424181,424244..424302,
FT                   424359..424464,424519..424857,424909..425135,
FT                   425188..425325,425377..425471,425527..425680,
FT                   425728..425928,425985..426046,426095..426325))
FT                   /locus_tag="CNA01580"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(423524..423868,423953..424038,
FT                   424103..424181,424244..424302,424359..424464,
FT                   424519..424857,424909..425135,425188..425325,
FT                   425377..425471,425527..425680,425728..425928,
FT                   425985..426046,426095..426276))
FT                   /codon_start=1
FT                   /locus_tag="CNA01580"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41324"
FT                   /db_xref="GOA:Q5KPT7"
FT                   /db_xref="InterPro:IPR024881"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT7"
FT                   /protein_id="AAW41324.1"
FT                   /translation="MRHSSLALLSSLLLLSLPTFAFWPFKEKRFKDEAFINAGPLGLSK
FT                   LGGRVAAIGDWDGDSKLDLFTLSDEAKTVQIHLWNGDKYKYIPSHTLSLSERIINVVPG
FT                   DYNHDGHLDLLLMYDKSEGGGWWGSKVERLGMGVYLGGGPDGGFQEESWTLPLSTPSQP
FT                   MVYDADGSLRPSLLGYQPTETGEGVVCWRNNGTGFTLEIPQLRPIDQICTMANPHSSAF
FT                   VDIDGDCLPDLVLHCSRSKTVSFIQIWLNRGDAGYILARSYDLPSGSGPISFADTNRDG
FT                   SVDIIFPTCTHKSTSTGLGRDCSINIAQNKQVPLCSTEGSQWSTDGLLKCRGWGDMCLS
FT                   DEKFEFSFDESDPSFTSIPLSELLPDSSNPGILLHPPSDSSIPLPLRPGDFNVDGFPDF
FT                   LFVTSDDTKSSKSTQVNILENVPCAKGVIGCTKGVRRGWRLGHGKGWYDLEGITDAVGA
FT                   SWLDLDEDGSLDIMVQRSGDQIGHKVTFIQNNFYHDAFFLKTEVLNGVCDGKCEPVAGG
FT                   KSYNPLGVSYSGATYKFTVLDTAGHRVAQQVAQLPQTGYHALQTPYAFFGLGRTNNYVE
FT                   KLFIGVSLAPPNHITFLESLIPNSQVIINPPYPAAISSPDEKREEPRSPVKARSTEWKS
FT                   QLYLKPGEWVPWVGAAVLGTVIVLGTVVLGLNEREKREDERDRQRALHAINFQAL"
FT   gene            426513..428274
FT                   /locus_tag="CNA01590"
FT   mRNA            join(426513..426716,426768..426921,426978..427194,
FT                   427239..428139,428205..428274)
FT                   /locus_tag="CNA01590"
FT                   /product="(R,R)-butanediol dehydrogenase, putative"
FT   CDS_pept        join(426576..426716,426768..426921,426978..427194,
FT                   427239..427983)
FT                   /codon_start=1
FT                   /locus_tag="CNA01590"
FT                   /product="peroxisome assembly protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40683"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT6"
FT                   /protein_id="AAW40683.1"
FT                   /translation="MGEVYEGESPAESSRAPKVNQLDADELDDALVSMLGEKVLRSIDN
FT                   FKPKVSWDFKPEIELVIKLVIFRLGICDSLSRSSPGAKLQNLKLIHHPQLGIKTIRSAL
FT                   LLYLLLHPPIFPSYLLKRIRQHALSKQWPDLPNYDWRKKAWKALGRIELASKIWEASGW
FT                   AGFLWDGKYPSLLMRILGLRLVPSQPHLTKLVSYEFMNRQLVWSAFTEFLMFVIPLLPT
FT                   VPPFLRLSPSRFFKPISTFLSQPTDIDYSSLPPIPLDRRGLNCGDNEPRKHGGPLAHLP
FT                   KTTCPICYIRHSAAPVPLSSTSQGSSLTLPPIPGSSEAAFGHEASETDGEEECGIFMPA
FT                   RTDCDGGCLWCYYCIGEELYRHRKTNLQKIYRSKQMRNGRQELEKTDEEVKWNCLRCGD
FT                   GVTKAWRADSQDEAQLLYG"
FT   gene            428455..432306
FT                   /locus_tag="CNA01600"
FT   mRNA            join(428455..428750,428799..428936,428989..429085,
FT                   429141..429261,429311..431849,431901..432306)
FT                   /locus_tag="CNA01600"
FT                   /product="(R,R)-butanediol dehydrogenase, putative"
FT   CDS_pept        join(428723..428750,428799..428936,428989..429085,
FT                   429141..429261,429311..431849,431901..432181)
FT                   /codon_start=1
FT                   /locus_tag="CNA01600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41432"
FT                   /db_xref="GOA:Q5KPT5"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT5"
FT                   /protein_id="AAW41432.1"
FT                   /translation="MDNNAIQIAVRVRPWHPEKELPFVQRPSTQPFFQGDGNFGQLPQK
FT                   AAAGSLREVVDVIDHRMLDFDKPLEEPGKRGPFVMGRRYKNRKYVFDQVFGMGAEQEEV
FT                   FTKTAKPLLPGVLDGYNATVFAYGATGCGKTHTISGTEEQPGIIIRTMRELFDLVEETK
FT                   DKYDTYFEMSMVEIYNETIRDLLGDDYPNCPYGGLKLLENEKERVTIDKVTLKRPTSVE
FT                   EVMSLVMLGNDRRSTSFTERNSVSSRSHLVLQINVGRNERGTDIDVANSIVRQCSTSAT
FT                   LSIIDLAGSEKASVNRGQRMKEGANINKSLLALSGCISALCQRPVRGVRVHVPYRDSKL
FT                   TRLLKFSLGGNCRTVMINCISPSSKDIEETNNTLLWADKAKKVSTKVSRNTAGVELRTA
FT                   QWLQKIVTLEETIKTLRSQLDNSHNAKSGLQQKRLEKARAESREELGKVEAELDALLPI
FT                   IVEGSEMEALWSASVLQVEALEARLQDITVEVKDGRSEEDAKKEKDHLRSLILQQDDAF
FT                   RFNHEIQAGIQNKSLKYITLTNLLKKAEEKMFGEDIEEALYQHQLKVAEHKAHTARSVA
FT                   AARERGLRDYISQQAEALAKAASAFSRFSNQLRSEIIAVQSMQSGDDLASLKSRFLALG
FT                   NQVDQSTAVLFGKSHSLPAAPSQHRLPVSLAAPSPRRVSVGRHAHSPMRQNASPKSVLR
FT                   KNLFAGMSVPEKAIEAKPRQIRWPDETGEGKIDDRSIAPDCPIFSSPGSGGEDSVLEEE
FT                   TNPVSMIPPSLRPASSATSCASMSPAPSTSNTSASEEIPAWKQMRMARGLIPQSQSGDN
FT                   VGGNLSFDSKSPTSGSSRAGRTGFVGSSAKPGRPGPLSEMSIQTSAQPSPPSSSSTSSL
FT                   LKPTASSAAKANSSSAFANIKIAMPASATAGTMLPPPVPPHRRDSMIGPDRHGRPKQRL
FT                   SMIPGHAEASFSGVGKGLPSGGLSTLSGGARIVSNDSKRRMSVQAGSVGSTYSPPVRAP
FT                   SISSRPSLSNLRGAASCGDTSVSTSRGLSTRPSVNRLNVGDVSALAPLPRPSLSTRYSM
FT                   TRLNSGVTTGEGGGKPVWR"
FT   gene            432711..434139
FT                   /locus_tag="CNA01610"
FT   mRNA            join(432711..433160,433220..433246,433304..434139)
FT                   /locus_tag="CNA01610"
FT                   /product="expressed protein"
FT   CDS_pept        join(432732..433160,433220..433246,433304..433993)
FT                   /codon_start=1
FT                   /locus_tag="CNA01610"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40685"
FT                   /db_xref="GOA:Q5KPT4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT4"
FT                   /protein_id="AAW40685.1"
FT                   /translation="MPRGYSSSIGSASTYSPLLINPSSQPESSFVPPPTNGHRLSLRYA
FT                   YPLVPLASLDALYTLHHHISTSQGLPGDVLTIGIARALVLFAVGCTQRWRARGGWVGVV
FT                   KAVSIFMAIWEACRRVLSRNLENDGNEGLETNLIWFLMAFGGLGIVEYLVFLLLLRLSP
FT                   PPLRINPLALRLPRSYTQTDMPFAFHTESAILTPGSLRAQRRMHGRNISNVSRTTVRSD
FT                   WSRSERGVQGERDVFRVNDQFMEDGEDTDEDEGGSGEPVYEYDDYTSDGHDGFPEGDDA
FT                   SSVSSSSIIDLPPPLSPAALSVPTFPASLSISSRLGALDRSPVIGPLVRRTRSARFLGR
FT                   SWGSSTGREVDGEAELGQAGSSIGRDWCTREMDEGYGTFND"
FT   gene            complement(434025..438241)
FT                   /locus_tag="CNA01620"
FT   mRNA            complement(join(434025..434505,434572..435002,
FT                   435083..435500,435561..438241))
FT                   /locus_tag="CNA01620"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(434163..434505,434572..435002,
FT                   435083..435500,435561..438229))
FT                   /codon_start=1
FT                   /locus_tag="CNA01620"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40687"
FT                   /db_xref="GOA:Q5KPT3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT3"
FT                   /protein_id="AAW40687.1"
FT                   /translation="MPKPTFIQTVLRKPARSYADPNAPPPWSDSYRDADRYPASAASRY
FT                   APVDDYRPAYAHSHICHQDAGPSRRVSRAPSSVVSASAASDTSFRTTRFPKPSGKATHH
FT                   VVLRNGEIVHAPVGESVSEIGTASAAPSVRSSRRKEKPPPPVQAQPGNVPAKTTKKRKP
FT                   KPVIDRSDSSLCSTPPALHSRLSETSSASSSPLVPISPVAPTLPRVTQSAAEKQLKAAK
FT                   QPTRPPISVPANAPTALLTPPASRQSTPSSSSQSVTPPTPIPPKIELVQQVSNSDSDSE
FT                   VFYTPRSSFSFSFDAAAPVAIDAPLPEPIETPRAVDMAEPMLDPVVTPKPRPKTEILLG
FT                   APVFNLLPPTPAPIPDPISTPFHSQPTSPIDRSALHPDHLPHTTSRPTLAPRVINPPRN
FT                   TAEQPPPLPSKDDEDMESASGQAGSDDEEESARQPHRRAGGSRTPKSSSRPCSRAQSIR
FT                   SSSRRSHNAFEGISRSTSEASFGSGGGGGGGRDGASGASRASSIVAGFGKGGWAAAAAS
FT                   TGSRSGATTPVMYLPPNGTTGWEGFPPTPAGASNSPPRRQSKFTPLPAASLPSFDKLIN
FT                   SPSLAGGSIHSPSNASANGGNVPQALYDPSVSASVSASASVPVSYSSPSEYSQGSASDN
FT                   LPLPSRSYAPKLYSSETRQSSSSSRLSEADADGQEDNRQGLNTTRSELQRPEAPVYPPR
FT                   TPSPLPPSSSSPGRLSQSSRPTSPSLLTSESTWRPPQSQSQSQSPIPTRPTTPRAGFEP
FT                   PSFLDPDILTILPEMTPQDSERLYRSSPPPERSRSRLSMYHDNGGGHLSHSRKSSIFRG
FT                   SRSEVGHGPTAGHVHGGSEAGEEDDGLAELPLPSMIKRSKSAAGYRFTGGSKWEGSSYG
FT                   DGMLMESHGRDQESAPGYTNLILPLGAYKQSNPAKSAPDLDARILGLPHATMASITLHS
FT                   TFDHHNATPAHLRDQLPPLVEFSSHSKPPGKTGKNQVLVQVYAVAVDQVDVRAVDEKGR
FT                   GDVGKYVPGRSFVGRALVVGTDEKEVVRGDVVMGLLDIRKSGALAEYILVDRRRVSRAP
FT                   FPTLLTLEQLSILPLQGIAAARCVRGSLNRQFRAIIINAHTGIAALVCQVMSRAGVYVT
FT                   AIVPGGDDSHEAHQKCIENGAKGVLMGSPAAVMINLEENGYDFVFDTQGGQRVYDTAKR
FT                   ALKSGGKLVSTKRPETTLNRVPPHLASRPSGIKTLRTVFGSKRKDSKFIAFEYVSPIGS
FT                   GEPEIDASGMDCRDVMEEPCMATFRPVLEGENAVVPFERGADVFKRQGWDECGVRVVRI
FT                   IN"
FT   gene            438571..439981
FT                   /locus_tag="CNA01630"
FT   mRNA            join(438571..438659,438695..438828,438872..439981)
FT                   /locus_tag="CNA01630"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(438606..438659,438695..438828,438872..439961)
FT                   /codon_start=1
FT                   /locus_tag="CNA01630"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40689"
FT                   /db_xref="GOA:Q5KPT2"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT2"
FT                   /protein_id="AAW40689.2"
FT                   /translation="MDEEKLGMGRTEVALALKTILDPALYPLCIADVDGVSHTTLVVAC
FT                   LRKLQGWHMDSIVDEISRFAPNYEDLPLVAFISSFCAPPSSSSASAGAPSTADQFTLPP
FT                   PPYPAWLWPCPPSAQPRPKPRDRSSSTPAATPVSFNPLPFPHPLVARKHPTMRLVFPPL
FT                   PPHAQTQLQSQPPGQQQQQQTLTALPLNSPGPIVPILPSPAHSDISRMPSLRHHREKST
FT                   TSSPTHTQSPPPPPPPATKDDAQTSVSPGPNAGAGVGRTDTVSDRAGSPEQGVLGVAAN
FT                   IVNASLNGIAGVLSSAGVTPPQAEEQAKSAKQAAVETPKDEEREGERERGDLTEGKAAN
FT                   QTITTSMNAFNMNREPTLSSSEMAESSTSGVTASADDVDDQDHLRESEGEEDEDDYDEE
FT                   EEEEEEEEEDIRATSQYISALDLAGF"
FT   gene            complement(440022..442370)
FT                   /locus_tag="CNA01640"
FT   mRNA            complement(join(440022..440137,440202..440405,
FT                   440461..440472,440535..440680,440752..440793,
FT                   440852..440909,440976..441148,441199..441354,
FT                   441426..441744,441879..442041,442104..442121,
FT                   442172..442370))
FT                   /locus_tag="CNA01640"
FT                   /product="glutamate carboxypeptidase protein, putative"
FT   CDS_pept        complement(join(440084..440137,440202..440405,
FT                   440461..440472,440535..440680,440752..440793,
FT                   440852..440909,440976..441148,441199..441354,
FT                   441426..441744,441879..442041,442104..442121,
FT                   442172..442257))
FT                   /codon_start=1
FT                   /locus_tag="CNA01640"
FT                   /product="glutamate carboxypeptidase protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40705"
FT                   /db_xref="GOA:Q5KPT1"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT1"
FT                   /protein_id="AAW40705.1"
FT                   /translation="MADPKFLQYVDDHKDDYINRLSKAVSIPSVSGNLSYVKDVEAMGE
FT                   FLLEQLTSLGVKAEKRAIGTHTLEGKEVDLPPVIIGQIGQDPKKKTLLVYGHYDVQPAL
FT                   LEDGWLYPPFELTPDPNGSGRLYGRGSTDDKGPVMGWLNVLEAHKKLGIELPVNLKVCF
FT                   EGMEENGSVNLDKFIESEKNKFFAGVDCMCISDNYWLDTKTPCLTYGLRGINYYEIKIS
FT                   GPDRDLHSGVFGGTVHEPMTDLIALMSKLVTPDGQILVTGIKDLIAPVTDDERAKFEAI
FT                   HFQMEDIHAAVGGEVTISDDTVTTLMGRMRNPSLSLHGIEGAFSAPGSKTVIPCCVKGK
FT                   FSIRLVPNLTVAGVTDLVVKYVEEEFKKLGSKNKMEVYLTHGGEPWIADPNHYSYRAAH
FT                   KATESVYGQVPDYTREGGSIPVTLDFANILNLNVLLLPVGRGDDGAHSTNEKIDTDNYI
FT                   RGTKLLGTYMYELAAAQA"
FT   gene            442577..444745
FT                   /locus_tag="CNA01650"
FT   mRNA            join(442577..442633,442702..443088,443139..443411,
FT                   443464..443700,443751..443867,443921..444254,
FT                   444319..444330,444415..444745)
FT                   /locus_tag="CNA01650"
FT                   /product="expressed protein"
FT   CDS_pept        join(442592..442633,442702..443088,443139..443411,
FT                   443464..443700,443751..443867,443921..444254,
FT                   444319..444330,444415..444599)
FT                   /codon_start=1
FT                   /locus_tag="CNA01650"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41274"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPT0"
FT                   /protein_id="AAW41274.2"
FT                   /translation="MANPFSLINAPRPDDGSPPRQSGSSKFVILGPNIGQYFEVSSSEG
FT                   SSCSSSPSTPSHSPNRLNHQHSFDTSKGRSPSPTECDEIDRVEYSSPAIEMEACQMSGW
FT                   DSSVSELSEGDSETETSMIITPDRDIRDGQSQRLDIRDIALLLKQTSIKSEHPALRPNR
FT                   LLSCRTTSSHTVVPRDFNRRCSESCSVTSASSSSFHAPQPGELNQHGDTVACEACGRGT
FT                   TITNAKKIMPCQDVTCASCFSSTLGAVTVTQSQAKCPVCFCLIGTFEAVTLEDIVKLQH
FT                   CSEKSPTTTLPSPFEHGLGVGPVVMRIDNVAWDITPAIVEAFLPRNSLSHRTLQPIHIL
FT                   LDRFDGRTKDYLYIEAATPQAAQTILKTCQNTFLSGGALTSGRRRPVTITPVSHSELIE
FT                   ELRPHSAQELHSLLALCQAAIDSNSGSKQSTSKYIKSRHGPYYALMSTMSKMNGEQSPS
FT                   YWDMFYVASGAISALSKAITRQAYFRSSQGSPARSYPTDAITLVSEEDLLVRNKLLMLF
FT                   EKCFGMMPRAN"
FT   gene            complement(444655..449280)
FT                   /locus_tag="CNA01660"
FT   mRNA            complement(join(444655..446261,446315..446473,
FT                   446528..446865,446916..447160,447214..447941,
FT                   447993..449280))
FT                   /locus_tag="CNA01660"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(444822..446261,446315..446473,
FT                   446528..446865,446916..447160,447214..447941,
FT                   447993..448847))
FT                   /codon_start=1
FT                   /locus_tag="CNA01660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40707"
FT                   /db_xref="GOA:Q5KPS9"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025527"
FT                   /db_xref="InterPro:IPR031991"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS9"
FT                   /protein_id="AAW40707.2"
FT                   /translation="MPTPENKPAGKDSDPSSSFPISSPSFWAEAANIPIPPVDHKHPRS
FT                   SPAEADTGEVSSRVQDDSPLPKRPRTSTKSPDHGLTFLPNPQDIDPDDPQAYLANPEYA
FT                   PNRFGDIGDYMRKKEIKVQAQNASIAASVASGTLPQIFAGLSFYINGNTQPSMEQLRKL
FT                   LLQRGGTVYPVLRNKTMVDYIIAPVLTLKKHEEFKRHKVVKEGWVVESCRQDKLLDWRK
FT                   WRLQPDGEGSEAGAKGLESFFAQKAKARQDFVEPIEESSNDPIDKKLAAPVDEDTARNV
FT                   PSEVINVTPTKPIPMQLQRLLTPRKQRHAPIPISPGQPPPSPTFSAPVSPKIQKPEGAW
FT                   EHYYKKESNEHAAKALQSDTWRAQNTAEQGNAGGFIDGYYQNSRLHHLSTWKAELKVLV
FT                   RDAQKRSEEALAKAAVKELAEGGEERGQAVHSLAKSVLPSIPLPAVPSDSANRVIFHVD
FT                   FDAFFVSCGLATRPHLKGKPTVVCHSSGRGVGSTSEIASCSYEAREKGVRNGMSLGRAR
FT                   ELVGPDLKTMPYEFETYKRFSLAFYTVLMAYADELQAVSVDEALIDVTSHVAARAALPQ
FT                   ETAVGQKREERDPAVELAEKIRDDVREVTDGCEVSIGIAHNILLAKLATRHAKPAGVYH
FT                   LISEAIPSFVHRLSVEDFPSVGYSTKSKVEAAFKTTKAGELLDISKGRWKSVLGEKTGE
FT                   MLWGYLRGIDSRKLEGDKVRKSVSAEMNYGIRFQTQVQAEQYVHDLAAEVSKRMKNVGV
FT                   KGRQITLKLLKRHPDAPVEPPKFLGHGWCETYNRSSTLSAPGGGPTDDPKVLGTEGVKL
FT                   LRSLSIDPVELRGVGIQVTKLDTEGTERGQVDRPTGQRTLNFAKQSKNDTEPVAGPSRL
FT                   PAQAQNTEIDGLDAEFLAALPPSLASEVCRDHALNNSNATKAVAVQPSRTPPLEIISIP
FT                   SSTPPLKAESPRSLRPPSPQADTSPEKPISKLRGPNEAAHIARQLRPKTKVQMKAGMVA
FT                   EGPLFGAWSKAREKTVEVELDKTRHQKSTIVDLTNTSSPQGTGSDNKAELDEDQIVPGY
FT                   TLAYLRSLGIDPDVLLALPKAMRKEVIVQEEENARRRQALFQPGDRSRSRGTSTSVSPV
FT                   KLGGVGAYRGRSTSRSIPPQQRQSVKIIRPPKPALMNSTELPDVLRTIELWIESREDSP
FT                   PADKDAIKVAAFLKKCLNDGEGKVGDGVEKVVEVLRWMRMIIKEKWAQDEGLNEGASEA
FT                   GREWWRIWRQMRDEVNLICVKKFGAGLRI"
FT   gene            450060..451149
FT                   /pseudo
FT                   /locus_tag="CNA01670"
FT   gene            451436..453670
FT                   /locus_tag="CNA01680"
FT   mRNA            join(451436..451528,451599..451911,452076..452180,
FT                   452232..452364,452423..452704,452757..452849,
FT                   452910..453043,453098..453425,453476..453670)
FT                   /locus_tag="CNA01680"
FT                   /product="heterotrimeric G protein alpha subunit B,
FT                   putative"
FT   CDS_pept        join(452138..452180,452232..452364,452423..452704,
FT                   452757..452849,452910..453043,453098..453425,
FT                   453476..453521)
FT                   /codon_start=1
FT                   /locus_tag="CNA01680"
FT                   /product="heterotrimeric G protein alpha subunit B,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40709"
FT                   /db_xref="GOA:Q5KPS8"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS8"
FT                   /protein_id="AAW40709.1"
FT                   /translation="MGCTQSTEDAAAKARSAEIDEQLKRDRANLRNEIKMLLLGAGESG
FT                   KSTVLKQMRLIYNKPYDAEERDSYREIVYSNTVQSMRVLLEGVQFMDIPIDTSNQSRWE
FT                   LIMAAPPQIEGDVFPPKLTDAVAGLWKDYGVQQAFFRRNELQLNDSAPYYFDAIARIAQ
FT                   PNYMPTDQDILRARVKTIGITETHFKIGELTYKLFDVGGQRSERRKWLNIFDSVTALVF
FT                   LIAISEYDQKLYEDETVNRMQEAMTLFESVANSRWFTKTSIILFLNKIDIFREKLLVSP
FT                   LSNTFPDFRGGNDYDMACSFLLEKFVGLNNNPSKSIYAHYTDATDTKALKFVISAINDV
FT                   IIQVNLRDCGLL"
FT   gene            453979..455450
FT                   /locus_tag="CNA01690"
FT   mRNA            join(453979..453999,454061..454154,454223..454234,
FT                   454306..454515,454565..454691,454759..454906,
FT                   454970..455045,455107..455450)
FT                   /locus_tag="CNA01690"
FT                   /product="carboxyl-terminal proteinase, putative"
FT   CDS_pept        join(454107..454154,454223..454234,454306..454515,
FT                   454565..454691,454759..454906,454970..455045,
FT                   455107..455202)
FT                   /codon_start=1
FT                   /locus_tag="CNA01690"
FT                   /product="carboxyl-terminal proteinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40711"
FT                   /db_xref="GOA:Q5KPS7"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS7"
FT                   /protein_id="AAW40711.2"
FT                   /translation="MSEAPSKWVPLEASPDVFNAWSEPLGLPQSLAFQDLFSLDPSFLS
FT                   FIPAPHRAVLLLFPSKGKLQEERSKEDRDDGKQFKGEGIWWIKQTIPNACGSIGLLHSL
FT                   LNLPERGPDALNPDSKLAQFKAESLPLTGLERAKLLDETTFFTEAHTSAASTGQSVVPT
FT                   DLDVDEHFIAFVEGVDEKGEKRIVELDGGRNGPLDRGASNNFLEDVAKVVQEKYFERAE
FT                   GDVNFNMIVLAGKSDD"
FT   gene            complement(455193..457385)
FT                   /locus_tag="CNA01700"
FT   mRNA            complement(join(455193..455432,455477..455992,
FT                   456060..456245,456313..456438,456489..456609,
FT                   456663..456880,456941..457060,457124..457198,
FT                   457277..457385))
FT                   /locus_tag="CNA01700"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(455331..455432,455477..455992,
FT                   456060..456245,456313..456438,456489..456609,
FT                   456663..456880,456941..457060,457124..457198,
FT                   457277..457330))
FT                   /codon_start=1
FT                   /locus_tag="CNA01700"
FT                   /product="negative regulation of gluconeogenesis-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40713"
FT                   /db_xref="GOA:Q5KPS6"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="InterPro:IPR027714"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS6"
FT                   /protein_id="AAW40713.1"
FT                   /translation="MAPAYPANPLLLEEPLIRTSYELLRRSHRSAQRQVEKDFNAINSG
FT                   LQAILKSMEKGSITDEGRMEIVKKVDQVTERANGLKRKLDDLQPSASRPNTLRARLDYL
FT                   EQNFPGSTTPSKKTKPKGESNRAAASKADKADAASNDMQIDEEDATPLPSNEADKSEPT
FT                   PDSSTLDRYIVDYLIRKGRLNSATALATSQGIEELVDIKLFAELAKIENALVEKHSCTE
FT                   GLAWCGENRGTLKKTKNNLEFTLRLQEFIELCRKRDITTAIAYARKYLSGWASAHMSEF
FT                   QKGMSLLAFGEKTGVAPYRKLYDQSRWEAVRDQFRETFLDLYAQPSQSLLALALSAGLA
FT                   SLRLPSCVQNVRPNKSTGGDNTSVNPVVPLLPAVPPLHNLETTLFSPASSTHLTAPLGG
FT                   IPSSPTTDLHAHPEAVTGNIDCPTCDENMRVLASEVPMSHHVNSTIVCRISGQVMDSEN
FT                   EPLAFPNGYVYSSKALAEMAKNNFDVVTCPRTRESCAFGRLRKVYIS"
FT   gene            457574..458648
FT                   /locus_tag="CNA01710"
FT   mRNA            join(457574..457695,457772..457888,457957..458114,
FT                   458177..458257,458309..458390,458442..458648)
FT                   /locus_tag="CNA01710"
FT                   /product="retrograde transport, endosome to Golgi-related
FT                   protein, putative"
FT   CDS_pept        join(457615..457695,457772..457888,457957..458114,
FT                   458177..458257,458309..458390,458442..458534)
FT                   /codon_start=1
FT                   /locus_tag="CNA01710"
FT                   /product="retrograde transport, endosome to Golgi-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40715"
FT                   /db_xref="GOA:Q5KPS5"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS5"
FT                   /protein_id="AAW40715.1"
FT                   /translation="MVLVLVIGDLHIPNLVHDLPAKFKKLLVPGKIGQIICTGNVCDKE
FT                   TYDYLRTTAPEVHVVRGEFDENPHFPLSLIIQHQSLRIGVVHGQQVVPAGDPDMLAALA
FT                   RQMDVDVLISGGTHRFESFEFEGRFFVNPGSATGAWSSLWNGEVTPSFALMDIQGPVIV
FT                   TYVYQLVDGEVKVDKVEYRKPDPTSEIQSQSTRSEVAARW"
FT   gene            complement(461722..464296)
FT                   /locus_tag="CNA01720"
FT   mRNA            complement(join(461722..462709,462766..463053,
FT                   464052..464296))
FT                   /locus_tag="CNA01720"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(461855..462709,462766..462939))
FT                   /codon_start=1
FT                   /locus_tag="CNA01720"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40717"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS4"
FT                   /protein_id="AAW40717.1"
FT                   /translation="MSASAIPAYRHNSASPVSSRKAVKASASASASSSRPPTRSSQDPY
FT                   YGHEETAVLAARFITHLFQCPNIPAPSTPGAPTPTLAHFVAYALHRTRLPSVVTFAALL
FT                   LLQRLKRRYPAARGSSGHRLFISAFMIASKVICDDTYSNQSWGIVAQKMFALKEINQME
FT                   REMCGYLEWNLNFGEREMLEFEMDLRALHGPRAVARASSSSSSRSDIVLTDSPCNSYPT
FT                   PETTPDPQVSSRPIRPVPSPYKTRCYSHVPPMAPAFLSPPLSPHHAHLSPQPPRLSSAN
FT                   SSLQSSPASDDCKTPSPITVMATTRPISSTKSFDMTKAFEATARTRGVSVVRRGDDSVA
FT                   VW"
FT   gene            466534..469025
FT                   /locus_tag="CNA01730"
FT   mRNA            join(466534..467081,467139..468106,468154..468328,
FT                   468392..468628,468678..469025)
FT                   /locus_tag="CNA01730"
FT                   /product="cleavage/polyadenylation specificity factor,
FT                   putative"
FT   CDS_pept        join(466848..467081,467139..468106,468154..468328,
FT                   468392..468628,468678..468899)
FT                   /codon_start=1
FT                   /locus_tag="CNA01730"
FT                   /product="cleavage/polyadenylation specificity factor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40719"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS3"
FT                   /protein_id="AAW40719.1"
FT                   /translation="MAYQAHQAYQQAPYYPPPPVQPTTDVFRRQYADRLRALTFNSRPI
FT                   IQDLSMLAMAARDRNDWNGMQAVVEEIELAVLRALPQQKLPLLYLLDSISKNVGPPYTT
FT                   RLLQAIVPRLYIKTYREVDGVTKTKMEEMIGLWRTGGPGGSELYGSHVREQVERELFGS
FT                   AGIQNFKVPNRQQVQVLLNAALDNKRREVAMRPGDVVLGRQMNALLGIGELLSTTNVQP
FT                   QELSMIVEQLKSMAPPSVAPTPTQVSVTPSWGPSPSVNDLAPSNLPPFPPKLPAVNGNG
FT                   YTNVALPPFPSNIPTPLGTISTPPVTSSQTPIPGNQRSLTPVMAPASLAPVSSIVPSVP
FT                   SIPVDVARILQTLNKSGIGSQPQTPDVDRGTPGPNMVPAIEAYEDMILRLDIKLKSIDL
FT                   NAPHKLSFAHLSHRCQQCGMRFPSANAAFDAHMDWHFRRNKKERESGGRGAHRRWLPRV
FT                   EQWINDATTLPSTAASSSQTEKATVSAERLAQLRQKWVKVPQDSKKAASVCPVCKEAFR
FT                   AEWSDSEEEWIWKNALAINGIFYHATCRAEQTSALKRLKAADPNRRTSSSASPRTTPSN
FT                   EGLKPEAQKRKVEGMDIEHEEGSKRVKVEEIVGDI"
FT   gene            469179..470691
FT                   /locus_tag="CNA01740"
FT   mRNA            join(469179..469541,469595..469771,469832..470016,
FT                   470065..470339,470391..470691)
FT                   /locus_tag="CNA01740"
FT                   /product="expressed protein"
FT   CDS_pept        join(469226..469541,469595..469771,469832..470016,
FT                   470065..470339,470391..470532)
FT                   /codon_start=1
FT                   /locus_tag="CNA01740"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40721"
FT                   /db_xref="GOA:Q5KPS2"
FT                   /db_xref="InterPro:IPR024382"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS2"
FT                   /protein_id="AAW40721.1"
FT                   /translation="MRIPFLAASFPFVLLPFATARSSQQPLQVYLYPSPQSSTNQQLTP
FT                   PTLSYTQAKAVLDHHLRQDSSVFDEIPEDESMWVHLLGLWDSRETGKARVVVVDGGVEA
FT                   QDVLPPSLPSEPSFYLDDNVRSHYLLKPYVHSARKTFESIGDALPAFSKSIKDMFDLAG
FT                   TKAAEILFQELSCLSALADSLPWIDRAGEHPWNAVTITGLKDAQKGSELWETGRKTVQA
FT                   GLESMTGFDSPPLLLIIRPSSSKVLLPRSAMTNSLQGRSLSSQTCYSSNEACTEATNCN
FT                   DRGRCAIKSAENDLECWACKCKNGYTGEECQKEDYSTSFIILIFSTVLLLALAGGSIAL
FT                   LSTIGETKLPSTLNLAVSGGVKHN"
FT   gene            complement(470573..471140)
FT                   /locus_tag="CNA01750"
FT   mRNA            complement(join(470573..470734,470805..470875,
FT                   470934..470966,471019..471140))
FT                   /locus_tag="CNA01750"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(470675..470734,470805..470875,
FT                   470934..470966,471019..471073))
FT                   /codon_start=1
FT                   /locus_tag="CNA01750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40722"
FT                   /db_xref="GOA:P0CP04"
FT                   /db_xref="InterPro:IPR022214"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP04"
FT                   /protein_id="AAW40722.1"
FT                   /translation="MSSTQDEAILRNARETIDSLYDLSQLLQTGLDKSTLSICVGMIEQ
FT                   GANPDTLAAVIKELRSENEALNSQSNA"
FT   gene            471286..473867
FT                   /locus_tag="CNA01760"
FT   mRNA            join(471286..471834,471904..471980,472042..472584,
FT                   472635..473867)
FT                   /locus_tag="CNA01760"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(471342..471834,471904..471980,472042..472584,
FT                   472635..473648)
FT                   /codon_start=1
FT                   /locus_tag="CNA01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40723"
FT                   /db_xref="GOA:Q5KPS0"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPS0"
FT                   /protein_id="AAW40723.1"
FT                   /translation="MRKRRTTPRSNISKNANISKQLATTLPEGETQSTRKIQAASVEKQ
FT                   KPVIELLGAGRSTLVSNDEDYLSPQVPPKPIISLEHPSSTTSTIKVATTFPHIVFDDLW
FT                   IDILSFFAQVYLALYEMTLGIGKWWAGTEIEDSHRGKETKEKEIKAKRRRRRVEPSSNS
FT                   SDSATGRFFPGMVNLSGTLCYMNSVLQSVASIPSLIIHLEKVIDLAVEVDIPTHVTDAL
FT                   LDVIRDLNTPNKRPPPALRPHNLLTALYPLPAIRRLLSTHEQQDAHELFLVLAEAVSDE
FT                   VVKVAAEVAKVRGIGEIISLQGYLSGKNDGSDQPRRAGDMEGAKRRQRIRGVAQPWEGL
FT                   LARRRVCQRCGWSEAIRMDTLGGIELPVPLHGNTTLDACIMEYLAPEILSDVTCEMCSL
FT                   KLTLDYYTSEVERLSGSSCKKTSTKEENEPGSDNQVSASRKKKAREARRAETRLREMVN
FT                   SNTVSDFGEPNLTPLPSSGLTAQIPVKWLTAKTASTRQCVIVRPPQSLQLHFIRSEFTM
FT                   YGTVQKKTAKVSFPLLLDLTRFVSDGVWEERGGIKNMLASVSTEKTIPPITGQRVIYQL
FT                   ESAILHYGFTHSSGHFVSIRRKPSPSLTKEEKSFRPLQVAKNCPDGCKCQDCVYFGQVR
FT                   DLENTKVPGRGWLRISDADVEEVGEEALHEAGGAVVMLFYERVMEYVAKKVVHDERLQG
FT                   DGDSQDAGGLEDNI"
FT   gene            complement(473367..474801)
FT                   /locus_tag="CNA01770"
FT   mRNA            complement(join(473367..473594,473669..473730,
FT                   473800..473887,473943..474069,474128..474258,
FT                   474318..474406,474465..474540,474607..474801))
FT                   /locus_tag="CNA01770"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        complement(join(473689..473730,473800..473887,
FT                   473943..474069,474128..474258,474318..474406,
FT                   474465..474540,474607..474647))
FT                   /codon_start=1
FT                   /locus_tag="CNA01770"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40724"
FT                   /db_xref="GOA:Q5KPR9"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR9"
FT                   /protein_id="AAW40724.1"
FT                   /translation="MAFIKLDYTVSQSKPSSVPNPPGYLAPFTAKQSASASSKHFQANE
FT                   EALAKQARKSTELKMKRAWDLALSPAKSLPMQAIMLYFSGSGIQIFSLGMIFMLLTQPI
FT                   SAVLNIFQAFEPFRPTPSSTSRKGIKAAAEESTYAPLIGPMVLYVACQGLILALGLYKC
FT                   SSMGILPTGSGDWLHFETRSDPPEWSAVRSQLLG"
FT   gene            474921..476562
FT                   /locus_tag="CNA01780"
FT   mRNA            join(474921..475262,475315..475495,475557..475628,
FT                   475683..475757,475811..475888,475938..476068,
FT                   476143..476562)
FT                   /locus_tag="CNA01780"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(475057..475262,475315..475495,475557..475628,
FT                   475683..475757,475811..475888,475938..476068,
FT                   476143..476377)
FT                   /codon_start=1
FT                   /locus_tag="CNA01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40725"
FT                   /db_xref="GOA:Q5KPR8"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR8"
FT                   /protein_id="AAW40725.2"
FT                   /translation="MHHFASAVAALLLLGFSRAQELSCSSPKVNIDPCLSPSPGGLFVF
FT                   RQRFEPDVGDDFGSWNIDGLEVLTCDTQQPQNDTAYAPTYNHEEIGSFCLKSTLFSEEN
FT                   AFANSEKAWAQSEVGEGVEEVWERAWNVAGRFISTFHPECYKNAQRGSGVPEFFAVLQK
FT                   LHWRFPTAQLLSDNDIIPSEDISYSLAELTSALSMGGNFPVVICDNTTLSTILWPLLVR
FT                   GSFATGTFEPTSMLQRESNCPQDGIIYQLSNRRPVPTTTATWDRIFRPSPRPITLSHDE
FT                   SKLYYRTQVPDDLRQKLALFKGYEQGKEEGKTERADKKFWRDEL"
FT   gene            477117..479331
FT                   /locus_tag="CNA01790"
FT   mRNA            join(477117..477348,477404..477724,477786..477967,
FT                   478030..479331)
FT                   /locus_tag="CNA01790"
FT                   /product="expressed protein"
FT   CDS_pept        join(477225..477348,477404..477724,477786..477967,
FT                   478030..479040)
FT                   /codon_start=1
FT                   /locus_tag="CNA01790"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40726"
FT                   /db_xref="GOA:Q5KPR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR7"
FT                   /protein_id="AAW40726.1"
FT                   /translation="MPEDLSFLDQLEDWLEAQIPNNLHDLPSKMFDTVEKLTNDLFETL
FT                   NVHGPPSISIPFPPFGAKEVPTVPLPPPPPPSSTISCCQNAVHRSGRFVKTHPIAVGAV
FT                   ISVGLGFTGLLAYHGASFFAKGRKEKRQFGVNGVVRDGMLKEAIVILAPSPMPHILVPL
FT                   AASLLRAGYIVLIAVTNNRDAQSLEKRLNGLEERSALRVLVYDPDDPSTFPPFHRSLLA
FT                   TLTLRFPVSGRYTAGDPYNPQPSQLAHIHAFLSLYPLHPSPPSQPGALPALPTLLAPNP
FT                   DGSKPMLVNFYPSGSVPTTPVTFASQILSSNHVLLGRNLAASSGARVISIYIGDVDLPT
FT                   LPAILSHGKTLSRRQIAKERLAQVASPQQKVSIIRDYIYGSFNAVFSVVIGSLGLGTAV
FT                   RDYKTFEKGVLKAIKSSHGQLFFIGQRSFLPFFVAHLPIPSSFLPPLLAYLPAMPSCTG
FT                   PAASEHVKSAGYKNKTSVAKQGATSRQDANGEKERLSASEGSEHEAGEDLISSVHTGTS
FT                   TSSRGVGSESSEGASGLGGSWVGLEDAV"
FT   gene            479477..481953
FT                   /locus_tag="CNA01800"
FT   mRNA            join(479477..479945,480009..480044,480098..480266,
FT                   480325..480587,480645..480727,480781..480857,
FT                   480909..481265,481326..481433,481499..481748,
FT                   481814..481953)
FT                   /locus_tag="CNA01800"
FT                   /product="expressed protein"
FT   mRNA            join(479477..479945,480009..480044,480098..480266,
FT                   480325..480587,480645..480727,480781..480857,
FT                   480909..481306)
FT                   /locus_tag="CNA01800"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(479575..479945,480009..480044,480098..480266,
FT                   480325..480587,480645..480727,480781..480857,
FT                   480909..481217)
FT                   /codon_start=1
FT                   /locus_tag="CNA01800"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41275"
FT                   /db_xref="GOA:Q5KPR6"
FT                   /db_xref="InterPro:IPR009890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR6"
FT                   /protein_id="AAW41275.1"
FT                   /translation="MLHRRHPISHPVPPSPSRQHRDYLGTTSTTGIPIPPTSSRTSTPG
FT                   RPASNPVHWELDAREQTSLYDHGLNRPGRSSMSKGTDIGWDTAESRKNLTNRMGMGLRN
FT                   VRHGMKDALRMDRSVNLVWHDRELKTLIIKSMLINLLSLLLLSLSSLIFSPILVHPAST
FT                   DMQTRTKAIGMWYNILLSWPVFVVCFWVNANWGPGISKRAQVLLHPTYRHQPSVWGTPS
FT                   KSTQMATGYTAKLFSSATRVLLISDFTLVSRLIGAIPLIGRPCALAYMSIISSYYCFEW
FT                   TFSTKNWSLDYRIEYLQARLAYMFGFGLPVTLMTSFGPPLVTMAIFALVYPFFVIQALQ
FT                   SSPPRNATLLPLNPSSRPLTPSFRVKSSNALPADPFGEPTYCDLEAPSGREKEWEFKVP
FT                   IFWFANHALRGLKWLEDAVAKDRSGRKDIFGLGSQG"
FT   CDS_pept        join(479575..479945,480009..480044,480098..480266,
FT                   480325..480587,480645..480727,480781..480857,
FT                   480909..481217)
FT                   /codon_start=1
FT                   /locus_tag="CNA01800"
FT                   /product="expressed protein"
FT                   /db_xref="GOA:Q5KPR6"
FT                   /db_xref="InterPro:IPR009890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR6"
FT                   /protein_id="ALO60294.1"
FT                   /translation="MLHRRHPISHPVPPSPSRQHRDYLGTTSTTGIPIPPTSSRTSTPG
FT                   RPASNPVHWELDAREQTSLYDHGLNRPGRSSMSKGTDIGWDTAESRKNLTNRMGMGLRN
FT                   VRHGMKDALRMDRSVNLVWHDRELKTLIIKSMLINLLSLLLLSLSSLIFSPILVHPAST
FT                   DMQTRTKAIGMWYNILLSWPVFVVCFWVNANWGPGISKRAQVLLHPTYRHQPSVWGTPS
FT                   KSTQMATGYTAKLFSSATRVLLISDFTLVSRLIGAIPLIGRPCALAYMSIISSYYCFEW
FT                   TFSTKNWSLDYRIEYLQARLAYMFGFGLPVTLMTSFGPPLVTMAIFALVYPFFVIQALQ
FT                   SSPPRNATLLPLNPSSRPLTPSFRVKSSNALPADPFGEPTYCDLEAPSGREKEWEFKVP
FT                   IFWFANHALRGLKWLEDAVAKDRSGRKDIFGLGSQG"
FT   gene            482766..486671
FT                   /locus_tag="CNA01810"
FT   mRNA            join(482766..483486,483541..484151,484219..484398,
FT                   484454..484623,484685..484863,484917..485298,
FT                   485355..485398,485451..486671)
FT                   /locus_tag="CNA01810"
FT                   /product="expressed protein"
FT   CDS_pept        join(482828..483486,483541..484151,484219..484398,
FT                   484454..484623,484685..484863,484917..485298,
FT                   485355..485398,485451..486435)
FT                   /codon_start=1
FT                   /locus_tag="CNA01810"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41277"
FT                   /db_xref="GOA:Q5KPR5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR5"
FT                   /protein_id="AAW41277.2"
FT                   /translation="MSQHRPSPDQPSYYPLPHPPYQPQYAEPMPARPSRPMTISLPQFQ
FT                   PPPYSQQQSQTLLHSPFETPRSMPMSSTPLSSHIEGMVDYFSTWDGQTMQPVPDFHQHA
FT                   LQHQPLLSQHPSSLPLPNHSPNEWQSQAPRSSRKTSRQPNSKATSSDSMSSTKTTRQQF
FT                   TACGACRHRRVKCDLKDKQEQAEKTALLESNGHTGPMREQAKKVQCSNCLERGLNCVDE
FT                   FAPIKAAKQLRRGKRITEIEQLYGRSATDAASVHDNASTSSIKQPVSSVKSNTQPVHSI
FT                   IPELTREFFESDFFRRFQVQRPVIDPGNFLERYLSQANPHAAAMGTEGAILCHVLYAWA
FT                   VSYGVDEYGRLDLPEGGREPLTGVNVTNACPGEVQREKDRSVRKEKMKSVVKIILKEID
FT                   DCGVMRKPTWDGVRVLLMILPLTEGISTPVERLVMYDAAISQVFMLCSHVAMGYDGLPS
FT                   ASSEAANGATEDDQGMTVVRVRVYWYAFVHEGITTGLKGGRLHLDEEDMETMQDIIDNN
FT                   ALVRDSVSFRISTKFATAPINLALACRKINKALTGPKAKRRTAVNVDLVKQAWEALERC
FT                   WEEFDDLLKVGPNHKYILGEEVARFADGWKIFLFEAQNVIYNNLEARRQKLSNTAVQLT
FT                   ARITESASPSTANSPETMHADLVTIDHLLDIAKSKCEVKTRQIVDLVKTYVGTRFFEWD
FT                   ASLVRDGTYYAAMWLVKQGGSSEDVAVCIQALNELRWAHAKAWERSADLRKEWLEKHVV
FT                   DDPQEQNKTWDSVITNLEKLGEDKTTTEAPQRQHEVLEQPNMPRHNTCNPGIGNEKSQS
FT                   QLQDNSKRLKQTHASLDHHIHQQQQQPHSSQIYAYPDSQHHLQQSLPNSYLDQRHVDII
FT                   PPGSNTSYSSQPSGISGPQYQTEGNHTPTTDSTFTSSHTTLPINDTKVNVMDMSSSYHH
FT                   VNMREGLFEDDSFHSSHGAQQTQMYEEAETRNGSVPSHHGLVGHGHGNIMLGENGYRAY
FT                   EKFDGQTGYMAAEGYPQSRQIHQVYDYHHDPSHLHPHVQDAHTQGTGQGDYNSYQHPTE
FT                   ELQGQFVLQYDGTHLFTPYSN"
FT   gene            complement(486751..491981)
FT                   /locus_tag="CNA01820"
FT   mRNA            complement(join(486751..487254,487304..487359,
FT                   487412..488963,489015..491333,491708..491981))
FT                   /locus_tag="CNA01820"
FT                   /product="transcriptional activator, putative"
FT   CDS_pept        complement(join(487080..487254,487304..487359,
FT                   487412..488963,489015..491104))
FT                   /codon_start=1
FT                   /locus_tag="CNA01820"
FT                   /product="transcriptional activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40728"
FT                   /db_xref="GOA:Q5KPR4"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR4"
FT                   /protein_id="AAW40728.1"
FT                   /translation="MDKLPWRTTSGGKKGPFTVDAGGGQGVYNGKVNSARVPERPPSAA
FT                   SSRLSNPPTPAMSPSIPINRHNFPYPPQGYQSFSQPSSIGHSGSGSFHGNDHSSIATTP
FT                   TPMTPIDIVGVSSSVPRNSFSQGVQPSSHSQLSSSRSKRSVPMISTTPVEPPPSSWGAS
FT                   FPDQQGENDANSKPFDWTSLPNPANWFSPLGTVQKTTCNDDPIDPAVFASLADLVERNQ
FT                   GKMNDSASIDFMGALNANTSPKAARSTAHSTSHPGGTSLLSRRLQHQQQTSSDGQNIHS
FT                   SSQSSANSPGILHNSGGLSGFPGPQQQYNHVTFAQPGKVSKGASNQPLTPWPLSERAMG
FT                   SSETPVTTPGGSDFGVNSPFEMGITGSWQQESMAKHELQGSNSSSRYPPIAPRRREAPQ
FT                   HPAPVFQTHRGSVPSSEHASRAGSEAPHDGPMPGGVSLNGLPPLPNGLSLEHLAQYGAA
FT                   GLEMALRVGMGIGMGLSQQTQQTKQTVDVASPPWPLTKSVPTPSFSQNPSSPEASSRKG
FT                   RKDSNIVSDILQDDFLTARVPSTPLMTPPLNGFGSFPVTRRPSQSDATSPLPEVGPPEQ
FT                   VAEKDPLAAQVWKAYARARDTLPNGQRMENLTWRMMHLTLKKKEEEQAAKEKEEREKED
FT                   KEAAEKEAAEAAAAATAAAATAAAAAAAAELPPVEERRGRTKGKSRIVGFAGATSSNSQ
FT                   SPNGMDIDWRAASRSRSRIPMDIDWRASSRSRSRSAAPFRNPFSEAHAHHLLAAGGTPI
FT                   AEMGQYMAGHGSLNIHAANAHSTSHHGNQNQYHHASSLPGPSSMMLQSLSQLPEKEGEQ
FT                   DEVQQAVEHMNGADLYPASAPQNRSALEHLQMSLASGLNPSEEATSNLPGINGPGLYTH
FT                   SQENFHPHYGFLPRRVRKTSFDHTVKLLEEGEPSSSPQFMSNPRKRHAEASPQGGANSP
FT                   LPEGDSGFPTSNFTFSFPQSYENFFDLAAASATPSGTQENNDVNHEGDDDLADLTDWAS
FT                   HPVTADTSAFGSPSAFGHIEPGMSLPSMPQATGDNPFDFQQLMHLYLNANSSASPFTHI
FT                   NPSQVLGAVPGQAANEFSPSAVSPQSGAPTPSNNSSGNNIRPLPKAVGGKAVDNRQMPP
FT                   PNRSSSTPNLAALRMSSQSESSKHGRTASTNASGNAGSGSSKGNKGSSGNNKSRPGTPT
FT                   SENEGGPGSIMPSGENPTMCTNCQTTNTPLWRRDPDGQPLCNACGLFYKLHGVVRPLSL
FT                   KTDVIKKRNRAGPGPKESNPSRKNSVASSKNVSVRSKPSSPTVASSANSGGGSKKARHA
FT                   SDAPVE"
FT   gene            493713..494793
FT                   /locus_tag="CNA01830"
FT   mRNA            join(493713..493891,493942..494230,494281..494793)
FT                   /locus_tag="CNA01830"
FT                   /product="4-aminobutyrate aminotransferase, putative"
FT   CDS_pept        join(493772..493891,493942..494230,494281..494606)
FT                   /codon_start=1
FT                   /locus_tag="CNA01830"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40730"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR3"
FT                   /protein_id="AAW40730.1"
FT                   /translation="MTQSPFSTFGYQTAMPSGSSFKPKRKRMSWGPEEEENGAKHMRML
FT                   SPTLNHPGFPLPELVADHSNNASDDDQVMDMDQDMPDSSSAVGPPSPAEGYAQNSYSYG
FT                   ASGSGGFGFGPGAEEDEFEMDMMDDMGTIQSKNYPSLTPHPNPHHFSNPGNNHNLRGTS
FT                   PLAAQPFSTALPAPPARGIFQPTVSGPLAPDASDIERARSQHGPWCQSIPKLIMSEYPD
FT                   ASGRRSMWTVCGDCGACEKTQD"
FT   gene            complement(494728..495736)
FT                   /locus_tag="CNA01840"
FT   mRNA            complement(join(494728..495155,495215..495269,
FT                   495324..495379,495429..495736))
FT                   /locus_tag="CNA01840"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(494827..495155,495215..495269,
FT                   495324..495379,495429..495609))
FT                   /codon_start=1
FT                   /locus_tag="CNA01840"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40732"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR011082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR2"
FT                   /protein_id="AAW40732.1"
FT                   /translation="MSESSPKDTLSALNESLDALEAALAPLEAKPWSQTVEKLSPLERT
FT                   KMDVLGAYLINDLVWVYLKTKGIDPTKHDVTAELERIKTYYSKVSSAEGHEEIRPKVDA
FT                   AAAHRFVSSSIPRTQHLPPTTSAELAANQRALRVAEEEEEESIRRLGKPSRFRHIQERG
FT                   QLKLIPGQEVETIGDEDVMIGGEDGQREAENFLREFANEIEGR"
FT   gene            complement(498616..500873)
FT                   /locus_tag="CNA01850"
FT   mRNA            complement(join(498616..498800,498857..499198,
FT                   499266..499447,499512..499571,499628..499811,
FT                   499871..499884,499942..500131,500224..500466,
FT                   500524..500873))
FT                   /locus_tag="CNA01850"
FT                   /product="alcohol dehydrogenase, putative"
FT   CDS_pept        complement(join(498678..498800,498857..499198,
FT                   499266..499447,499512..499571,499628..499811,
FT                   499871..499884,499942..500131,500224..500466,
FT                   500524..500745))
FT                   /codon_start=1
FT                   /locus_tag="CNA01850"
FT                   /product="alcohol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40734"
FT                   /db_xref="GOA:Q5KPR1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR1"
FT                   /protein_id="AAW40734.1"
FT                   /translation="MPPPASRASIVRLLSLTANQGCRGCGRTHSVLDHAHNHGHTQSHV
FT                   PLGLRGMATPVDLPIRGGPPPGNTDYAFEMAASNLRFGAHATSEVGMDFANLIKEMPAV
FT                   DRSQAKIGVFTDPNVAKLPVIEIVEESLLRAGLNFVMWDKCAVEPTDKSWQEAIDFSRS
FT                   SHLTHFLAVGGGSSMDTAKAANLFTNYPKADLFEFINAPIGKGTPITKKLSPLIAIPTT
FT                   AGTGSETTGTAILDIPSRKFKTGIASRALKPTLGIVDLLNTTTCPKEVAIAAGLDVLFH
FT                   SLESWTAVPYHQRTPRPANPINRPAYQGSNPISDIFSKWALETTVKYLPRIARDPFGDE
FT                   EARAQMLLAASTAGIGFGNAGVHMCHAFSYPISSLNKGRPKETQYHHPSYNPDVPLIPH
FT                   GVAVSLTAPAVFNFTAPSSPDRHREALLVFLGKDRAHEATGLKDEDLGPKLSEEIRRFL
FT                   DIVEVPRGLSKVGYTGNDITSLVDGCLPQRRVLDLAPVLAKNNNAEEREQLAHIVELSM
FT                   NW"
FT   gene            complement(501034..502746)
FT                   /locus_tag="CNA01860"
FT   mRNA            complement(join(501034..501541,501595..501978,
FT                   502028..502328,502381..502746))
FT                   /locus_tag="CNA01860"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(501082..501541,501595..501978,
FT                   502028..502328,502381..502570))
FT                   /codon_start=1
FT                   /locus_tag="CNA01860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40736"
FT                   /db_xref="GOA:Q5KPR0"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPR0"
FT                   /protein_id="AAW40736.1"
FT                   /translation="MAPLDVFITTWNTGLQGSKAQSQDLTSWLLPVLRNASNPELPEGF
FT                   IPDLYAIGIQELLPLHLAMAGLTEPVLLALTSRIENLLSAHASSLSPNKTPERYSLVAR
FT                   VAHVGNALWIFSRDSTMDGRIGKPSTATLGLFWGGMGNKGAVGVRLPVRRGKIGGWENL
FT                   TFVNAHLEAYDHNIPRRNAQYQRILSSLVFNSTDPLTTSQQIFDTSHLFFMGDLNYRLS
FT                   KQPPPGALQENNMFGNVLELEKSRMGMLDTDTLRQEQREGRAFGGLREGDLTRFAPTYK
FT                   RIVGQVEGYSKKRIPGWTDRILFASHTDPPHLFSPEASLDPVPSNVADTTTILHFNSTI
FT                   ELVISDHKPVHAILSLPEVSHETPSPHLAPTLPPAPSPHHPRPLPTQREVLLIEKFFGT
FT                   LLDRLVGWPWCIIVLLGFGNTRTGMGVSAFVAMIWGIWWSGIYSG"
FT   gene            502984..506375
FT                   /locus_tag="CNA01870"
FT   mRNA            join(502984..503078,503140..503168,503222..503272,
FT                   503322..503542,503596..503737,503793..503966,
FT                   504022..504353,504406..504715,504765..504983,
FT                   505037..505897,505956..506048,506106..506375)
FT                   /locus_tag="CNA01870"
FT                   /product="gamma-adaptin, putative"
FT   CDS_pept        join(503054..503078,503140..503168,503222..503272,
FT                   503322..503542,503596..503737,503793..503966,
FT                   504022..504353,504406..504715,504765..504983,
FT                   505037..505897,505956..506048,506106..506213)
FT                   /codon_start=1
FT                   /locus_tag="CNA01870"
FT                   /product="gamma-adaptin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40738"
FT                   /db_xref="GOA:Q5KPQ9"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ9"
FT                   /protein_id="AAW40738.1"
FT                   /translation="MSGHYNLKALIKAIRSCKTLADERSVIQKESAAIRTSFKEEDTFA
FT                   RHNNVAKLLYIHMLGYPAHFGQIECLKLVASPRFSDKRLGYLGIMLLLDENQEVLTLVT
FT                   NSLKNDMNHSNVYAVGLALCTFANISSEEMSRDLSNEVEKLLGSSNAYIRKKAALCALR
FT                   IIRRVPDLLDHFTSKAKSLLQDRNHGVLLAGITLVTEMCEINEDVCAEFRRATGLLVKH
FT                   LKNLVSTGYSAEHDVLGIADPFLQTKILRLLRLLGKGDVASSETMNDILAQVATNTDSS
FT                   KNVGNSILYETVLTVLEIEADSGLRVMAINILGKFLANRDNNIRYVALNTLNKVVSMDT
FT                   NAVQRHRNTIIDCLRDGDISIRRRALELSYALVNESNITMMTRELLSFLEVADNEFKLG
FT                   LTTEICLAAERFAPNKRWQIDTILRVLKIAGNFVRDEILSAFIRLVSHTPELQFYTAQR
FT                   LYAALSSDLSQESLTLATVWVIGEFGDILLQGGTIDDGDKVKQVSDSDLVDLLEHVLNS
FT                   PYADSLIRQFVMTALAKLSVRISELSTPNQNTLQDRIVVILASFSSNLELEIQQRAVEF
FT                   GSLFAMREVKMGVLERMPPPEIKATIMGTVSERKPVGSTRTDKDMIVDLIGDDSAPSTA
FT                   GLPVAATGPSTQDLLADIFGTGASDIASPGAGSPTAPRSNANDIMSLFNTTPAAAASPP
FT                   VTSSLPAASTGGSLFDLVSPSPTLSSAPAPAPAPTSAAKPQLQSYTAYDKNSLKITLTP
FT                   KVSPAQPGVVQILARFTTNGTEKIEGVNLQVAVPKTQQLQMQAMSSQEIAPGGVETQQM
FT                   RIHVPAGATIRLRMRISFTRAGQSLTDQQDFAGFPAGLTGSK"
FT   gene            complement(506412..507395)
FT                   /locus_tag="CNA01880"
FT   mRNA            complement(join(506412..506748,506800..507025,
FT                   507082..507171,507223..507395))
FT                   /locus_tag="CNA01880"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(506488..506748,506800..507025,
FT                   507082..507171,507223..507299))
FT                   /codon_start=1
FT                   /locus_tag="CNA01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40740"
FT                   /db_xref="GOA:Q5KPQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ8"
FT                   /protein_id="AAW40740.1"
FT                   /translation="MSAPEATGTRQRTNKVETPTNENQNPASLSANPNKKVPRNKPHVK
FT                   PPFVDMSMNKFLTYLVLSLFLLFAFYMWRFTVWAHQAGGYWALITGHHMSPAEVAAKQA
FT                   ASSASASSSVASSTASATTSGHPQKIKAKPTQDAGDGDDNIQSQIFNLASALGITPAEL
FT                   SSAIRPLVDPSVPNPAEKAKQDAQLLQAKMASQQHENENQEGSVLDMLGEALLD"
FT   gene            507664..510353
FT                   /locus_tag="CNA01890"
FT   mRNA            join(507664..507925,507981..508192,508244..510114,
FT                   510176..510353)
FT                   /locus_tag="CNA01890"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(507740..507925,507981..508192,508244..510114,
FT                   510176..510237)
FT                   /codon_start=1
FT                   /locus_tag="CNA01890"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40742"
FT                   /db_xref="GOA:Q5KPQ7"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR015350"
FT                   /db_xref="InterPro:IPR015351"
FT                   /db_xref="InterPro:IPR036358"
FT                   /db_xref="InterPro:IPR037095"
FT                   /db_xref="InterPro:IPR040159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ7"
FT                   /protein_id="AAW40742.1"
FT                   /translation="MAEDHNEGVSNTPLDLLINAIAGNHYPIPHDHTHEHDHDHDVSLD
FT                   HLLSQRKDSAEDSQQHASSHKRARSQEVVSSRQRKVPKPLGSQAMFYPGFAPADKAPGS
FT                   LDENNSHRFNTLEVWHPTTGQKSYGKERRMLNPPPILRLSGPASSCISSITMVSVVSPN
FT                   ITQPVAICAPQTHHMGRPPDITPHLGTPGVEDKKKERREEQKKLRTAALNAGFAATLPK
FT                   NRNATDLKDRTLLKDGLTFPGLWIGEEAGKMKEFRLELKIYAEPTEKGLSSPSTQDFAQ
FT                   SSYHLGNPDNDHETAHTFADMLEPPSMDALQPLAEAVQQSSQQGHDTLSEHFPEVEPSL
FT                   AATNLHNDNDAENPGNSPLPITQATTEEQPLGSFLSGPIRIVSKPSRKTSKTRSLAICF
FT                   PRDSVFSLWTRIHGQTVRTKWMNLEANFNGHGPRLTSRTAKWTPFRFEVLDHANAPFAY
FT                   RTARNKFDETDHLEGQQLTYGSIVVLVDLQTGVKSDPVKVVRVESGKSVVGQYDGQPVS
FT                   ELQRIGLVRTIDGQEDMSEGCRWYLSAPGARIGGGELSAESAPGIRMRRQRANAKAASQ
FT                   LKELNEERGKEKEIEGTSHDEPHLTSSFLQDPQTLSAIENVSGSSTETNHNQQSVLSIE
FT                   LSLPEGVHSADTFDHTDHPPVIDPSFENMAPLVDSQQQTKNPKGQSSFQRRSNKTRRLA
FT                   LAAAVLAEDDDNAVQTLLSWVKAERSEEVSSGADGLDTQPDEVRSVIVDSVADWMSWTI
FT                   GGAASFSFTFKPTEHNEERVEAP"
FT   gene            complement(510349..513791)
FT                   /locus_tag="CNA01900"
FT   mRNA            complement(join(510349..510808,510862..511049,
FT                   511110..511546,511612..513420,513487..513791))
FT                   /locus_tag="CNA01900"
FT                   /product="conserved expressed protein"
FT   CDS_pept        complement(join(510514..510808,510862..511049,
FT                   511110..511546,511612..513420,513487..513724))
FT                   /codon_start=1
FT                   /locus_tag="CNA01900"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40746"
FT                   /db_xref="GOA:Q5KPQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ6"
FT                   /protein_id="AAW40746.2"
FT                   /translation="MVSPPPPRPVHPFFQLSSAQSKRKRQAGPEAGDSARRGHNSPIRT
FT                   GQDSKENTPFGDLSVEYPLNGRGKTDETLDSTDDESEVVFTHASQAPSSFASIGTPSGR
FT                   ASSRLGPKRVRPSFPSSATLSSQATASSSSMNEVVDLSSDADDWEDRIPVTRCPKRRIA
FT                   SKDAIGSRPMLSKPKPLSRSTSWTGSKGINEKEAIEILESTPSPVALKVLPAPKNLGFG
FT                   QETGKAAHPFFTHTHRQSRHGASNPSQERSAPMAAEDVSVLKTTAAPFGLDKQLPKIHS
FT                   FFSMSTLDRAQEKLKNGWGKEEREAPLPMRPWPNHIGGYCAPASDPRWKGKRRKPTPAV
FT                   KDDGFWEGVLGRTSTPVYQGITSKAYEIPIFPHIAKHPSFLSIPSKCSSSSSNRALWSD
FT                   RYRPLRASEVIGNEVEATYLRDWLSTLAVGGQHAKGSKIVRQVVKKPRSALVDGFIVDD
FT                   LGLYGDTPNSEEDGEDEFPHLEDLPDPPISHDLNARPDKYPSLASHLANTILLTGPTGS
FT                   GKTAAVYAAAHELGWEVFEVYAGMGRRTAANLMKWVGELGKNHTVLPQDGKSQGTINDN
FT                   EKKGKSRGRGKGLSSFFDKGSFQSSKVSLSRGIASDPIDIESNGESDKIPVTEAANVSG
FT                   GEPGIKFKESLLLIDEADILFEEEGSFWPAVIALASESRRPIVLTCNDHQRIPRIQLPL
FT                   QAILQFHPIPSFIALPYLQAISSQESQLRGKPCNPCVETIFRGAIHQTPEKDVLSDQCL
FT                   PPNGHERIPFFDLRQAMMQLQFGLTDQILQRGCAKKYGTPDEDEKKDDLQLMTERMEVI
FT                   SFSDAFIDIRPRVLMELYDVDKLQPTSDEELDVAALLKPEMYETYPILAMIDRSSDIAG
FT                   SLVQAVGGHLPPFGDLGLARAKYIRSMLPLLDPLIPLSEPLLPHSTLFLYTLPTMQSII
FT                   SADDIFEALEQQAVDRGDEKINPRTGKPMRRVAGYTYTRYWDLEGAENEARRISRLIW"
FT   gene            complement(513911..516668)
FT                   /locus_tag="CNA01910"
FT   mRNA            complement(join(513911..514179,514231..516282,
FT                   516341..516422,516474..516517,516575..516668))
FT                   /locus_tag="CNA01910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(513997..514179,514231..516282,
FT                   516341..516422,516474..516517,516575..516640))
FT                   /codon_start=1
FT                   /locus_tag="CNA01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40748"
FT                   /db_xref="GOA:Q5KPQ5"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015007"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ5"
FT                   /protein_id="AAW40748.1"
FT                   /translation="MAKRTADNQKTKDDVEEEGNEEPGIRAAPLAAVEGRPVRGLPKRR
FT                   GLGGASAPTPTPAPAPVADIPPAPTSGTSSPVPPSGTSNAFTGFSFGASTSSTPSFSFG
FT                   QSSASSPASTTPAAAPKPFAGFSFGSAAATGSSTSAPVTEPTGTATPAFSFSQKPVEPT
FT                   QTKALQPSKPFAGFSFGAPAAAAPSTGDNASEPPRFSFGAKPTSDVTKEVPAHEPIKSK
FT                   AAPFSFGTASSAPVASGSKEATQVQGFSFAKTLIATATSTTSKPTLTEASETAPAKPSF
FT                   SFGPMATTFGTGTAPTSNSAPPAPAAEAAPAPSTSSSSSESETSYYTSLRGLNQSFLTF
FT                   FSTTIEKDQFIDLTTVLPKLLVQYEEHLTGIETKAGWKPDATSKDKIETTAAPEPPKAT
FT                   GFTLPKAPSAGSFSLPKAPSTSSAAPATGGFTPSAPATAPSKSSIFSFPAADTTPKKSS
FT                   DEVNKIVSEAIADKPEEEKMAEKTGFGFSFGTDSTKPKESSAFKFEAPKKSTSLFASSP
FT                   ATPAKSAAGNEAAPLGKFGPGGSQPQLSFGAKAGTSPAANTTSSFNFNVGKPSTPAGAG
FT                   TSFSFGTSSSPSVAAGASTTSASVFGGTSTRSAPTFSFGATTPSASSSSSFVFGKSPVV
FT                   QPSGDAPKFGASLQPFGSTSSVSTPAPAVNESNTEGEEATEPSSPSKNLASVAGAGEEN
FT                   EDTVIEQRGKLNRLEDGEYKLEGLGQFKLKRTKNEEDRKRRLLMRTDGNGNVILNMAVK
FT                   STFNPSVEGPYLKFLGFNMDGKPTPYALRVKNAEAANTLLEGLKKEVEEIKDDKS"
FT   gene            516854..519703
FT                   /locus_tag="CNA01920"
FT   mRNA            join(516854..517961,518019..518258,518311..518954,
FT                   519002..519067,519122..519303,519369..519703)
FT                   /locus_tag="CNA01920"
FT                   /product="cactin, putative"
FT   CDS_pept        join(516876..517961,518019..518258,518311..518954,
FT                   519002..519067,519122..519303,519369..519406)
FT                   /codon_start=1
FT                   /locus_tag="CNA01920"
FT                   /product="cactin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40750"
FT                   /db_xref="InterPro:IPR018816"
FT                   /db_xref="InterPro:IPR019134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ4"
FT                   /protein_id="AAW40750.1"
FT                   /translation="MPRSPEHDSKFEKDSGRERAGDRRDRDRDRYRDDYDRRESSSRRD
FT                   ESERNRDRDRRDKDDRGQGKDRERERRRDKGRGDYYDSDRDRDRDRDRRDRKRERSRSR
FT                   ERSYKKERKHRDSRSPSPSSKTRRKEAKAAAKAAAKREAELEQSRALAELSMYSATDNP
FT                   FHDANLGEQFQWHKKRDKEKKAGLTAEEIARKDALRRQEAKEELERLNKRRADREVELQ
FT                   LREEEETRQRRLAEDAAMAEWIAKEDDFQLEQSRRRAGIRLREQRAKAIDFLAINLRFT
FT                   DPKSSHQTAAIGALTNPRASEIEREEEEEGWGWADAGFEFEIDEPWKIFENLTLDDCVE
FT                   LEQDIKMYLSLEKSPINIEFWQAMQIVCEHYLSQLRDPEHAVGGPLSDPEVEEATNKIV
FT                   SGLSLQRLVELENKANGLLRSGQPVDSDFWDLILKKIHVEKAIAKLNSIHEIVLKNRLE
FT                   QFKRRQREDAAKVQAELGGVLVSNENAFGGDIRADAGPVPTGGDEADDEEEDEDDYIED
FT                   YDREMSPPIAEPRTMGLDERRLPIVNEEDELRALFSARHSITSSNFIPTQARASAHTSQ
FT                   SISRPSAADLEAERIYREEAEREARDLGSDESEEEFGDLDAGLEVPSTYDWSDRYRPRK
FT                   PRFFNRVHTGYEWSKYNQTHYDTDNPPPKVVQGYKFNVFYPDLIDKSKAPTYYLKSIPD
FT                   DPDTQIIVFTAGPPYEDIAFRIVRRQWEYSHRKGFRSTFDRGVLQLYFNFARTFYRK"
FT   gene            520371..522844
FT                   /locus_tag="CNA01930"
FT   mRNA            join(520371..520782,520845..521132,521185..521845,
FT                   521902..522239,522298..522844)
FT                   /locus_tag="CNA01930"
FT                   /product="expressed protein"
FT   CDS_pept        join(520565..520782,520845..521132,521185..521845,
FT                   521902..522239,522298..522709)
FT                   /codon_start=1
FT                   /locus_tag="CNA01930"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40752"
FT                   /db_xref="InterPro:IPR014752"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ3"
FT                   /protein_id="AAW40752.1"
FT                   /translation="MNNIRQDSGPSPTPESSFGSPRRRASSPRPHRPSADGLLFNNERQ
FT                   VPPPIYLRNSSPRGLSSRGEVKIHIPAWGIAFVRPPRPLEVHPLETTPNHPIRPPSKDT
FT                   VLSGGLEIIMKERRRVKAISVGVQSVCRLYMGQSRGWEEDGIFERGVEVLSGDEEGIWL
FT                   EKGSQSFSFSILLPGTLATTDSHTFGRVSYIITARVEGIESSTSSFSSIFKFKTLSNSF
FT                   PSSTSGIPNIADFERVIARSNKFAADVALGRARSASMSRSGTSDRVSTPEPGIDRSSID
FT                   DQAVSDVIDSGSPPFDGLYTRRHSSDLSPVSTPLSLSSSLPDTSFRPNRNGNTQTEKAG
FT                   WLEGDLKGSRELSIYAVSPSTGGVCQLDVRKEGSVDGLGSWKFNAAAEVFSVSSVILLS
FT                   ISIPAPSAKTTIFLARLVLTQSYTITSPRTPNVPPSSPESQQKFVLYQVGRQHKQGEVA
FT                   PGRSADALWRGIEAAGAGGEEGWKIKAVARIPGHDKIRPTTYDGTITPIKVSHELTLQL
FT                   YYSMDGLSVTGQCVEGPGALRLMQVRIPIFLPSCHCVSDALHLPTYNRSNTSPWETIDE
FT                   FMASQPDDRACMCGWTFAELGEAALRKMRMTERDEAEEHLRQLATEGNKGRREDYDNGD
FT                   AVI"
FT   gene            complement(522835..523701)
FT                   /locus_tag="CNA01940"
FT   mRNA            complement(join(522835..523174,523231..523494,
FT                   523556..523701))
FT                   /locus_tag="CNA01940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(522917..523174,523231..523446))
FT                   /codon_start=1
FT                   /locus_tag="CNA01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41327"
FT                   /db_xref="GOA:Q5KPQ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ2"
FT                   /protein_id="AAW41327.1"
FT                   /translation="MPSLESAGSFSTLSEATASGASTATHSSTGSASQSATSTSYVYSY
FT                   ATSKIVKVAVATGVIVLCLAAIVLFFKVSSWIRLRQRLRRQRLLTLTLKSEQQANAYEI
FT                   AAWADEPSTVPARSVGIREDKEKKSKKEREELRAWKRGGANAWALQEWEGVAA"
FT   gene            523906..524743
FT                   /locus_tag="CNA01950"
FT   mRNA            join(523906..524058,524135..524172,524316..524390,
FT                   524614..524743)
FT                   /locus_tag="CNA01950"
FT                   /product="expressed protein"
FT   CDS_pept        join(523921..524058,524135..524172,524316..524390,
FT                   524614..524698)
FT                   /codon_start=1
FT                   /locus_tag="CNA01950"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40754"
FT                   /db_xref="GOA:Q5KPQ1"
FT                   /db_xref="InterPro:IPR019329"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ1"
FT                   /protein_id="AAW40754.1"
FT                   /translation="MVRSALASLARPLSRQSTQSTSLSAKRYASHGPTYNPPSGYLFGE
FT                   RPPKDGKRVKESWENIYYVGMFGGMVFMGVVYAYKPDTSIQSWALKEAKERLEARGEEY
FT                   QYKPKSA"
FT   gene            525707..527298
FT                   /locus_tag="CNA01960"
FT   mRNA            join(525707..526241,526307..526403,526454..526791,
FT                   526839..527298)
FT                   /locus_tag="CNA01960"
FT                   /product="glycerophosphodiester phosphodiesterase,
FT                   putative"
FT   CDS_pept        join(525760..526241,526307..526403,526454..526791,
FT                   526839..526950)
FT                   /codon_start=1
FT                   /locus_tag="CNA01960"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40756"
FT                   /db_xref="GOA:Q5KPQ0"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPQ0"
FT                   /protein_id="AAW40756.1"
FT                   /translation="MACRPSLYALSRLSFIPNTRPFTSAHFPRQKSTSRQRLYALLGLS
FT                   LSLPAGYYFFQSSPSLSPSVYSDQELKSSKSLTPFHKLVTIKIPSSSYGFFDKPYRLDG
FT                   EVADVKGGEVVIQHVMVKSPDIQIERPYTLINDPNAANGEREMRMVVKRVRGGEVGRVV
FT                   HTTKEGEMLGVRGPIPTFSIYPQRYDKIIMISTGTAVSPFLQLLAKLSPSNAPRLELIQ
FT                   ALPALSSSTPPFSHESLDRAAPIKWDWVDTNEDPSFLPSLEKKFGEKLKITRFPQGAVP
FT                   AGAVQAALEGMNRERVLVLVCLPPWLMRPLCGGMTRNLDQGPVTGVLRELGLGSKQVYK
FT                   LE"
FT   gene            complement(526290..527902)
FT                   /pseudo
FT                   /locus_tag="CNA01970"
FT   gene            527458..528337
FT                   /locus_tag="CNA01980"
FT   mRNA            join(527458..527775,527828..527942,528014..528337)
FT                   /locus_tag="CNA01980"
FT                   /product="expressed protein"
FT   CDS_pept        join(527839..527942,528014..528125)
FT                   /codon_start=1
FT                   /locus_tag="CNA01980"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41325"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP9"
FT                   /protein_id="AAW41325.1"
FT                   /translation="MLSLEDHLRRERTVFRRLSSTMMMNDAAYSRRRKQIPSLSSLLAI
FT                   FPQPLRILLVLFPFSPSLPIVYASLS"
FT   gene            complement(527948..531777)
FT                   /locus_tag="CNA01990"
FT   mRNA            complement(join(527948..528259,528313..528572,
FT                   528629..529075,529132..529276,529338..529543,
FT                   529604..529794,529843..530646,530706..531045,
FT                   531101..531312,531365..531467,531518..531777))
FT                   /locus_tag="CNA01990"
FT                   /product="conserved expressed protein"
FT   mRNA            complement(join(527948..528259,528313..528572,
FT                   528629..529075,529132..529276,529338..529543,
FT                   529604..529797,529843..530646,530706..531045,
FT                   531101..531312,531365..531467,531518..531777))
FT                   /locus_tag="CNA01990"
FT                   /product="protein phosphatase type 1, putative"
FT   CDS_pept        complement(join(527980..528259,528313..528572,
FT                   528629..529075,529132..529276,529338..529543,
FT                   529604..529794,529843..530646,530706..531045,
FT                   531101..531312,531365..531467,531518..531769))
FT                   /codon_start=1
FT                   /locus_tag="CNA01990"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA01990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40759"
FT                   /db_xref="GOA:Q5KPP8"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP8"
FT                   /protein_id="AAW40759.1"
FT                   /translation="MLAPYHLQPLIPQLRPAPDLLQFDTQHSLAPRSSSPPQSPVRSSN
FT                   NNNEHREIRCVEGYGYNLYVGASDGTVEWWVCEGSMYPQANGWVMRHKHTLFPRRPVSK
FT                   MYILPKVSKLFVISDGTMHALTLPSLEVVPSTIIPTMRGVVSVILNDDELDYGQGSEEK
FT                   TDMTVVIVRRRVLGIYRLGNRLQSIKEIPLPSAPTAHALFQTYLCCALLSPETSQIVNC
FT                   VVDLSDASLTEVLPVSQVPPLEGEGGEGQEAVNANIVVIPDEKEFLVTSYTGTSTMGVF
FT                   LNGQGDPVRGTITWTSHPLSITVESNWIIALLSDQTISIHSLSDLDGPAQVISLPPGTN
FT                   ATSLSYSPYGVRVSDVFSGEKLKPSKMRFLSGKIAPTVESPATVEEHGKRQGDSIKEKE
FT                   DDPPAGSGLTPPSSPKPTLEHTADKSPAFITAMCETFLVTPSSILSLIPTPDIMLLENL
FT                   CEEHQLSEAASLVSDIRRRYRKGTIEPSPSPIDTLNASHLIRYLSLVLASHLTLSASFE
FT                   KAAEYWVKGKVDPRWVVRLFEGLRGKMIGSEEEGEIFSGLANTFMDMDLVDDSTSSIKR
FT                   NYSPHLTPSTSLSPASTDLRQALENEANKMLAEVLSKIRGTRRKGGGARGLDSRKIDMV
FT                   VDTTLAKLLTLLANDSQEPTEQLLALLSSSNDIIMSEVEPFLEKRKYVLAKVKEKNGEW
FT                   GRVLDILRELVESGDQDPMCKDPVQEVALALTNVQDVDTWTDHVLWLTAKRPEKALDVI
FT                   INHPPATLSPANFLPRLQPYPETHQAYLEHIVVKQRSPSRDLHQQLLCSLLDEIQRTIV
FT                   DDGVKYHLDELQEEYKKETERIAGIKGKERETFIYFFARLAPDTPIKRLRLKLAFFLHG
FT                   SPFYDITQAEQRLEGMERLVYEKAIVYGKLGKHRPALQLLALTLSDPLSAQTYATASGE
FT                   ILPPRLARSASSISGIGALEAWATLGEVGKRKKVKDDGGKLEEALVQDLLDVYMQDGTP
FT                   LSLHCASTLLNTLPHLLPLYPILGSMPASWPLNIVSPFFVRSIRRGTHKRWEGMVRKGI
FT                   ARGEFAEVEERWLEEMRGMVFSYNPIRRNHS"
FT   CDS_pept        complement(join(527980..528259,528313..528572,
FT                   528629..529075,529132..529276,529338..529543,
FT                   529604..529797,529843..530646,530706..531045,
FT                   531101..531312,531365..531467,531518..531769))
FT                   /codon_start=1
FT                   /locus_tag="CNA01990"
FT                   /product="conserved expressed protein"
FT                   /db_xref="GOA:A0A0S2LHT5"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHT5"
FT                   /protein_id="ALO60295.1"
FT                   /translation="MLAPYHLQPLIPQLRPAPDLLQFDTQHSLAPRSSSPPQSPVRSSN
FT                   NNNEHREIRCVEGYGYNLYVGASDGTVEWWVCEGSMYPQANGWVMRHKHTLFPRRPVSK
FT                   MYILPKVSKLFVISDGTMHALTLPSLEVVPSTIIPTMRGVVSVILNDDELDYGQGSEEK
FT                   TDMTVVIVRRRVLGIYRLGNRLQSIKEIPLPSAPTAHALFQTYLCCALLSPETSQIVNC
FT                   VVDLSDASLTEVLPVSQVPPLEGEGGEGQEAVNANIVVIPDEKEFLVTSYTGTSTMGVF
FT                   LNGQGDPVRGTITWTSHPLSITVESNWIIALLSDQTISIHSLSDLDGPAQVISLPPGTN
FT                   ATSLSYSPYGVRVSDVFSGEKLKPSKMRFLSGKIAPTVESPATVEEHGKRQGDSIKEKE
FT                   DDPPAGSGLTPPSSPKPTLEHTADKSPAFITAMCETFLVTPSSILSLIPTPDIMLLENL
FT                   CEEHQLSEAASLVSDIRRRYRKGTIEPSPSPIDTLNASHLIRYLSLVLASHLTLSASFE
FT                   KAAEYWVKGKVDPRWVVRLFEGLRGKMIGSEEEGEIFSGLANTFMDMDLVDDSIASSIK
FT                   RNYSPHLTPSTSLSPASTDLRQALENEANKMLAEVLSKIRGTRRKGGGARGLDSRKIDM
FT                   VVDTTLAKLLTLLANDSQEPTEQLLALLSSSNDIIMSEVEPFLEKRKYVLAKVKEKNGE
FT                   WGRVLDILRELVESGDQDPMCKDPVQEVALALTNVQDVDTWTDHVLWLTAKRPEKALDV
FT                   IINHPPATLSPANFLPRLQPYPETHQAYLEHIVVKQRSPSRDLHQQLLCSLLDEIQRTI
FT                   VDDGVKYHLDELQEEYKKETERIAGIKGKERETFIYFFARLAPDTPIKRLRLKLAFFLH
FT                   GSPFYDITQAEQRLEGMERLVYEKAIVYGKLGKHRPALQLLALTLSDPLSAQTYATASG
FT                   EILPPRLARSASSISGIGALEAWATLGEVGKRKKVKDDGGKLEEALVQDLLDVYMQDGT
FT                   PLSLHCASTLLNTLPHLLPLYPILGSMPASWPLNIVSPFFVRSIRRGTHKRWEGMVRKG
FT                   IARGEFAEVEERWLEEMRGMVFSYNPIRRNHS"
FT   gene            532001..535161
FT                   /locus_tag="CNA02000"
FT   mRNA            join(532001..532577,532625..533827,533877..534012,
FT                   534061..535161)
FT                   /locus_tag="CNA02000"
FT                   /product="transcription regulator, putative"
FT   CDS_pept        join(532348..532577,532625..533827,533877..534012,
FT                   534061..534561)
FT                   /codon_start=1
FT                   /locus_tag="CNA02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40761"
FT                   /db_xref="GOA:Q5KPP7"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP7"
FT                   /protein_id="AAW40761.2"
FT                   /translation="MPSPPPQPVPTRSTRSSNPHAGAHPRTGASPMSYGAMTGISFTNG
FT                   GGFSFEGKPRSVKWGNGGMMGSFGARFYGDAGGDSPVIPFSTSVTMEPSSFAASAQAFG
FT                   LPGSMSSSYHRRSYAAAVAGSRDPHNLSTSFASMSFQPMSLGTSYNRSQVQGLMARSDA
FT                   ELTKAYECCGKTHSGLHSLLEHVEDCHPFSDPNMPPEDSFSPVTHAMDLDLDDVPEEPA
FT                   QPPAPGSSQSSLSPDPIAAVPVPSYPLPTSKTPTDSVGKSPLKLSDVLKSPPEGESMVK
FT                   ASNLTLTRTQSSSSSPPDGSLATPTTSTQPSPVFLQPKINPARPAFMSMGTNAMRPAAQ
FT                   QKRFDRAFNEVVAGRKEDEPKGDMPTAVAPGVLFASAVSSLGIPTVPPGTKTTETTTPK
FT                   EGEAEVKPAATDATTSAAAAQPSSTSTGAAAPSAPKVFPEPALPQPSLFSSHKPWRCPN
FT                   PGCNKAYKQSNGLKYHQQKGQCDFAIHDAVDLGLTLEEAEERNRPFVCAVGAGCTKRYR
FT                   QMNGLKYHYLNSGEHGLYGLRMLQNGTHPHPPSLPAPPPVRARPNPPSSSGVTSGVSAP
FT                   QRPAGAPYAIPSQATNTINGAGQGRVIGQGGHGQNHHALPRMGTWPNQSRPANGPNPIN
FT                   GKPAPNHALGPQKVQPQARPNPPPQPQPVTKGRDAVLFSAISEDPMDIMSRMDS"
FT   gene            535270..537531
FT                   /locus_tag="CNA02010"
FT   mRNA            join(535270..535815,535875..536114,536173..536250,
FT                   536302..536498,536559..537531)
FT                   /locus_tag="CNA02010"
FT                   /product="expressed protein"
FT   CDS_pept        join(535397..535815,535875..536114,536173..536250,
FT                   536302..536498,536559..536704)
FT                   /codon_start=1
FT                   /locus_tag="CNA02010"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40762"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP6"
FT                   /protein_id="AAW40762.2"
FT                   /translation="MVLPEARPLHLPLSSIIPPSGPNPGPPHTLPVPSYILGPLPPTSP
FT                   LHLALRYLDLADDATREDCASNARHGSNSQGSNSQNMTRGEHDGKGALNTPTRVLLVTG
FT                   PKAAFQDAIESEDERWFREHGGWMSVIQKLKRIDMRFCPSAKHLQLLLTLLSKNQSRQA
FT                   NADSHTLDGCPGLVILWNVAELFMVSSTDTELQENKVKEDKNGNSPGCSSGKQFNASIC
FT                   ISDYLNVLAAARETANHFSSIDPSGLSTQLVVMEPNLTAHSSLPVLPPSAQGESSGVSS
FT                   RQAPREKRIFVVDGARHLMGESNVAVIQQQGEEQEVPTEYELTVGRAQGTFAMKRQRRK
FT                   GGDWTAQQDELHGWEWEWE"
FT   gene            complement(536176..537618)
FT                   /locus_tag="CNA02015"
FT   mRNA            complement(join(536176..536480,536581..537441,
FT                   537525..537618))
FT                   /locus_tag="CNA02015"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(536721..537341)
FT                   /codon_start=1
FT                   /locus_tag="CNA02015"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI79"
FT                   /protein_id="ALO60296.1"
FT                   /translation="MPPSKGHDAAPPPNWPASVIYLSKPRLSPKFPPSLLPFIASPSFT
FT                   PQTTKHPSHVQIKKIAEVSHPAYGQLGLFARQKVKENELVIPYLGIIHVTFTPDNGSDS
FT                   ILDEHSESDYDLSLLRLSSSDIRNPFPGQHISIGVDAAREGNAGRFVNDYRGVKPAGPN
FT                   AEFRVGKGEGGELRMEIWSLRGGIGKGDEVLVSYGKGWWGARK"
FT   gene            complement(537834..540774)
FT                   /locus_tag="CNA02020"
FT   mRNA            complement(join(537834..538047,538101..538160,
FT                   538209..538457,538520..539626,539679..539888,
FT                   539944..540192,540249..540270,540312..540353,
FT                   540485..540563,540655..540774))
FT                   /locus_tag="CNA02020"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(538021..538047,538101..538160,
FT                   538209..538457,538520..539626,539679..539888,
FT                   539944..540192,540249..540270,540312..540353,
FT                   540485..540563,540655..540718))
FT                   /codon_start=1
FT                   /locus_tag="CNA02020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40763"
FT                   /db_xref="GOA:Q5KPP5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP5"
FT                   /protein_id="AAW40763.1"
FT                   /translation="MSTQSGRSTTSKSSSRKKPLSCAECRRLKLKCELVFPCRHCVKRG
FT                   LASICPEGELVNGSRRTKILASTEDLHSRIAALEEALKTATSSQHPLLQDSLYANRKEI
FT                   RQRRSSSSSPESSIQLPSDCLTSFSHLTLGDDPHFSRYYGAASSVYLSKQQSIPVSCER
FT                   FVPSDESVAPRQPHAISNDYTDLFPPFSSVHSQLDIDGIFHQYLPPPEIGLTLAEVYFH
FT                   TFGWFTNIVQRPSWNDVFFHHVYRESASIRSNPVKPQRLAVVLLVFALGALMDLSKPPH
FT                   NEEARHYFNGARACLSLDPSHSVTYVQCIYLYGSYLMNRGEDTSGGDTFWPLLRMGMAV
FT                   CEAIGLHRDGSNWGLEEDQAMVRRIVFWEIHGYDVLQSTALGRGMCISDASIDCQVPLA
FT                   ETDSGFHARAYALTKIWSQINEKQVRIKPFVYSEVAEIDKALCAFQDDLPYHLSPSLPP
FT                   SPDDLTNLARHKEAFQRNTLLLYINEAKLTLHRGWFIRALREYPDEPLSSPFKHSYLSC
FT                   LEACRGVVFLVRNMLILHGQLIHRRWHFFFHLFAACVCLAAAVIRAPASSLVRSILTEL
FT                   ESGINLFKIADREELITVNRLREKAVRAMQNISSASFNELETETEDLDLLGARTTLRRA
FT                   APKVSTHEQSGVIPLTVPLFYENTSIPPNAERTETMTAMLDVDDMNQGNLEWNDFDMDT
FT                   FLREIGAI"
FT   gene            540933..546310
FT                   /locus_tag="CNA02030"
FT   mRNA            join(540933..542415,542466..542761,542816..542905,
FT                   542961..543194,543249..543549,543615..543745,
FT                   543799..543850,543909..544045,544106..544933,
FT                   544984..545092,545143..545407,545460..545991,
FT                   546044..546310)
FT                   /locus_tag="CNA02030"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 2,
FT                   putative"
FT   CDS_pept        join(541082..542415,542466..542761,542816..542905,
FT                   542961..543194,543249..543549,543615..543745,
FT                   543799..543850,543909..544045,544106..544933,
FT                   544984..545092,545143..545407,545460..545991,
FT                   546044..546240)
FT                   /codon_start=1
FT                   /locus_tag="CNA02030"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40764"
FT                   /db_xref="GOA:Q5KPP4"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR025305"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP4"
FT                   /protein_id="AAW40764.2"
FT                   /translation="MTQYSSPSPPTSNLTSPPTRPGTLPVAFSPRSHPHGPRSPESQST
FT                   RRSAPGSSHTRYRTMPLPADSSSTSIPHRSSSISEHADSPVIVDEPEIGLPEAPYRPPE
FT                   AVIDPPEDDPPPYTPGIVAEHIGEDGDMQVDSKFTAKDFNAWQSNLESYDQMEIDQSTS
FT                   QSSMPQLGPGVLPRRWLAIAHEHELVRPYIEALPPPSKKFHSQTHAQVAAGQASLPPPS
FT                   QRPTPVFASNNPFAQDSPRIATLEDIIQALPGDGDDSEHWYFCSTCWGWLKIKAGHGLP
FT                   PGLQSMEEWEASVIEQKAYPDIESFEKAREQRRDEWARLVGIQNSRLVAPQEHHHFHQF
FT                   NTLLPSSKLARIDRVVVEEHLNVFPHITVGLDPEESWESFNLPHSPSRLFLSDSSDVWI
FT                   SVDEGLVPGQLPVGLVNAFTAEKMSNPNPGLDGVQSVNEAWNLIATLLINPLFKGQRGW
FT                   VNLNNAKFQSKIGAGLASSHIMYHIGFACQQEPDGLRVGPFKGGSESGSAAQIANEAGN
FT                   MAKMDKYMLRVWIEVTLYLLAFLRRNKLQAITPPYMDAIPLEISINDIVPFAQYPTSTA
FT                   PFPDNVREACHILGVTKYDTAETLETAYDLQIMFDEHNTPRYLGALERISEASVVGKSS
FT                   LELKVAVERSLDKYTDDEVLKAYSLIGYTRQHAEDISIPPQGAPDDYILSMHKSAIQAS
FT                   TSSQQRQDLNRALVLIGKDRRSEQLKSMGEKGQTFVSVQEAYEALSAPRDAVDDGLIMQ
FT                   YEMAVNEYPGKADHYRMCLSVIADAPGEERPGLKQFLQTGSREPDVPARKDIPAGLQNI
FT                   GNTCYLNSILQYLYTIKPLREAVLIFEQDKSKIVPTSKSEVERAKRFVRQLRLLFLQLY
FT                   KTELPAVRPDEELAYLAITRPEIDSMVEQTQEPPTELSASTATATDSAQITPNLLDSIP
FT                   SVPELTTLPSPSSTIFASPPESPRQDLTGTPIPLEQDEITEEMELDADKENIRSPESSS
FT                   TRSRDTSSTSTILGKRGNQDRERDNSRSPGEERVKYKQAEGSGNNATRGKSESESALEF
FT                   ELGTGSRVETTQADQVESPSLGTATEIAHLELTTPAGSPSQTRKEEAEVLALTQPEDKY
FT                   ESPSAPPSLPPRPQARKQETLSSGLRFGLQQDAAEVLINVLSQLELALEQPGEDGKEAS
FT                   NLIKNLYSCKYRQQTVYESSSPSSDDQPTYDAQTPVESVFTHPIIGVEEEGKDLYDCLA
FT                   ELYLGGSAIEYEGKKGFMMDLMDEFPPMLYIQMRRSQYDPVTGRDRKTNTHISFPQTLC
FT                   MSRFLTSAPAEKREESIALTREIIRMRTRLHSLRNHTPLSIPSTYKHASSALRQLASSG
FT                   LDIPELNEVLSPELCDALDREGDEVIKEIEELQQELPKLKERMDEIWRDVHEEEEEDEH
FT                   VKAYDYELVSVYMHRGKTSGSGHYWTYQAHLPGHSEEFYNYNDEKVTVVPASEVLQDRT
FT                   GSDANPALLCYARKGWDLVDSLHREILEHSSPEVEELVLT"
FT   gene            complement(546174..548736)
FT                   /locus_tag="CNA02040"
FT   mRNA            complement(join(546174..546810,546862..547378,
FT                   547439..547511,547572..547667,547724..548042,
FT                   548108..548565,548615..548622,548667..548736))
FT                   /locus_tag="CNA02040"
FT                   /product="ferric reductase transmembrane component,
FT                   putative"
FT   CDS_pept        complement(join(546368..546810,546862..547378,
FT                   547439..547511,547572..547667,547724..548042,
FT                   548108..548565,548615..548622,548667..548723))
FT                   /codon_start=1
FT                   /locus_tag="CNA02040"
FT                   /product="ferric reductase transmembrane component,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40765"
FT                   /db_xref="GOA:Q5KPP3"
FT                   /db_xref="InterPro:IPR000778"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP3"
FT                   /protein_id="AAW40765.1"
FT                   /translation="MSSSTEHLRRYIPIPTQYQIYNSYTEDPKWQKKFTIIWTSFLAFS
FT                   LLLSIPYIIHHFRIGRLYSGLAIRESLDPSQNVSDSSHGNAKRSHSQNKWRGTFIGRAV
FT                   TGVGAIVQSITLWTLPMPDLSWLKGEVGDCCRRAYFTLSVSQIVLVLGYAGAVIACFVV
FT                   GASLTQNSNRPGFLALSQLPLIVLLSLKSPLPLPIFVPSLSYEHYNFLHRWTGRTLFLS
FT                   ATVHGAMWIHQFVVTDQYDQIAAAKSKRGILAYALMGMVVITSLKPIRRKCYQLFWMAH
FT                   IMFFVGFFAAISYHTPYSRPWIWPCVAIYAYDLVVRMLRYRIKDATLVPVDKTLTMIHI
FT                   PDCDAGWLPTQHVLLRVLSGSGIFESHPFTITNAPSTAFSASPRGIILYAKVAGDWTKK
FT                   LHDLARDVKSLEVGDDLEEKESFLANKAQNEGGVNADEEGIDHPGKRVQVMIDGPYGGL
FT                   KMDLGQYESVLLVGGGSGITFILGSIEEALRVREKGRGPAKVDVAWIVKDLCTIEALAP
FT                   SLLHLYTLAQRLRLTLTYNLYLTDPPHPLPSTPSLLPASTTLSPYRPEVAQLVRESLPL
FT                   PLTKAQETLLEQGRELITGDDDGHQTQHHGEGRGHAGGLAVVACGPEGIVMEAKSAVAG
FT                   LGIAERVRCGGVGFHGECYLL"
FT   gene            548886..549945
FT                   /locus_tag="CNA02050"
FT   mRNA            join(548886..549000,549039..549621,549672..549945)
FT                   /locus_tag="CNA02050"
FT                   /product="L-cystine transporter, putative"
FT   CDS_pept        join(548888..549000,549039..549621,549672..549866)
FT                   /codon_start=1
FT                   /locus_tag="CNA02050"
FT                   /product="L-cystine transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40767"
FT                   /db_xref="GOA:Q5KPP2"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPP2"
FT                   /protein_id="AAW40767.2"
FT                   /translation="MQPHPLAAFLVNLTGVTYFIAWSYSFYIQLVHNFKRKTTHGLSPD
FT                   FVWVNPLGFLALTLWNWGAYFSPVARKQYQDRHHGHLPQVSTSDLAFSLHALIISTITL
FT                   AQVFWYGYFRQLLTGHSSSDQHSDEASPLISDSVHNSAAGDDSESSNLVIFHSPIRPSP
FT                   VAQLFLGGIVISPFVYAIFVWTGKAQFLDWLYYVGNIKVVISAVKYIPQVVLNHRMRAV
FT                   NGFAIGVIICDIIGSVLSFSQLVISSVFIDHDPSGIIANPAKLGLAGLSFTFDLVFIAQ
FT                   KYWLYRIKKDDEERT"
FT   gene            complement(549899..551246)
FT                   /locus_tag="CNA02055"
FT   mRNA            complement(join(549899..550467,550553..550844,
FT                   551047..551246))
FT                   /locus_tag="CNA02055"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(549973..550467,550553..550844,
FT                   551047..551240))
FT                   /codon_start=1
FT                   /locus_tag="CNA02055"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI43"
FT                   /protein_id="ALO60297.1"
FT                   /translation="MSQMPRPPKRPPAARSTQQQYPSTAYIHSYEASLTCPESSSQTET
FT                   GGLIRYAGEVQGDYEIWADRHDIIHLLPSLPNTTSLVSPPSPTLSSSSSSWSLPSDTEE
FT                   IWYLSDPEEIEVYKNEKKKKWMEALRQERLREREREDLEAGKVEKAGHVDGRWDPDEEP
FT                   PTQIRTLMSHTATSIFSSPNPSLLEMRILTHHSTDERFAFLRGRWRNAWEKVKGNIKGE
FT                   KENKRRLEEKERGLGGLGGYESDSEESGEEEEPSIPPEDDGIPPPPPDVDDTVPPPPPL
FT                   PVEESESGTFPPPQPQPSTEEDQEEEKKRQRRLRVEEWKKQRVSG"
FT   gene            551378..554846
FT                   /locus_tag="CNA02060"
FT   mRNA            join(551378..551485,551568..551768,551827..552984,
FT                   553036..553109,553169..553223,553288..553698,
FT                   553751..554229,554289..554354,554412..554533,
FT                   554584..554651,554703..554846)
FT                   /locus_tag="CNA02060"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(551427..551485,551568..551768,551827..552984,
FT                   553036..553109,553169..553223,553288..553698,
FT                   553751..554229,554289..554354,554412..554533,
FT                   554584..554651,554703..554757)
FT                   /codon_start=1
FT                   /locus_tag="CNA02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHT1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHT1"
FT                   /protein_id="ALO60298.1"
FT                   /translation="MRFREIIITPTWEAIGPFPSGTRELPFLGSPLAAYSTSSADPDIE
FT                   FAHRPYSPEETWPSELGNGGRVSWSRFEAKGDWLEISYPNVNWDQLRSDHGWSALQYMV
FT                   LLRTRLTIPKSGHKRLTPVLINMLQLSEFALVRQGADPHTSGPVRWYQGNSYGFGGPAP
FT                   GLDSTIKPAAVRFERSLLLEPGVYIMLARAVYDIRQFGDPGPGNPPIIKMSSVNMVHDT
FT                   EKHVTQLPEEMGTFPSVLSGWLMGEWASVGVRVPEGALETTVIDVNSAKVIYKSRDAEP
FT                   LERVLAVEIVSNISIVPGQTRLIPMRIRQQTPLSLEARTLSISIDFQSGGQTRVLQWSF
FT                   PLHHVTYDSHNLTTNNPHFWITCASPSLITDSHLNHLPAHVSSAMIVPPKHSVRHDEEK
FT                   PVILALHGAGVDVKNSEWGERMPEVPGVWAVLPIGKNEWGEDWHGGSMEDAWAARAAVE
FT                   VLLRKAGIALSDKTVIIGHSNGGQGAWHLAARYPDRVVGVVAASGWLTIQHYVPYTDYT
FT                   SNRYADPALMGILHSSLAPYHNDLHSSNLSDIPILAIHGADDDNVPPRHSRAHAALVSS
FT                   WAGEKDSFIKVLEIPKRGHWWDDVLSSSDVVDFIQKLPPRQSWDEQRKKGYTLTTANPQ
FT                   ECGGRAGIRIVELDTPGRLARLDVNARQWKSNQTAETLDIRGMNVRRIEIKSLQSSQHF
FT                   QTYVRCRPYGFSPVNNSILGPLAPARAYGPMIRILSSPASFHLIIPSSGEAQPHHLSIA
FT                   KRIAHDLYVYHKADCDIIADQEGLERVAKGKIGPGSIIVIGRPENNRYTEWMAAEGKIP
FT                   IQFPTKGVMAISKDKVVSDRGAGFIALHPHPTHSGSLSLLIAGNDELGLELATRLFPTR
FT                   TGVPLPDWAMICPRSRWQGANGLIGAGFWGGEWEYNEAMSWMDR"
FT   gene            complement(554824..556339)
FT                   /locus_tag="CNA02080"
FT   mRNA            complement(join(554824..556077,556165..556339))
FT                   /locus_tag="CNA02080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(554981..556077,556165..556312))
FT                   /codon_start=1
FT                   /locus_tag="CNA02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41328"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN9"
FT                   /protein_id="AAW41328.1"
FT                   /translation="METPHSLNRRKRETREDGTDLPESSPRAPLVAWKHDQRIRNAILQ
FT                   ATEDELIDPPIPTQQPRPISSKLSHSSTTINDPVRPRKRICRNHRSLPPCLRNALPSSS
FT                   ASHSLAGSSGVLSEASIKDISGSASAKTQLDLLLEQFRLQVSPMKRATEEGSQPEGRPK
FT                   RHGKENQTNSARRKSKEKERGQQKALQDKKAKKGDVPLQKHAELSTSAKMRGDSSSSIL
FT                   SHNSSATDISFISAPTHHTSFDRRMSHSSSISSIRSPLSPVKPGAAPRIGLGSQNKPSK
FT                   IPPPRISTLKTFKTPFLEPRQGIRSSPRLIESARPAIPQTPARDRACSRVPTTPSIRTT
FT                   VSGSSSRATPTRPNSSGPQTRSAKKLASNPSGFTNFDVGEDEPEGDRSFDSFDGIFNEG
FT                   GPEIEMLLRQVDGTQ"
FT   gene            556541..557667
FT                   /locus_tag="CNA02090"
FT   mRNA            join(556541..556653,556706..556759,556827..556948,
FT                   557006..557086,557146..557216,557267..557453,
FT                   557504..557667)
FT                   /locus_tag="CNA02090"
FT                   /product="vesicle-associated membrane protein 712,
FT                   putative"
FT   CDS_pept        join(556572..556653,556706..556759,556827..556948,
FT                   557006..557086,557146..557216,557267..557453,
FT                   557504..557566)
FT                   /codon_start=1
FT                   /locus_tag="CNA02090"
FT                   /product="vesicle-associated membrane protein 712,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40773"
FT                   /db_xref="GOA:Q5KPN8"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN8"
FT                   /protein_id="AAW40773.2"
FT                   /translation="MSLIHALIARGTTVLAEHATGTAELKPAAQITILSKIPPNNSKLT
FT                   YVWQDRLIHYVSSNGVIYLVMADDSVGRRMPFAFLADLERRFTAQYESDDIVSAGAHSL
FT                   EEFEPELAKLMHQYTSSPPADPLRQAQSDLNNVKDIMVQNIDSILQRGERLDLLVDKTD
FT                   TLAGQAYAFRRGARSVRRQQWWKNMRIMALSGVVGLLLLYLFIAQFCGASLGHCRS"
FT   gene            complement(557574..559102)
FT                   /locus_tag="CNA02100"
FT   mRNA            complement(join(557574..557862,557919..558052,
FT                   558103..558313,558370..558451,558513..558625,
FT                   558674..558751,558814..558853,558910..559102))
FT                   /locus_tag="CNA02100"
FT                   /product="DNAj protein, putative"
FT   CDS_pept        complement(join(557674..557862,557919..558052,
FT                   558103..558313,558370..558451,558513..558625,
FT                   558674..558751,558814..558853,558910..558995))
FT                   /codon_start=1
FT                   /locus_tag="CNA02100"
FT                   /product="multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40775"
FT                   /db_xref="GOA:Q5KPN7"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR035299"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN7"
FT                   /protein_id="AAW40775.1"
FT                   /translation="MEGLQRLLQGGRGMGMGGAAGGQTVVADNGETVHISALALLKMLK
FT                   HGRAGVPMEVMGLMLGEFVDDYTISCVDVFAMPQSGTTVTVESVDHVFQTKMLDMLKQT
FT                   GRPEMVVGWYHSHPGFGCWLSSVDVNTQQSFEQLHPRAVAVVIDPIQSVRGKVVIDAFR
FT                   SINPAALATGQESRQTTSNIGHLNKPSIQALIHGLNRHYYSLAIDYKKTEAEQGMLLNL
FT                   HKRGWTEGLKMKDFEEMEQGSQKAIENMLNLAVAYTKSVQEESTMTEEQLKTRHVGKLD
FT                   PKRHLSEAAEKAMEDQVIQSLAMGVLAEL"
FT   gene            559251..559336
FT                   /locus_tag="CNA02110"
FT   tRNA            559251..559336
FT                   /locus_tag="CNA02110"
FT                   /product="tRNA-Thr"
FT   gene            559723..561987
FT                   /locus_tag="CNA02115"
FT   mRNA            join(559723..560683,560737..560972,561039..561392,
FT                   561456..561598,561668..561779,561829..561987)
FT                   /locus_tag="CNA02115"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(560467..560683,560737..560972,561039..561392,
FT                   561456..561598,561668..561779,561829..561987)
FT                   /codon_start=1
FT                   /locus_tag="CNA02115"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR040521"
FT                   /db_xref="InterPro:IPR041320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV7"
FT                   /protein_id="ALO60299.1"
FT                   /translation="MKRKKNPYRQEMLDLMTAWRKVLPEAFITYTRFGRGSRNFQTPLR
FT                   GDKALDLNEPCACTKKSRIVTLISLEEQWQEDVQFCPCSSEPIRLIERGFMPVTMAFPE
FT                   TAISFRLLSFFHSIWQHVPIAVQGFADGLFAWQSQLSGVVRAKGSHKARNGGPLIRQAM
FT                   QFYRELLLRERKVIDKAVNRSLRDIVAGQCPCCFGPRKEQDLPAGTADFVIACDGNFEH
FT                   SRPIAAAQNDFPKNHPDLFLKTNQLDKARLAVLANGGNSTKVKFDDSACSDHWKAKDGG
FT                   VSDNAFKDKVDTGLFGMVCRHEIGLKLINLVKTGEKLYNPLALVLWILQDVDKEGRLAL
FT                   LYDIGCNFDAHIKKRNLLVEERDQNRLLIGVSVFHAYAHNWLCQMRYNPRLIAGFGFSD
FT                   GENSERF"
FT   gene            complement(561685..564058)
FT                   /locus_tag="CNA02120"
FT   mRNA            complement(join(561685..562058,562136..563242,
FT                   563312..563834,563897..563942,564009..564058))
FT                   /locus_tag="CNA02120"
FT                   /product="hypothetical protein"
FT   gene            562009..563919
FT                   /locus_tag="CNA02125"
FT   mRNA            join(562009..562094,562149..562277,562337..562576,
FT                   562628..562795,562867..563919)
FT                   /locus_tag="CNA02125"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(562160..562277,562337..562576,562628..562795,
FT                   562867..563246)
FT                   /codon_start=1
FT                   /locus_tag="CNA02125"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIK6"
FT                   /protein_id="ALO60300.1"
FT                   /translation="MKQLCRVHAAFITLRQQFRKYKAVTEKFEQTRKGRKPKLGTKNTQ
FT                   RYSKQLRSPALAAAIKKYDLAVKNYADTFNPKNVPEFAVSVEALQAKDDEDIFWDDMVF
FT                   DIKEADWSRNQDCRQGIKFMLMRDRAVEEKARLQAETARLIRWCHDRHNIIEECISKIK
FT                   SKMTVPSSSNSTADCNDVNLFFLEETKERHAALEEQRIGDGLWRVWDKRPEPCLEDEGV
FT                   EDILIMLRERVGIRWGFETTGMDGNPSLDEVYVEKDREIVEVDVSETDGEERTDDREDV
FT                   GAGKLPGCFVHFLSADILED"
FT   CDS_pept        complement(join(563139..563242,563312..563789))
FT                   /codon_start=1
FT                   /locus_tag="CNA02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41329"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN6"
FT                   /protein_id="AAW41329.2"
FT                   /translation="MSSQNPARSIQDRPGDNAVFPTDDIWDRATPDDSFSSKTGDSEDE
FT                   EGEDLPARDTPFGDRERQGGDSQTTRDEGINAELFCAAQKGRCRMNKSVKTALNKFLSA
FT                   QRKALMEFCVQHDVRLATAERYANSQNHRRESGTWQLWRRSRMRRTALLEKFGEEILKN
FT                   VSRKEMDEASRELSRTDVFSIICSFFAVCL"
FT   gene            564218..566041
FT                   /locus_tag="CNA02130"
FT   mRNA            join(564218..564427,564474..564590,564645..564815,
FT                   564867..566041)
FT                   /locus_tag="CNA02130"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(564419..564427,564474..564590,564645..564815,
FT                   564867..565847)
FT                   /codon_start=1
FT                   /locus_tag="CNA02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40777"
FT                   /db_xref="InterPro:IPR013256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN5"
FT                   /protein_id="AAW40777.1"
FT                   /translation="MSEYQALKARALEMQREKEEAMKMELAAKQEREKQLAREQEERRK
FT                   RLEEASKEARRRELMRAHEELNRKTGGAGNRVSQAEYDPFAEDVKPIATANIPKPSARS
FT                   GPSKISKTSLNKPASSSSTKASTSNKSGNSKNGGPSKGSSPPVTAVLGRKEKAARLFAQ
FT                   KAKKSAADSLFSVRSLVESREPAQVRVTPRAGPSQVPPTSMKTEMRGKANGGGRNAAVR
FT                   SRLMMNGKEELRKLCPDRDVRDRRSIDEISRDLKAKRLLTDESSPQKNSRPLTASMSKL
FT                   SIPSSKAREKRPISNPPSEKRRRYSLDDSTDSESESSSSRQAKRRPKKRSRSPPSQFSE
FT                   PSAAFISAEIQALFRRPGRSGPKYADDFSDASSDDMEAGLSDVEIEERRAAKIARLEDE
FT                   AAEKEEREHKLRKEALKKQKLKGGKA"
FT   gene            complement(565908..567764)
FT                   /locus_tag="CNA02140"
FT   mRNA            complement(join(565908..566310,566368..566435,
FT                   566498..566861,566907..566984,567032..567135,
FT                   567188..567764))
FT                   /locus_tag="CNA02140"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(565940..566310,566368..566435,
FT                   566498..566861,566907..566984,567032..567135,
FT                   567188..567750))
FT                   /codon_start=1
FT                   /locus_tag="CNA02140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40779"
FT                   /db_xref="GOA:Q5KPN4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN4"
FT                   /protein_id="AAW40779.1"
FT                   /translation="MLAPTVAKIPPTPDLPRDHHGPPAKPLASLQETAAPKYFRNPWPS
FT                   YRTASMWDAYQAYQRGASIAPHPSFFQGSRFFDGEEPYRDQEEDDYESEPIWTESDSIK
FT                   KRKIYIRPEFSDIRPGDEKDDWRDPPVGLVEPDWGGNSKTGERVTWLGHAGVLVQIPWR
FT                   IMDQEQTSRGGATCGILFDPIFSYRCSPTQYIGPARYMDPPCSVSMLPEIHICCISHDH
FT                   YDHLDYNTIMDLWKYHQATIHFFVPIGLKPWFTASGIPYHRVTELDWWREAIVSFEASP
FT                   DVDYDPHYPPDDYENKKSIAEDLTKTDTSALTLKVAFTPAQHRSGRSVLDHMTTLWGSW
FT                   CVGVVEAADAGKVLKRGMNDWKGFKIYFGGDTGYRYASAPEGDSDAICPAFQQIADYYA
FT                   PFNLALLPLSTGSSLPFLRTVLSLSLDQYILTSSLHCSPADSLDIHLIIKSERTLGIHW
FT                   GTFCDADEARGTRVDFGRCRRSYGVSPEWDTIEAEKGRFVITDIGQTLIFPTTTDDN"
FT   gene            567919..569626
FT                   /locus_tag="CNA02150"
FT   mRNA            join(567919..568113,568163..568354,568411..568538,
FT                   568590..568663,568713..569116,569170..569626)
FT                   /locus_tag="CNA02150"
FT                   /product="expressed protein"
FT   CDS_pept        join(567998..568113,568163..568354,568411..568538,
FT                   568590..568663,568713..569116,569170..569572)
FT                   /codon_start=1
FT                   /locus_tag="CNA02150"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40781"
FT                   /db_xref="GOA:Q5KPN3"
FT                   /db_xref="InterPro:IPR009617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN3"
FT                   /protein_id="AAW40781.1"
FT                   /translation="MLFAPATSPPNVRHPYPRPSPGTEFLHFLFHLARLAFAPIIIPLR
FT                   LLYQTLTAPLTISLLLKLVLLFSLSLISLVLSVLAVGAFFWTWSTGGPIEAEGWLVYGS
FT                   RKFRLPHTNLQVPLSSIIEDVRYDIQVEMELLRPRKGSDVLDNFMLSLDLMSAKYPQTA
FT                   LMSAAQPTLAPSPLPESFITLPSLATRFIPPCVLPWPFRSFCPSKIIGYGDPVDQKVLQ
FT                   RRAKAGFLELASTKDIVPLRKDLMEGVLLKPSSAPESVIGSIFLSIGREDSFTGDTEGE
FT                   SHSTEVKTTGWVVVRFIPRPSGIRWLISVHPFPPILLLPPLSLSLTLLSSIFGCAIITG
FT                   IRRKPSNSRKSKRSLKAPSRSHRIRDSNARSGQEGTERQARVQYRAVRTRRASNHTDAD
FT                   STTYSESRIPTENTNSASTSEIGDRNSIVISDDESTSSR"
FT   gene            complement(569480..570505)
FT                   /locus_tag="CNA02160"
FT   mRNA            complement(join(569480..569998,570158..570505))
FT                   /locus_tag="CNA02160"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(569863..569998,570158..570249))
FT                   /codon_start=1
FT                   /locus_tag="CNA02160"
FT                   /product="expressed protein"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI36"
FT                   /protein_id="ALO60301.1"
FT                   /translation="MFGFGRLGHIVFDLLAISTILAGVKKSTGYSIQTSLFTDTAIRSF
FT                   IDSYLSVGETVFGMLSGYAVNSRYFKRNIE"
FT   gene            complement(571134..572558)
FT                   /locus_tag="CNA02170"
FT   mRNA            complement(join(571134..571268,571336..571446,
FT                   571497..571718,571779..571910,571976..572039,
FT                   572159..572279,572349..572558))
FT                   /locus_tag="CNA02170"
FT                   /product="peroxisome organization and biogenesis-related
FT                   protein, putative"
FT   CDS_pept        complement(join(571193..571268,571336..571446,
FT                   571497..571718,571779..571910,571976..572039,
FT                   572159..572279,572349..572435))
FT                   /codon_start=1
FT                   /locus_tag="CNA02170"
FT                   /product="peroxisome organization and biogenesis-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40784"
FT                   /db_xref="GOA:Q5KPN1"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN1"
FT                   /protein_id="AAW40784.2"
FT                   /translation="MSTLATNIILHPKVNRSLAILATTVGRDKVTRLLQYLARLVSWYL
FT                   LSRGRMESASRFEGLKTGLANGRKVMRLFRPAEFLQSAVNLAQRPVTSLKGPGQIAHLA
FT                   QIGRQIGYAGFHTADMIVWLAQVRFLKFDKVTTQRYVRLMYKFWFAGIVCSLVSSSASL
FT                   VRLRADSRRFALSSQVAKEEEKEGRSGEEAARQMAERRERGRALLAQRQSILSQLVSDS
FT                   LDVWIPATGLGYTNLNEGTLGAFGVMTSYMGLQTQWMKHSAAGVKKSI"
FT   gene            572760..574480
FT                   /locus_tag="CNA02180"
FT   mRNA            join(572760..573484,573530..573845,573894..573921,
FT                   573973..574088,574136..574195,574252..574480)
FT                   /locus_tag="CNA02180"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(572775..573484,573530..573845,573894..573921,
FT                   573973..574088,574136..574195,574252..574446)
FT                   /codon_start=1
FT                   /locus_tag="CNA02180"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40787"
FT                   /db_xref="GOA:Q5KPN0"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPN0"
FT                   /protein_id="AAW40787.2"
FT                   /translation="MFKRLPRTLLQPSSRPPQVCSQCRNLSQLRAPVHISQFPRYASTI
FT                   SDRQTKQARMSKLPVSHKPPKRRLEAASQPLRNAASITRGPVLQCIAHTTAEKYDLIAL
FT                   GTTLQSLGVRWDEVPEGDPDRALVIGPWKGRGGAERLISGKDVRSTSTIAKSPAVEWAE
FT                   NEGVDLRDMGFGYGERGEIWVFSSGSFVTWGLTEEEGKAFLRQVIRGGRNVEIDRVSPK
FT                   ECELEEVDFVVDPTAKTHILGNLILLGRPPQLSTFHYSPSLASLLARYTLSLSLSRSSS
FT                   LSVLEERLDNHLASVSILPRTLEMYGRQPLPRKEVIRKMGELMTLRMAVNTAGGGLDDT
FT                   PEFYWSEPELESYFDSVASEFEIKERIDVFNKKIDYAQEVQSTLRALLTESSGHRMEMI
FT                   IILLISVEVVIVLIREGPDLIHKLLEIVGVAPAEAEDITENIQKVADKLPSIGAISSPA
FT                   IRHTTTHWADGSERYV"
FT   gene            574947..575041
FT                   /locus_tag="CNA02190"
FT   tRNA            574947..575041
FT                   /locus_tag="CNA02190"
FT                   /product="tRNA-Ser"
FT   gene            complement(575209..575303)
FT                   /locus_tag="CNA02200"
FT   tRNA            complement(575209..575303)
FT                   /locus_tag="CNA02200"
FT                   /product="tRNA-Ser"
FT   gene            575664..579222
FT                   /locus_tag="CNA02205"
FT   mRNA            join(575664..576899,576950..578414,578466..579222)
FT                   /locus_tag="CNA02205"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(576698..576899,576950..577062)
FT                   /codon_start=1
FT                   /locus_tag="CNA02205"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIF6"
FT                   /protein_id="ALO60302.1"
FT                   /translation="MGPIVMQLADLPNQYRSQFLYTMLMGITPAPREPPSCFLHRLLLP
FT                   LAVELLSAHCDGLWVKTPKYPEGRLILSALARFTVTDLLLWLLPGALTTRGKTRHASNV
FT                   "
FT   gene            580568..582335
FT                   /locus_tag="CNA02210"
FT   mRNA            join(580568..581051,581119..581345,581402..581655,
FT                   581714..581847,581897..582041,582101..582335)
FT                   /locus_tag="CNA02210"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(580698..581051,581119..581345,581402..581655,
FT                   581714..581847,581897..582041,582101..582273)
FT                   /codon_start=1
FT                   /locus_tag="CNA02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41326"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM9"
FT                   /protein_id="AAW41326.1"
FT                   /translation="MKIDSLSTPGHSTIDDESFIPHLLTFQRQYFSLYPPYLLTFPDSF
FT                   LLASPLGQDFLLRCILGENVEADEPDLDQPIQRERWVKLYQPEKTYQTKVWKKIMASLE
FT                   AGIKSVERLDNSEWAIDDRFYDHMVTLMVSSNPIPLDNGPQTSYRTFLYDMPDATFHGT
FT                   FGHDKPQNDARITLLEEQIAIQGGTTGLRTWTAALHLGHHILNHFSTLFSLPRDPDRGF
FT                   IELGAGTGFVSILLAQMGFKVVATDLESPANQTGEQSENGNSVITPLGRLQSNIELNQY
FT                   DVKPQSLHLNWYDARRPRDTDPSLEAWSKIQELHWDIVAADVIYDPDLVRPLVDTIDVL
FT                   LGNHDGPEKLRAVISATIRNQETFDLFLETCDKHNLRVDILSLPTMSAQASTFWDSALD
FT                   AGTRVLIMRITKHPITSRGNIISRQSYDF"
FT   gene            complement(582327..583057)
FT                   /locus_tag="CNA02220"
FT   mRNA            complement(join(582327..582404,582458..582572,
FT                   582624..582693,582900..583057))
FT                   /locus_tag="CNA02220"
FT                   /product="60s ribosomal protein l30-1 (l32), putative"
FT   CDS_pept        complement(join(582381..582404,582458..582572,
FT                   582624..582693,582900..583032))
FT                   /codon_start=1
FT                   /locus_tag="CNA02220"
FT                   /product="60s ribosomal protein l30-1 (l32), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40789"
FT                   /db_xref="GOA:Q5KPM8"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM8"
FT                   /protein_id="AAW40789.1"
FT                   /translation="MAPVKKSKSAKSSESINTKLQLVVKSGKFTLGYKQALKQLRSGKA
FT                   KLILISKNCPPLRKSEIEYYAMLSKTNVHHYDGSNVDLGTAAGKLYRVGVMSIQDAGDS
FT                   DLLQQQESA"
FT   gene            583277..584071
FT                   /locus_tag="CNA02230"
FT   mRNA            join(583277..583534,583648..583770,583891..584071)
FT                   /locus_tag="CNA02230"
FT                   /product="chaperone, putative"
FT   CDS_pept        join(583368..583534,583648..583770,583891..583912)
FT                   /codon_start=1
FT                   /locus_tag="CNA02230"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40791"
FT                   /db_xref="GOA:Q5KPM7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM7"
FT                   /protein_id="AAW40791.2"
FT                   /translation="MASPLVVGLGLLGAGLAGRVGYQMMRASRGGAQEFLKGGFKAKMD
FT                   RSEAIQVLGLREPITSNKLKDAHRRLMLANHPDRGGAPYLAGKVNEAKALLDKEVVRR"
FT   gene            584386..585863
FT                   /locus_tag="CNA02240"
FT   mRNA            join(584386..585176,585227..585475,585528..585863)
FT                   /locus_tag="CNA02240"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(584479..585176,585227..585475,585528..585804)
FT                   /codon_start=1
FT                   /locus_tag="CNA02240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40793"
FT                   /db_xref="GOA:Q5KPM6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM6"
FT                   /protein_id="AAW40793.1"
FT                   /translation="MALDQDATDEQLYADLPSPLHLSPSELIETYHPNVLAPLVRCSKL
FT                   PFRHLTSLYETHITHTPMILAEEFSRAQIARTSDFSTSSNERGVYWMAPNNGKCRGKGE
FT                   YITRVGHPEDVRPAKEPWKTYHSPPSTERLPPSPAPPNPQAQLVRGCLIAQFASPNAKS
FT                   LADAAELISPYVDGIDLNCGCPQRWAYNEGIGCALLRKPELVRDMVRGVKDRMGWGWPV
FT                   SIKIRIDSEQEKTEQLISNALQAGISHLTIHGRTRHQPSTDPVNLPGIKFAVDCVKGEV
FT                   PCVANGDVWELEDARQMRLHTGVQGVMAARGLLANPALFAGYDKTPEDCVSQFINLGLD
FT                   YGFNFSLFHRHLAYMLESHLSRVEKVWFNSLTSQASAIEWLNERAINFKEKRGTIWDAR
FT                   RGYNITDV"
FT   gene            complement(585831..588337)
FT                   /locus_tag="CNA02250"
FT   mRNA            complement(join(585831..586310,586361..586517,
FT                   586574..586776,586825..587074,587124..587246,
FT                   587297..587463,587511..587598,587656..587822,
FT                   587876..587934,587985..588337))
FT                   /locus_tag="CNA02250"
FT                   /product="ammonium transporter MEP1, putative"
FT   CDS_pept        complement(join(585903..586310,586361..586517,
FT                   586574..586776,586825..587074,587124..587246,
FT                   587297..587463,587511..587598,587656..587822,
FT                   587876..587934,587985..588090))
FT                   /codon_start=1
FT                   /locus_tag="CNA02250"
FT                   /product="ammonium transporter MEP1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40795"
FT                   /db_xref="GOA:Q5KPM5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM5"
FT                   /protein_id="AAW40795.1"
FT                   /translation="MVNITYGALLSSSDGAVHFEPLGTDIISTLAGQPTAFDPGDIAWV
FT                   LTCSALIVFMLPGLGYLYSGLARRKNALSMLFLSLVSLGIVSFQWFFIGYSLVFSETGG
FT                   SFWGDGRNIGFRQVLERPIPEANGKLPEIVFATFQLMFACLVPAVLLGAAAERSRILPA
FT                   MIFMFCWTTLVYDPLAHWIWSANGWANKWGVLDYAGGVPVEIASGTAGLAYSYFIGKRR
FT                   GYGTDRVLFKPSNVGNVVLGTVFLWVGWLGFNGGSCYCASLKAALAIFNTNLAGSVGGV
FT                   VWLIMDFRLERKWSMVGYCTGAIAGLVAITPAAGYVGAPAAALIGLVSAAVSNLATRLK
FT                   VTMRVDDPMDIFAVHALAGIVGVLMTGLFAQSSVAANDGFSDIDGGWLDRHYVQLGKQI
FT                   AWACVGMAWTFVVTYAIMFFINLIPGCHFRATDEAEIVGMDEVELGEYVADYAFHQRDL
FT                   EGEYEAHTLSQCPSATKLHLQEFRHNKDGESSSSSQPKELPPTMPRGGAVVGDLDGDTA
FT                   VESQHSRSRSRGRSQHRVRIEKEGDNEAMEMSDVRHTKTSDQRQEGSNLEGSYMDHRE"
FT   gene            588782..590576
FT                   /locus_tag="CNA02260"
FT   mRNA            join(588782..589044,589107..589794,589852..589994,
FT                   590047..590576)
FT                   /locus_tag="CNA02260"
FT                   /product="8-amino-7-oxononanoatesynthase, putative"
FT   mRNA            join(588782..588813,588878..589044,589107..589794,
FT                   589852..589994,590047..590576)
FT                   /locus_tag="CNA02260"
FT                   /product="8-amino-7-oxononanoatesynthase, putative"
FT   CDS_pept        join(588931..589044,589107..589794,589852..589994,
FT                   590047..590445)
FT                   /codon_start=1
FT                   /locus_tag="CNA02260"
FT                   /product="8-amino-7-oxononanoatesynthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40797"
FT                   /db_xref="GOA:Q5KPM4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM4"
FT                   /protein_id="AAW40797.1"
FT                   /translation="MTQLDDRLDDFLRGRKQKGRFRSLKEYDTSPHSGLTDFSSNDYLS
FT                   LTSSESLRSAYLERLANSPQILGSTGSRLLSGCSPAHSALENRLSTLFNSPSALLFNSG
FT                   WDANVSFFATVPQASDWVICDELVHASVHSGLRSSRVPPEKRLIFPHNSPEGLEKVLQQ
FT                   IARNPSSGHDSTVFLALESLYSMDGDMAPLPLLLDIFEQYVPRTRQCVVVDEAHSTGVY
FT                   GEHGKGLVYALGEEGGWAPGDGNKRGKSRVDVRLMTFGKAVGCSGAVLLCSPTVRTFLI
FT                   NFARPFIFSTAMPHSTVIALQCVWDLLLGLEGNKRRESLMAIAAYIHSLLNDLLRNTPA
FT                   EILRLPPNSGAQFTFHIPPHDTESVSSSPLSPILGLLTPTPHALSAFLLEKGFIVRPVV
FT                   PPTVPPGAERVRICLRASMDKKVIDQLMAALREWVESKMNVGVMRAKL"
FT   CDS_pept        join(588931..589044,589107..589794,589852..589994,
FT                   590047..590445)
FT                   /codon_start=1
FT                   /locus_tag="CNA02260"
FT                   /product="8-amino-7-oxononanoatesynthase, putative"
FT                   /db_xref="GOA:Q5KPM4"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM4"
FT                   /protein_id="ALO60303.1"
FT                   /translation="MTQLDDRLDDFLRGRKQKGRFRSLKEYDTSPHSGLTDFSSNDYLS
FT                   LTSSESLRSAYLERLANSPQILGSTGSRLLSGCSPAHSALENRLSTLFNSPSALLFNSG
FT                   WDANVSFFATVPQASDWVICDELVHASVHSGLRSSRVPPEKRLIFPHNSPEGLEKVLQQ
FT                   IARNPSSGHDSTVFLALESLYSMDGDMAPLPLLLDIFEQYVPRTRQCVVVDEAHSTGVY
FT                   GEHGKGLVYALGEEGGWAPGDGNKRGKSRVDVRLMTFGKAVGCSGAVLLCSPTVRTFLI
FT                   NFARPFIFSTAMPHSTVIALQCVWDLLLGLEGNKRRESLMAIAAYIHSLLNDLLRNTPA
FT                   EILRLPPNSGAQFTFHIPPHDTESVSSSPLSPILGLLTPTPHALSAFLLEKGFIVRPVV
FT                   PPTVPPGAERVRICLRASMDKKVIDQLMAALREWVESKMNVGVMRAKL"
FT   gene            591171..593929
FT                   /locus_tag="CNA02270"
FT   mRNA            join(591171..591246,591322..591543,591606..591742,
FT                   591795..591875,591928..593434,593487..593929)
FT                   /locus_tag="CNA02270"
FT                   /product="3-isopropylmalate dehydratase, putative"
FT   CDS_pept        join(591332..591543,591606..591742,591795..591875,
FT                   591928..593434,593487..593838)
FT                   /codon_start=1
FT                   /locus_tag="CNA02270"
FT                   /product="3-isopropylmalate dehydratase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40800"
FT                   /db_xref="GOA:Q5KPM3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR012235"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM3"
FT                   /protein_id="AAW40800.1"
FT                   /translation="MPAPITTPRTLYDKVFDDHVVHSGEGDTLIYIDRHLVHEVTSPQA
FT                   FEGLRNAGRKVRRPDCTLVTVDHNIPTISRKNFKNVNTFIGEADSRAQVAALEDNVKEF
FT                   GLTYFGMNDKRQGIVHIIGPEQGFTLPGTTVCCGDSHTSTHGAFGALAFGIGTSEVEHI
FT                   LATQTLPQAKSKNMRINVEGTLAEGVSSKDIVLHIIGVIGTAGGTGCVIEFSGSTIRAL
FT                   SMEARMSICNMAIEGGARAGMIAPDEITFEYLKGRPLSPREGEEWDKAVEYWKTLKTDP
FT                   GAKYDIEVEIKAEDIVPTLTWGTSPQDVVPITGVVPNPDDFPEAQRGNIVRALEYMGLT
FT                   SGTPMEKVKIDKAFFGSCTNGRIEDMRSAARVILASQKNGGPSKVADGVYAMIVPGSGL
FT                   VKQQAEAEGLDVIFKKAGFDWREAGCSMCLGMNPDQLKPGERCASTSNRNFEGRQGAGG
FT                   RTHLMSPAMVAAASLTGYLTDVRTLMGSHANDDGLKITSYFDYLTPVEVPAQPTEPTEE
FT                   TEEGKTPVKAAAAGSAGLPKFNVLRGIAAPMWEANIDTDKIIPKQFLKTLLRTGLGKAL
FT                   FWPLRYDVETNEEIPDFVLNKEPYRHASIIVCTGPNFGCGSSREHAPWALNDFGIRCVM
FT                   APSFGDIFKTNCFKNGMLPLQLPQADLDTLYEDASAGLEITVDLENQVIVRPNGKPSIP
FT                   FSVDPFRRHCLINGLDDIGLTLVHRDEIEKFEGKRTAVWPWLDGVGYAKKGQKVIAVPV
FT                   RKGARKTDW"
FT   gene            594060..594154
FT                   /locus_tag="CNA02280"
FT   tRNA            594060..594154
FT                   /locus_tag="CNA02280"
FT                   /product="tRNA-Ser"
FT   gene            594490..598443
FT                   /locus_tag="CNA02290"
FT   mRNA            join(594490..594637,594700..594881,594931..595351,
FT                   595398..596412,596465..596656,596714..597230,
FT                   597289..597513,597571..598443)
FT                   /locus_tag="CNA02290"
FT                   /product="isoleucine-tRNA ligase, putative"
FT   CDS_pept        join(594616..594637,594700..594881,594931..595351,
FT                   595398..596412,596465..596656,596714..597230,
FT                   597289..597513,597571..598281)
FT                   /codon_start=1
FT                   /locus_tag="CNA02290"
FT                   /product="isoleucine-tRNA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40802"
FT                   /db_xref="GOA:Q5KPM2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM2"
FT                   /protein_id="AAW40802.1"
FT                   /translation="MSFRTHDPSKPIHIPTTEDEVLQYWRDIDAFKTSQKLSEGKPEYS
FT                   FFDGPPFATGKPHYGHLLAGTIKDIVTRHAHSTGHHVERRFGWDTHGLPVEHEIDKTLN
FT                   IKGKEDVMAMGIDKYNAACRDIVMRYSNEWKSTVERMGRWIDFETGYKTLDPTFMESVW
FT                   WVFGQLWKKDQVYRGLRVMPYSTGCTTPLSNFEAGEDYRMTSDPAITVSFPLADDPTTS
FT                   VLAWTTTPYTLPSNLALCVNPEFTYIKIHDFERDQNFILLESLLGTVYKEYQGGKKPDP
FT                   KKEPKFKKVGTFLGKDMVGWRYVPMFDYFTEQYEDRAFRIIADTYVTDSDGTGIVHQAP
FT                   AFGEDDHRICVANEIVRDDEIPPCPIDESGRFTSEVPEHQGKHVKEADSALIKDLQKKG
FT                   RLITRSDIMHSYPFCWRSGTPLIYRAIPSWFVRVANISDKLVKNNEKTRWVPGAIGEGR
FT                   FGGWLRNARDWNISRNRYWGTPIPLWVSEDYEEIVCVSSIAELEELSGQKGISDLHRES
FT                   IDSITIPSKQGKGTLRRIEEVFDCWFESGSMPYAQSHYPFENVERFQKSYPADFISEGI
FT                   DQTRGWFYTLLVLGTHLFETAPWKNLIVTGLVLAADGKKMSKKLKNYPDPMEVVNKYGA
FT                   DCVRLFLVNSPVVRADNLRFREEGVREILTNVILKWINSLNFYLGQVELFEQTTGDKFV
FT                   YDHDAKKSTNVMDRWILATCQTLIQHVETEMAAYRLYTVIPKLLDLISDLTNWYIRFNR
FT                   SRLKGSGGVEDTRAALNTLYEALLTLCLTMSSFTPFTCETVYQALRPTSPAPEDPAQDV
FT                   RSVHFLPFPKIRAEYFDPIIERQVQRMRAVIDLGRLIRDRKTLKVKMPLKELIIFHHDQ
FT                   EYLDDVRSLESYIAAELNVVNIVYTSEESAVGIKYRATADWPSLGKKLRKDIGKVRSHL
FT                   PKMSTDECKAFVAEGKIVVNGVELVAGDLVVTRFAEVPTGEVKYDTASDNDVIILLDIR
FT                   RHPELENMSLLRSLTSRVNKLRKEAGLKPSDKVDIFYEYDAGEEDAIRPAISGNEEYLN
FT                   KQIGGVPVELSQKGEDKEVLKREVRMKEAEGLGQGERFVLSLALRA"
FT   gene            complement(598436..601176)
FT                   /locus_tag="CNA02300"
FT   mRNA            complement(join(598436..598858,598935..599004,
FT                   599084..600475,600524..600747,600809..601176))
FT                   /locus_tag="CNA02300"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(598746..598858,598935..599004,
FT                   599084..600475,600524..600747,600809..601139))
FT                   /codon_start=1
FT                   /locus_tag="CNA02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40804"
FT                   /db_xref="GOA:Q5KPM1"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR023167"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM1"
FT                   /protein_id="AAW40804.2"
FT                   /translation="MHSALTPNTAAFLEYISPGDAPTSAPPAALFNNMPVPGRDTPEDT
FT                   PPSASTHDSQLNEHPAPSDDSDSLTPEIALGPADDPANKDTLAGNGANKRKAGRPSAVV
FT                   DDDDEDASDSDLPSGHEDKKQHGAGRAAAGSASGSGRKGGRKSGGGEGDGKRELNKSER
FT                   RKEQNRAAQKAFRERREAKVKDLEDKVAELENKAYGTQIENENLRGILKRLQEENVALK
FT                   QSAFTFSMPVNSRSSTNSNNGNFSVPAPQNPKPLTPPQSNNDDSLKSVNDVPMLAHRHS
FT                   STNTVSDNSSESLVSLRSSDRTPPALFSDHFNTYALGAIPVPPPSSSSQPVQKYPSASN
FT                   GQQSMSSNSNSSGVISPPSADQSEFNALWESLYPNDVGNLLSQNTNQNQGGPFTLLNSQ
FT                   PDSMSFASAGNSMNDLFNFGAPSASISTSARPSVNPAPASVTQSANHITQNLGATGQAS
FT                   DWNRFAFREPTAEASAPNWDVTDNSVNEFLASLSGDTTTDTTANDYLNNDDEAFNAQLR
FT                   KIFGTDNSPSAAFNLPSTSFSPNNYLNMSPSPVMPLSNSQSPQSSDSRSNTNISSGRGN
FT                   DISMIDSPEYSMGSSRTSVSHESTDLQQGKISAIRSLKEYACKADNEVIHVVDEKGRVI
FT                   KPSELWMRFGMQHENPTEHLLIDDLCDQMRAKATCKDGKLQLDITDAAVLFQRGEGQPH
FT                   SYAEKMVKKAANHSS"
FT   gene            601416..604854
FT                   /locus_tag="CNA02310"
FT   mRNA            join(601416..601612,601660..602298,602351..603007,
FT                   603066..604854)
FT                   /locus_tag="CNA02310"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(601424..601612,601660..602298,602351..603007,
FT                   603066..604682)
FT                   /codon_start=1
FT                   /locus_tag="CNA02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41330"
FT                   /db_xref="GOA:Q5KPM0"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPM0"
FT                   /protein_id="AAW41330.1"
FT                   /translation="MNNQNQQPPVNLSDPHLQARLALLAAQQQGLADRQPVSQDHIAAM
FT                   AAAMGSMQGQNRDAIMKQLQALQNSQAHRAKLAAQQTANQQPQPGPSAPSPANQPGLSA
FT                   PSPITAPSPSNPLHQDSFQHPGMPRSGSGDNLLNQQQQQQQQQQQQQQQQQQQQQQPFM
FT                   SQQQRELFLAQQRAHQQQSMAGPSDGSVRPPSQAQPNLPGQPQGQSPRQPLSHVQQRQN
FT                   FLKTFMGYFQNIGQQPPPAIFDNGEREGAFKVGDGWMDVIDLLMAVMKAGGIMNAMQQP
FT                   ADSPTWRNLLAVKNIPTTLPYPIPAPKPPNSDPNAPPTMTTDPVQYLTAAYFAYIHGFE
FT                   THMQKTRQASYARQQAMAIAQGRPPPPPPVMPSLAGFRLPGQAPSPAESWSSAQAQTPA
FT                   PAVPSLPPPLNTSAQPPPASTAPTPTHPAPSPSDSSTKSSTTSGPPRARKASSKKEKKD
FT                   LSVNTNVPSPIDGEAETPTGSSGGKKRKRKNANAPQPETASTPAPPPIVSTPAPEPPAE
FT                   PTKRARYRVEYRPINFPVQTFAGWEPSMVSSTFPKHSLRQGTRPIHDLAVVDMEAILMG
FT                   LRSRMPKELGYAVTVLNMLSMSHPEENINGLPLHHLREIFIELLDLTEEAAFGDGGRSG
FT                   WLKSWHDLNDVKEESAADDKNSCMDNLNKMPFFELERLGRDFDFSVYKDEEEYQWRKEE
FT                   TSGSTGIVLACINMLRNFSMLPDNQELMASYPQMINLLASISDARLCRLPGENCTKIKR
FT                   PFSIIELARIRRDCVSILVNIGEYVELPRVPSSSSLAIFRLLSTFIASGWESNALSEPV
FT                   YGPTLSSSIRDVGPPTVVPSIDRALAAFSLLAQPDANREALGSSVPPSELIDMYESLLK
FT                   LLPVTKRQFEAMHSIEETLGYNETLALCLYSLAFLSPLHVRASMRNVPGSVPLLTRIIF
FT                   DTALQKSDYRSNPFGILCRRLCETLGVLNGTVSPAGTVEGPSGMGFGAGGIEGSGWKFA
FT                   SGRVENGWLAGKEEGVLGAILGVKGMSWAALGELDGMVWGGDSI"
FT   gene            complement(605010..605104)
FT                   /locus_tag="CNA02320"
FT   tRNA            complement(605010..605104)
FT                   /locus_tag="CNA02320"
FT                   /product="tRNA-Ser"
FT   gene            605389..608194
FT                   /locus_tag="CNA02330"
FT   mRNA            join(605389..606188,606246..606386,606441..606614,
FT                   606673..606837,606901..608194)
FT                   /locus_tag="CNA02330"
FT                   /product="mRNA-nucleus export-related protein, putative"
FT   CDS_pept        join(605712..606188,606246..606386,606441..606614,
FT                   606673..606837,606901..607899)
FT                   /codon_start=1
FT                   /locus_tag="CNA02330"
FT                   /product="mRNA-nucleus export-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41416"
FT                   /db_xref="GOA:Q5KPL9"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL9"
FT                   /protein_id="AAW41416.1"
FT                   /translation="MAHYVPTSFKPMRSLVAAAGIQLSPSPSSDHNEGTFETEDGELLL
FT                   GNIIIDEFPADGDRPPVKGEHFQPPGLFNTSMMPTIVTTDGKLHVELKTKDDKAAISEK
FT                   GQGEGLMLPQHVLLETSSAVQAAEDGGDDGEEGDHSLGGDDFWEGLHFVDDDIIRGSRR
FT                   YFNPEPEDNLEVEATFLATADSRKVCQNCKRPGHQASKCPHIICTTCGAMDEHERRDCP
FT                   LSKVCYGCGRRGHHKSECPDPISRNKRWAGCERCGSREHTDKNCPTLWRIYTYRSDSGR
FT                   RETIKLKEKAEGWVKEAIGGDAMEDWCYNCARTGHFGDDCPQRRGSLVRLTAPSAFSRE
FT                   IARRGPFFSAPKSFLPNPTHSRWEDDDPSAIPYTSAYDSFAGSNAGRRGREKEKQQMMA
FT                   RDTDFNDEDDWFSGDRNRNIGKGAGTPRNNPRGGRGGKRPWDSEMRGKEWDRDRYDRER
FT                   ASREFFDRDREPPRSRGQAPPRRRSRSPNRRDGSRDNAVQETAPNSAPPKAVYRPAINI
FT                   RDRAIDSPSVREGERGAKAGSKALVSRALSGQNSSNSTPRGQRSSNSPSALPSLLSRIE
FT                   SPTPSNSTSRSRKGRGKEQERDWENEWRRRGNGGGKVANWGKDLDKETEGLSLKKKTKD
FT                   DISRGSSGQKYYGGYM"
FT   gene            complement(608241..610902)
FT                   /locus_tag="CNA02335"
FT   mRNA            complement(join(608241..608661,608715..608802,
FT                   608973..609038,609293..609561,609659..610902))
FT                   /locus_tag="CNA02335"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(608420..608661,608715..608802,
FT                   608973..609038,609293..609457))
FT                   /codon_start=1
FT                   /locus_tag="CNA02335"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW5"
FT                   /protein_id="ALO60304.1"
FT                   /translation="MSYGNPAQEEPVSSSSQLPVPATGQQIATQKPSKASRMLRGPIGR
FT                   DQILEWQASLCCLTPLGTCFRPQSSGTIYCSIHTCQAINVDRERCGNAVHNPRQSRFCS
FT                   NGWHVENSKYDNIVEMVTKRKQLDEANAARRKQEMTEQMALFKSQFSPLSSTDKTSSSS
FT                   NQSSQLFMSNPQTRKQNGFQMRW"
FT   gene            complement(610961..611814)
FT                   /locus_tag="CNA02340"
FT   mRNA            complement(join(610961..611132,611186..611814))
FT                   /locus_tag="CNA02340"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(611005..611132,611186..611663))
FT                   /codon_start=1
FT                   /locus_tag="CNA02340"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40806"
FT                   /db_xref="InterPro:IPR035213"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL8"
FT                   /protein_id="AAW40806.1"
FT                   /translation="MLRSQLRLPRVPLQSVYAVPSRPSRRFSHAFPTDVPPLRQRIRPL
FT                   VPFFIYWTIITSLVVHLMRTRQDTEASLARQQAKITVLSDLIAKLQRGETVDEGEMQRE
FT                   LEMVGLRERTSATLALDKEMRIVGDVGWRDMLFGKRERTAEDEAKEERVIEEWASVINE
FT                   TANAPPPPSSANSSPRQVEQPQNRAGVAKRAPGSNVYL"
FT   gene            612000..617216
FT                   /locus_tag="CNA02350"
FT   mRNA            join(612000..612411,612498..612593,612655..612734,
FT                   612786..612793,612849..612988,613185..613805,
FT                   613872..614019,614075..614281,614395..614604,
FT                   614675..615101,615155..615225,615270..615411,
FT                   615465..616101,616152..616240,616304..616829,
FT                   616889..617216)
FT                   /locus_tag="CNA02350"
FT                   /product="Ras guanyl-nucleotide exchange factor, putative"
FT   CDS_pept        join(613194..613805,613872..614019,614075..614281,
FT                   614395..614604,614675..615101,615155..615225,
FT                   615270..615411,615465..616101,616152..616240,
FT                   616304..616829,616889..616978)
FT                   /codon_start=1
FT                   /locus_tag="CNA02350"
FT                   /product="Ras guanyl-nucleotide exchange factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40808"
FT                   /db_xref="GOA:Q5KPL7"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL7"
FT                   /protein_id="AAW40808.2"
FT                   /translation="MHRPNAKQLTLGCLLPPTPSELVSPVTPSPMSPASFHTATAGTPD
FT                   TLARVTSEEDDRSRYGAKGPDVPPVALPGYQHSLSYLDSLQELNPDPAQAALLQSARLK
FT                   LSSKDKEAMRKIRFTMMEQNFSDSASSNSVSPSSPRFPQYSAAGPSKGQELRTRRSILS
FT                   KFVVTEPRGDSGEDEDVERLETMKRWQSQPALSRERHCMTNFLSTPACSVDYAIAVVGH
FT                   EGVGKTTIIAEALRGWGMSNPLSIYSPDGHLIFSCCSQIAAGGKLKTGCKVEFFEMGIN
FT                   ALDLTPGAASIWPSSALKVSGAVCCYDARREETLEGLKNCIEQLSATSTPIVIIACKSD
FT                   PDAELRVIAAHGNSMGEPCNVGLIEVTIKTHEGKLKMRNAVRWLLYKLEQRQRRQQRQL
FT                   SALNIAQSLVSGVQAPTAVGSIDVTKSTIGSLASLDSDADCLGDRSMWEQTLSTASKTS
FT                   EAPLIGQTPGVEEEIREDQKSTSYGVGKLVTPDKERIMNDGSLGCLDNLEESTRREKKQ
FT                   TGRVQAKHDTIADQIAEGISPVYVALKDLLNRLFTSIVSSQDDAFTRSFFLTYRRFCHP
FT                   QDLMLEFLKRFREIEDYAVSSDVKNWALLKLTGALVDWTNRYPGDCVSMSTPIIFSEII
FT                   ILLSKHTFMAHLISDLILVQDALPKTTDPDESWSMRSHDVTSHNVEKSIQVLIDKEGGS
FT                   KLDDNEEEDEVGSLGHKAASELSASTGSLQLEEVQRQGSGSDSHRVRIPSGVSVLGEEG
FT                   SLSSEGQHSHTRPAGSSYRMNSMQVSDEVADARWGNALNMVMRMEPRVFATELTRMQWE
FT                   LFLDIRPRDVFRHTLGKETGGPVRKSINFFNHLSRWISTIVLASSKAKHRARVIERFIF
FT                   IAHQLRRLNNYDSLYAVISGLREASVHRLSASQALIQLSPIAEQDYHSHLKLMDPRSGY
FT                   TQYRKALQADIDNGRGAIPLLNNILGLVSRLQGVRPNDCREEDGKIQWDKFMRFGEILS
FT                   MIQECQTRGPMVNGQVGQGFKKVIEETIILSDEDALWERSQSLENSGGTIGGKMLRRLA
FT                   NLGF"
FT   gene            complement(617203..619443)
FT                   /locus_tag="CNA02360"
FT   mRNA            complement(join(617203..619090,619141..619443))
FT                   /locus_tag="CNA02360"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(617282..619090,619141..619401))
FT                   /codon_start=1
FT                   /locus_tag="CNA02360"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40809"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL6"
FT                   /protein_id="AAW40809.1"
FT                   /translation="MSLSSQTTLISPSAKHTNPPLHRRPSQHARRKSLHAAHPHAHAHA
FT                   HTHAHGHAHGRRGSEGEAGRRALAAGLAMHTLDQSKKKKQGERPLPRGNRSDTHLPRLT
FT                   RTDSTMSIASHSSATSNVSRPSAKSRRTTESIQMIDDQGKEVDPNEDEWESGEDVKQTK
FT                   KGKGKQQEPSSAAMRRTVSDTTSDPKGKRTQSIAEAMARGDLVDIQDPDHRPLLTQRTT
FT                   GFAGTVQPPDPQVAAEMPHVDHPIITNPIKRVASSKSLVGPISAITSIDTTPDVGLPTE
FT                   PPRGLQSATSEPKRPSSGPSLRSISGSGLPRDPTDQRDEAQARDKLTDSPSYPFPKMAS
FT                   PTESEQKASPKDDHPEKKIPTASRSQATSSKAARSLRHRPSNSSLRSIQSLRAPPHPLN
FT                   SPISYTGRNAAHESPSRGSYDKRDRVPSMHQPPVPQPQVSYEVAQGQGWDQIPEEDVQR
FT                   ENAPVSNQSNVDAGTTHSQNLRRSSVASTRSLRSIFAGTLAPPSAASSTPQPHKRLTAL
FT                   EAASAASKRPTTDNPVLYHHSLSHASGSAESCFLISRFLPPKKIRRPKWEVDIHDQERI
FT                   ENGGVGLTNGDYRSAHETLVSTFRELGTGAMHQKRGLPRTASGYSLLPTGLTLSSVAAA
FT                   TGVSNGHQDNQGLGTIKARDGARLEVARGGSGGMTPFEMSVERVLKQRPGRVTL"
FT   gene            619689..623370
FT                   /locus_tag="CNA02370"
FT   mRNA            join(619689..619915,619965..620123,620176..620391,
FT                   620448..620575,620628..620725,620787..620797,
FT                   620846..620962,621013..621165,621222..621327,
FT                   621396..621725,621778..621904,621961..622321,
FT                   622376..622545,622610..622828,622892..623370)
FT                   /locus_tag="CNA02370"
FT                   /product="saccharopine dehydrogenase (NADP+,
FT                   L-glutamate-forming), putative"
FT   CDS_pept        join(619700..619915,619965..620123,620176..620391,
FT                   620448..620575,620628..620725,620787..620797,
FT                   620846..620962,621013..621165,621222..621327,
FT                   621396..621725,621778..621904,621961..622321,
FT                   622376..622545,622610..622828,622892..623285)
FT                   /codon_start=1
FT                   /locus_tag="CNA02370"
FT                   /product="saccharopine dehydrogenase (NADP+,
FT                   L-glutamate-forming), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40810"
FT                   /db_xref="GOA:Q5KPL5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL5"
FT                   /protein_id="AAW40810.1"
FT                   /translation="MRTLPLTRSPFITRRCLTTLGLRREDPSRIWERRTPLTPHAVQSL
FT                   LADAKDQLKVEVESCKRRCFPDSLYSDAGAKIVPSLSKDVDVILGIKEPRLSDIRNLVE
FT                   ASKNEGKKRTWMMFSHTHKGQEYNIPLLSAFLHPTQTLIDHELLTAPAPGKDGKPQLKR
FT                   VAAFGWFAGAVGAGEALSLTGLALLRRGLATPLLSLSRPYSLGSLAAFKEALKKAGEEV
FT                   KTSADLKGQEPIVIGVTGAGNVSSGATEMLNELGVVWVGPEDLADLRQSGSPNKIYACA
FT                   ITPASYLQRIEGGIFDKQEYYKSPDKYMSIFAAKIAPHLTTLINGVGWSKGFPRAITRP
FT                   SLNKLIEKENGKQKLVAVQDITCDKEGGLEFVDQFTTVDNPYFEGPGDILISAIDILPT
FT                   ELAADASSYFSSALYPYIQGLLFPSGQGDKNDITETLSRAAIVKDGVLQSQHEWLGEKI
FT                   EQWKTGGAVAPDSLKQEKLRKGGKKKVLLLGSGLVAGPAVDVFAARPDVHLIIASNNLA
FT                   EGQSHIRGRPNVEAMALDVADDASMSEIVEEADIVVSLLPAPMHLRVAKHCLDHSRHLV
FT                   TASYVSPELQALHSQAIEKDVIFLGECGLDPGIDSMAAMRILERAKREGKQVKSFVSWC
FT                   GGLPELSASKVPLRYKFSWSPKAVLTAAQNDASYKLEGKHVKIPGNELLARRFPEVKLW
FT                   DGLPLEGLANRDSMPYAKKYGLGPAEGLTDLFRGTLRYQGFSSLLESFRLLGLLRSDPL
FT                   PGSPKSWTEFLSMTVERELGLSKGLKGEDVSSAVQDLVGEGSKDVIRALKLFSLFPGSD
FT                   TSLLPLPNLPTPSPIDFFAHLLSRKLAYLPDERDTCLLHHSFTISTPSGDTQKVTASLR
FT                   HMATPTQSSMSITVGKTLAFAALRIADGEVKVRGVTGPYEPEVWAGVLSSLEGAGVVIE
FT                   EKWH"
FT   gene            complement(623351..625280)
FT                   /locus_tag="CNA02380"
FT   mRNA            complement(join(623351..623794,623847..624278,
FT                   624331..625037,625091..625280))
FT                   /locus_tag="CNA02380"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(623439..623794,623847..624278,
FT                   624331..625037,625091..625233))
FT                   /codon_start=1
FT                   /locus_tag="CNA02380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40811"
FT                   /db_xref="GOA:Q5KPL4"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037855"
FT                   /db_xref="InterPro:IPR040608"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL4"
FT                   /protein_id="AAW40811.2"
FT                   /translation="MTLPSPLSATYWSTWSPVRPSATVIESVQRDQGEEWIGSWDAVGL
FT                   YEANDKQPGYQTISLHITTHRLILIPSDSHSPHVPSLQTHLSYVRNTEYYSGFMRSSPK
FT                   LTLTLGNPQSRDNDPAVESAGTWTCRVCGYVNERKGLGKSGKCGLCGVPYAQAVASPSV
FT                   SATPSRAGTPNSSGFTPPSSTADDKEGESKVACPACTFLNSALLRNCEICATPLPRLPQ
FT                   LNTIREKPEKQQVVRLSFRKGGDKEAYKKLSSVLGDKAWEREGRSSAQTTSSNGERSGA
FT                   GIDGILQSIDLSAKAQDTHMQTAFADLEALMLRAGEMVRLAQSLNQKLSSQQQAGASSP
FT                   TGSPQGQTTEEEATMIRTSLVQLGLATPALTKEMVKNERAYHEGLAKELGGLLTGRDGE
FT                   SGLMVGEGGRGVVALDEVWGLWMRARGVALLSPQALIDTLPYLPNYTSPSIHSLRLPSS
FT                   LMVLHTPTFSTLSILSRTLSRLEPSFPNSDPFEKSFSLLEFASTESLPIGLAQEFVGLM
FT                   ESQAGLVRDDQAGQGDGGVRWYRDIISP"
FT   gene            625390..627901
FT                   /locus_tag="CNA02390"
FT   mRNA            join(625390..626778,626830..626971,627019..627169,
FT                   627221..627308,627359..627901)
FT                   /locus_tag="CNA02390"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(626182..626778,626830..626971,627019..627169,
FT                   627221..627308,627359..627715)
FT                   /codon_start=1
FT                   /locus_tag="CNA02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL3"
FT                   /protein_id="AAW40812.2"
FT                   /translation="MSETGGNAPVAHQSTFDSRLAYVQSNVPFPSRQTSYPAYNNSSLP
FT                   AHPASSSSRLNARPDHLHQPSASSAPLLHSEAMTHPGCVLCGLVRSCGSGSNPSSPVLS
FT                   PQDSTTPLPSSSRTPSLATSFADSGVPGPYHHPFERTQSPAPDGRRTGNRVGGREIVYH
FT                   DKDITVYKAEGKERLCQGGRHIIIVVNEHLQSVYEFGASDIPLLSHILDTAAQILNSVA
FT                   AAGDDLESGKGKEKLHVGFVGSIIKDPQSPHAHLHAHAYLTPIDTKLSGASLWRRNVVF
FT                   GSLNWWSIEDLRAEIREATSNNRVKTGYEYRQAPIDKVPDAGAAIAPAYALNPTYSDVP
FT                   SPVSQSKQHALQQQQPQPSSYRPQPGPSSVSKDRLSPLPTHPLEEVGSIESVVSMSTVT
FT                   PQTSNSGRTSREDKGKGKEQEQAISDWEEVQYGSEGSERLSDRII"
FT   gene            628190..630409
FT                   /locus_tag="CNA02400"
FT   mRNA            join(628190..628399,628502..629249,629308..629508,
FT                   629559..629749,629801..629970,630026..630079,
FT                   630133..630409)
FT                   /locus_tag="CNA02400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(628583..629249,629308..629508,629559..629749,
FT                   629801..629970,630026..630079,630133..630178)
FT                   /codon_start=1
FT                   /locus_tag="CNA02400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41433"
FT                   /db_xref="GOA:Q5KPL2"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL2"
FT                   /protein_id="AAW41433.1"
FT                   /translation="MLATNLISLVLVLPTLALAGHNSPFNGHSPSRRHHHARAASFALT
FT                   HASPTSNELLKRTYHDAIEHKMARKRAGKKFAKRGADGSQCRVKGQSYVPTGVSSTSAI
FT                   SSTAASSIASSPSPASTDAIASTSASAVAPDSSASASTSTSDESAPTSSAWIDNQQNWV
FT                   DATSSSEQAAATSASSSSPSSSSGTSVVSYAGLTPNGNKAGVSAGDSLPWVASKLGWWY
FT                   DWSATPSGDCGSAVTVPMLWGGGIADATDASRLVAFEALSQSPSYIIGFEEPDCAAGSG
FT                   SSGLDVATGIALWDSLIAPKGEAGTILVGPSMCKQAAESGWLGPFMEGVSRKPDIMNIH
FT                   VNKNSAAGIQLDIDHYWNTYGLPIWVTEFACVDDSTDFVPCTDQDEINSFINTAVDIFE
FT                   TDSRIAGYAYSNGYGLSENWMMVKDGQLSESGQTYLAAISKYH"
FT   gene            630663..632003
FT                   /locus_tag="CNA02405"
FT   mRNA            join(630663..630764,630843..630962,631027..631083,
FT                   631265..631313,631383..631504,631558..632003)
FT                   /locus_tag="CNA02405"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(630714..630764,630843..630962,631027..631083,
FT                   631265..631313,631383..631504,631558..631908)
FT                   /codon_start=1
FT                   /locus_tag="CNA02405"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV9"
FT                   /protein_id="ALO60305.1"
FT                   /translation="MTERQTFDSLEELSTCEISDALIKLGVQTGGYIPDLHLYSPSDGH
FT                   KLKVVGPAFTVQMVAENVQRENEPPKSKEHFVDACPSGSVLVISAPFIRNAGCWGGLMS
FT                   TAAKAKGIKGVIIKGGCRDLAEHRELGFPVYANYHTTLGQKSFVRPSLLSVPVDMSPQY
FT                   YSSPAIVSLYPPSFEYKITVKPGDIIVCDEDGCVAVPPALVEKVVEKGKEGRDVDENVR
FT                   KDLEKGKGVKESMAKWRGEDKRGGGKL"
FT   gene            complement(631337..632665)
FT                   /locus_tag="CNA02410"
FT   mRNA            complement(join(631337..632081,632151..632273,
FT                   632338..632383,632449..632665))
FT                   /locus_tag="CNA02410"
FT                   /product="transcriptional elongation regulator, putative"
FT   CDS_pept        complement(join(632051..632081,632151..632273,
FT                   632338..632383,632449..632590))
FT                   /codon_start=1
FT                   /locus_tag="CNA02410"
FT                   /product="transcriptional elongation regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40813"
FT                   /db_xref="GOA:Q5KPL1"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR039948"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL1"
FT                   /protein_id="AAW40813.1"
FT                   /translation="MSAGKKAQTQPPEDDYVLLESADGYTFVVSRKIACASGMLKSMLD
FT                   EDAAFEESKNKTCRIQQRGVILAKVIEYLAYKVQWSECLAEEVNEDFSDRIDPYIALEL
FT                   LTAADFLDC"
FT   gene            632813..635935
FT                   /locus_tag="CNA02420"
FT   mRNA            join(632813..632903,632945..633112,633169..633288,
FT                   633335..633478,633531..633825,633870..633991,
FT                   634043..634327,634370..634471,634531..634640,
FT                   634697..634838,634893..635047,635104..635407,
FT                   635455..635595,635653..635935)
FT                   /locus_tag="CNA02420"
FT                   /product="rsec15, putative"
FT   CDS_pept        join(632844..632903,632945..633112,633169..633288,
FT                   633335..633478,633531..633825,633870..633991,
FT                   634043..634327,634370..634471,634531..634640,
FT                   634697..634838,634893..635047,635104..635407,
FT                   635455..635595,635653..635865)
FT                   /codon_start=1
FT                   /locus_tag="CNA02420"
FT                   /product="rsec15, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40814"
FT                   /db_xref="GOA:Q5KPL0"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="InterPro:IPR042045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPL0"
FT                   /protein_id="AAW40814.1"
FT                   /translation="MIRRQRPTFTTSELELQLQQINLDPTSSTTENLEALAPLIKSIQD
FT                   TDSEQLYLRSLDNFVEEKEREIEEICQENYEDFVSSVSTLLTIRQGTVHLRRRIGELDG
FT                   QMGDVGRALGEKKRALLEQKKVARNMDDAIETLQTCLRLLDLVHRIDEMVREGKYWGAL
FT                   RSLEDLLHLPPPSISQTPFYAHILSSLPSLRLSIKDAVTASTKTWLFDVRESSAKVGKL
FT                   ALEQMALRTRKWRMKREREGGVRLARVGGPLELVHNERVEFDALDNDEIKVDFKPLYHC
FT                   IHIYEALGQKPELQRSYQEDRKTQATLILTSRLSTTPSTLVNTLPLLMQELVGFFIIEA
FT                   HVLDTMPDFRTQRDVDELWDEMCRRIVEVMGQGLKGCSEPGVFLSSKTEVLLFVQTLEV
FT                   YGYNITELNGLLITLFERYSELLLRKFGADFDQIVSDDDNQPMMVNDHEEFDQVAGVCW
FT                   LAKGEAESLAMQGFPQPMPFSQTYPMCCINIRNFVDQFYQFTDGVAQQHLDVDEVLRRS
FT                   LDGLLSDHVSKQIAKKLQTMLNLSQIAQVVINLEHFCTACNELESVLMNLRASQRGGPI
FT                   KLASGASFNSTLSAAQSRIDSIINSKLESFFELAEYNWMPVRPQSTVEEPSTYVFEMIT
FT                   FLTAYVDSVLIGLKEEFKTGAYRNALMRINRWLMDTLTGQEVVRLNESALASVLADVSF
FT                   IETEIKRLGKSELDHVFDEVKHTINIILSDAVQAYMEPSIRSMSYPSVKPLSLAMILAK
FT                   LSKAASSQGGQANMFKAARRRGEADEVARLAGK"
FT   gene            636040..637620
FT                   /locus_tag="CNA02430"
FT   mRNA            join(636040..636196,636266..636340,636426..636699,
FT                   636760..636865,636940..637007,637059..637620)
FT                   /locus_tag="CNA02430"
FT                   /product="expressed protein"
FT   CDS_pept        join(636106..636196,636266..636340,636426..636699,
FT                   636760..636865,636940..637007,637059..637572)
FT                   /codon_start=1
FT                   /locus_tag="CNA02430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41331"
FT                   /db_xref="GOA:Q5KPK9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK9"
FT                   /protein_id="AAW41331.1"
FT                   /translation="MITRRLASTVSVPPETKSPRKIVLVGAGFLGSYVVKALIADPRNR
FT                   IQIVSRHPQSLHSKLSTLGAQILPPASVDITSPSSTSELRKAFKGASAVVSLAGLLVGS
FT                   DKQMKALQEDGARRVGEAASEEGVGRVVGVSAIGADLRGVTAYWRTKAKGEDAIREYHP
FT                   TATIIRPSLLFGPGDSFFSRFATLAKYLPFLPVFGGGITRFQPVYVGDVARAVEICCRD
FT                   DPIVVSQVAGRIIEAGGPDIFTYREMMELVLRYTHLEGRRAIISLPYWLGSVQGFFLEK
FT                   LPETMFTVTRDQVKQLRNDNIVSPHPPMFAQNFEDLLKAFPSSAPSSAPPGDAGLQSVY
FT                   DILPTYLGVGKREEGKRTHGRKSASLDEVKGMGKR"
FT   gene            complement(637623..638191)
FT                   /locus_tag="CNA02440"
FT   mRNA            complement(join(637623..637848,637894..637992,
FT                   638028..638191))
FT                   /locus_tag="CNA02440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(637770..637848,637894..637992,
FT                   638028..638185))
FT                   /codon_start=1
FT                   /locus_tag="CNA02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40824"
FT                   /db_xref="GOA:Q5KPK8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK8"
FT                   /protein_id="AAW40824.1"
FT                   /translation="MTPPPVLDKAPAKSAQLFPYHLPLSPEWAEYSDWYSQTAMTSAAA
FT                   GMFIKQPIIVWGAFALAVFGYVNQQPLRQPKDATAPLLVLGMALAGVVGSILPKTMLAP
FT                   QTQSVPA"
FT   gene            638285..639598
FT                   /locus_tag="CNA02450"
FT   mRNA            join(638285..638348,638409..638638,638691..639598)
FT                   /locus_tag="CNA02450"
FT                   /product="aspartate-semialdehyde dehydrogenase, putative"
FT   CDS_pept        join(638287..638348,638409..638638,638691..639496)
FT                   /codon_start=1
FT                   /locus_tag="CNA02450"
FT                   /product="aspartate-semialdehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40826"
FT                   /db_xref="GOA:Q5KPK7"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="PDB:5CEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK7"
FT                   /protein_id="AAW40826.1"
FT                   /translation="MSPRPQIKVGVLGATGTVGQRFIELLAAHPYFALHALGASSRSAG
FT                   QQYARVVRWKLPSPIPDAVRHMVVHECRPDAPGFAECGVVFSGLDADVAGDIENAFRAA
FT                   DLVVYSNAKNYRRDPLCPLIVPLVNPSHLSIIPYQREQLGLKKGYIVTNANCSTTGIVV
FT                   PLAALEKAFGPLDTVIVTTLQAISGAGYPGVSSLDIMDNVVPLISGEEDKIEWETNKIL
FT                   GGVTPDNKAFDLHAPKQINVSATCTRVPVIDGHTGCVSVKFARSPPPSVAEVENAFREY
FT                   TCDAQHLGVPSAPAQAIVVHDAPDRPQPRLDKNLHNGACVSVGRIRECPVFDIKFVCLI
FT                   DNVRLGAATSSIINAEIAVEKGLIQ"
FT   gene            complement(639535..646012)
FT                   /locus_tag="CNA02460"
FT   mRNA            complement(join(639535..639668,639719..639951,
FT                   640005..640077,640139..641188,641248..641359,
FT                   641424..641848,641899..642070,642126..643231,
FT                   643285..643342,643395..643522,643570..644740,
FT                   644799..645078,645140..645397,645588..646012))
FT                   /locus_tag="CNA02460"
FT                   /product="kinesin family member 21A, putative"
FT   CDS_pept        complement(join(639660..639668,639719..639951,
FT                   640005..640077,640139..641188,641248..641359,
FT                   641424..641848,641899..642070,642126..643231,
FT                   643285..643342,643395..643522,643570..644740,
FT                   644799..645078,645140..645332))
FT                   /codon_start=1
FT                   /locus_tag="CNA02460"
FT                   /product="kinesin family member 21A, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40828"
FT                   /db_xref="GOA:Q5KPK6"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK6"
FT                   /protein_id="AAW40828.2"
FT                   /translation="MSLSRRQSIAPPSPLSPSSITRPNSSAGQSTFGHTRASLSSDASS
FT                   IAAGAKETPNTLENRNVKVVLRIRPSDPDDPSIPPRFRSVLVHPTSKSDIRVDVDPAAL
FT                   TGHGPSISTGGKKYSSFSFDYVLGESAQQTDLYQCTAGESVDEFMKGHNVTFLAYGQTS
FT                   SGKSYSMGTTGDNIDYSGTEFTPRTGLIPRTVQSIFERAEDNKQKSGPGASWEARLSFL
FT                   ELYNEEIIDLLSGAGISISIREERDGRIVWSGVREVKVKSLSEVMKLLQEGSTRRKTGE
FT                   TTMNATSSRSHAIFSITLVQKRPSNALSALSALGSETPTRQLRRPSSMIGFPASGPRSP
FT                   TLPHSRSGPPSSFSRMTPSRPQSAINPSASTEEFVVITSKFNMVDLAGSERLKRTAAQG
FT                   DRMKEGISINSGLLALGNVISTLSDPVKSRGHIPYRDSKLTRMLQDSIGGNALTTMIAC
FT                   ISPIEANIGETLNTIKYASRARNIRNSAKVNQVEAGWDDVEYLQNAVLKLRKQVIALEA
FT                   EGKESRVSEDGLKRSEKLTRRLAELQKEHTELYDRYLAKCSENMRLSSELKSRGPGDGD
FT                   ALTKFNETVEPVILEYEKVVSALNQQLEELRGEIALMNEMSEERSRLLQDAQERQLQSE
FT                   TYLAELRMRMVKLADRNASSEAYIQDLEAKLKTYADKEDTHILVATELKKEIAKLRESG
FT                   TTSAKNVSELEARLTTSEALRENLATQVEKYERDAAIHEKAFRELEAHIAHLEAADHNK
FT                   RLLEELAQKNSKITELEDQLKAKGQSHFEQKEKELSETVEDEQSTQKGLDSKFALSEIP
FT                   SGSNTGPVAPPCERADASALAVGIDGPKTILDKEMPPSQADRESSQLEQLKKELKELSA
FT                   KYSESETRIADLTAKISEASLVQGVTDDMVKVSQTTTEELSQTHNQDEDGVGRKGMAVS
FT                   RAESNSSLDSDEEQTSMRRASLPLLSRSNISVKQGFRGGRGYLVSKGNRPQSLSQELFS
FT                   AQSLATSPCAMWSQPVTKSLLSSPTVQVRPSSRSSQSLETELRFVHRVIDERDKELRDR
FT                   EAYILQLEKQLEIAVAHDILSRKTSAKINVEADMPQTPVTSGIQVYPRDVPLPPSPQAH
FT                   FIPVMSVDMVHISEEDGESSETSKGRDYESSSVGVSPRSVERFKEVADSTNQCKNGDAK
FT                   VAQQFRIEKLIKDMAEKEASQRRIIEQQFIQIADLQKTIKKLKEKLMEGDPYVVDIGSL
FT                   WEERDVLIVEKAKQSCPIPSSASFPHSKESFASDAFALDRLRDEHAAELEALMAGHSQT
FT                   TDMSQLEFTKRLETCQKEIEDNQITINTLRARIESVEREHRLSLTKWDQASKSKDIAHH
FT                   DELESLKTMHSEVVASLEAAHTQALETLQAEQDFVSREMESSLSENEEQRRQLKMKADE
FT                   ALFELSRVRDERAVERYNDARQISELSENNARLENIKVELENANAELMATCAELTRKKT
FT                   SELEQKSGRKAVVRPPQGPPPTVPLPPTPQGSFAVNGAVHADDVRGSIKLTVSSEQEQG
FT                   GAKRQSESSEMLNEAGAQAVYDAAVAERDGLESEMEREREKIKEIEAKLEDEKVKVNNL
FT                   ALDLRASQKMANNLRVHLDEARQETKRSTAACREHVAELEARREQMGKISQDQRSQRDS
FT                   LQAAQAQVASLKMQLERAVDNKVGKKGLRCF"
FT   gene            complement(646269..650594)
FT                   /locus_tag="CNA02470"
FT   mRNA            complement(join(646269..646808,646883..647663,
FT                   647732..647738,647803..648701,648758..649215,
FT                   649271..649457,649503..649577,649638..649844,
FT                   649899..650002,650054..650594))
FT                   /locus_tag="CNA02470"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(646566..646808,646883..647663,
FT                   647732..647738,647803..648701,648758..649215,
FT                   649271..649457,649503..649577,649638..649844,
FT                   649899..650002,650054..650455))
FT                   /codon_start=1
FT                   /locus_tag="CNA02470"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41332"
FT                   /db_xref="GOA:Q5KPK5"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK5"
FT                   /protein_id="AAW41332.2"
FT                   /translation="MTSKARSKSLSNLHSPSNLFPLGQAPLVYLPDESRLANKRLKEVK
FT                   PLFSLPKLQEHSSTQDRLLLGLSPEVQQRRSQDHSQVSVSSPFGILEDEPLIVRNESEV
FT                   HLKYNGDAVDQETLWEKVSPEHTMKLAGSSPLRTWDLDSGNNASVSKSSFLSERSPHDF
FT                   DSVILSLESSSLLNSPVTLPQAATFESKPLLELLLRATLGTVTTGELMWDKKLSAFVLG
FT                   ERSERVLGLERETLSGFKTNFLTIGTSVRRLELIIDSQSNLPLTSTHHALFHALGTYLT
FT                   YIKDRLACAATECHEQGPSRWNSWMLATRHVKQLAETLCGVVRWPTSSPDAHALPSRAS
FT                   ALLTHLHGQFLAILSTSPSQHHPSAIALAYLLSQASAPFLNLLQSWLGFPGTDDEDQSP
FT                   GSQPWTDLGISRKLVGDAWKYEFSAGRMPGFVPKEARRILYEAGKGLRTLKVATNGLHP
FT                   LCNIRQAIDIRWIWGDSEKSELRNHLRHIQRQVDHWHRHQLSRSSSNRLTQIPSQKEDE
FT                   TDYMESNERNTPRHEEYALYPRPESDIGDLWSLFNQPPGSQLSLSHPHHSHSEFPLWGP
FT                   TPLTYLHEFISRHSSPNHPLLPPSCPTLSIFISNQILDPLLAHATLISTSLVSLYLHDL
FT                   RFLDHLDVLRAFWLAGDVGFTERVSSALFGKDSAGAGEAVGLGKRARIRARLGLGEDDD
FT                   KQDRDSDWGIGLGIGLSERSRWPPGGAELAYALRTTLLNHEDNDRKKSTGSVWQDVGDR
FT                   VSFAVRELPEEENSGKRARWLNPQAIEALDFLYLSYSPPVAITDILPHQLMEKYQTIHN
FT                   LILRLSRVDLVLRTMYWDVIHQFELFNEPHKIGVDLRPSSGLPCYRLQERSTHSLFPKG
FT                   SIAQRRLQILRFRMTHFVNVFGRYVLDIAIGSNWDAMKRRLERLRKDCTGKAHNRQGTS
FT                   EEESDEAWVESTLHDEEIDEIAPGGIRRLQSIHSIVLYHNMVLDKICRACLLGPQSGQQ
FT                   VTFKILMVLFGLVLDLGKTVKEVERGVRGWEDGVEKVDEIEKEWHEKEATFLHALERLS
FT                   LRSTHPKTNTMERDGIDQDLQVLHSSAPETANGGHGNPEGLAGNDLRELWLRLTFKEGG
FT                   GIAVRGIRKNEDD"
FT   gene            650743..652049
FT                   /locus_tag="CNA02480"
FT   mRNA            join(650743..650932,650984..651200,651253..651349,
FT                   651394..651855,651915..652049)
FT                   /locus_tag="CNA02480"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(650897..650932,650984..651200,651253..651349,
FT                   651394..651855,651915..651966)
FT                   /codon_start=1
FT                   /locus_tag="CNA02480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40815"
FT                   /db_xref="GOA:Q5KPK4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR022238"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039769"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK4"
FT                   /protein_id="AAW40815.1"
FT                   /translation="MSRPEEISPPEIFYGDTEAAKYTANTRIKNIQSQMTERALQLLAL
FT                   PEDQSAYVLDIGCGSGLSGELLDEEGHVWVGVDIAPSMLEVALEREVEGDLFLQDIGQG
FT                   FGFRPGTFDGAISISVIQWLLNADSSSHSPPQRLNRFFTTLHACLRNPSRAVFQFYPSS
FT                   DDQVTMITTAAQRAGFGGGLVVDYPNSRKARKMYLCLMVGQQEIPKALDGDEMDVDEET
FT                   IGKRRDEIKNERRRRREARRKTKKGNKDVKAKEWILKKKDLYRTRGKEGVPRDSKYTAR
FT                   KRKTYF"
FT   gene            complement(652111..654177)
FT                   /locus_tag="CNA02490"
FT   mRNA            complement(join(652111..652851,652899..653021,
FT                   653087..653216,653274..653454,653507..653666,
FT                   653796..653986,654053..654177))
FT                   /locus_tag="CNA02490"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(652776..652851,652899..653021,
FT                   653087..653216,653274..653454,653507..653666,
FT                   653796..653986,654053..654055))
FT                   /codon_start=1
FT                   /locus_tag="CNA02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40816"
FT                   /db_xref="GOA:Q5KPK3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK3"
FT                   /protein_id="AAW40816.1"
FT                   /translation="MSQPESSVAPPRESYDERAASPLPRDYAEDKYSTRPPPARYDDEL
FT                   RDDSYSAKGGDTYRSDRPAFEAPRRPAQAPPPVNPNPVLGVFGLSIRTRERDLEDEFMR
FT                   YGDVEKVVIVYDQRTDRSRGFGFITMRTVDDAARCIEKLNGLSLHGRNIRVDYSATQKP
FT                   HSSTPGQYMGAKRPVRDDRYGRGRYDDRRGGYGDRRHDDRRDYYGSSSSRHDDRDGGYR
FT                   ESYGSRRTGDPYEGRSRRDDYSYDKYDKQDKYADYDYDRRSSRRSRYSASPARSTAAPA
FT                   PEVPRY"
FT   gene            657166..658714
FT                   /locus_tag="CNA02500"
FT   mRNA            join(657166..657632,657703..658226,658285..658714)
FT                   /locus_tag="CNA02500"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(657212..657632,657703..658226,658285..658677)
FT                   /codon_start=1
FT                   /locus_tag="CNA02500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40817"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDY8"
FT                   /protein_id="AAW40817.1"
FT                   /translation="MPRRSAKYKATARARELYRMATILNHKQLKASLSIPYHALRTSRY
FT                   LNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLRVNHTEFRKLLCLIKDHPVFVSHGP
FT                   RKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLERNNV
FT                   YWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRYGFNI
FT                   LGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMIS
FT                   QGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYGILKNRW
FT                   QSLRSLRVKIRNVRDEGVATCWIRACVVLHNLLIDTGDWYNRLDGDADEPDDYIDIERM
FT                   QERMERVLERHREEEEDEARDARDASNLTRKRVMERMQEIERRDLL"
FT   gene            complement(658614..660165)
FT                   /locus_tag="CNA02510"
FT   mRNA            complement(join(658614..659441,659502..659595,
FT                   659650..660165))
FT                   /locus_tag="CNA02510"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(658726..659441,659502..659595,
FT                   659650..660045))
FT                   /codon_start=1
FT                   /locus_tag="CNA02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK1"
FT                   /protein_id="AAW40818.1"
FT                   /translation="MISRRVTCFFLLEILHIPPLTYFYLRLRSSQQSPIMPPKRQNENE
FT                   NQASEATQKKQRNSNKQWATDTNSDGVSAEEHVAVWLSTIPENGRLPNFHNWKTGHEKK
FT                   DFWSRKCLQYLTDNGCDSRRQFQSVALKINQIVESFTKASQIGTGTGAGAMEIDDESLL
FT                   AQRKKVCPFYEILLPVLGDRASVTAHHASSTLHASLNRPDRDLAALDGLIERQRGEMAA
FT                   DDSEDELSGEDGGLFGDGAGEASETESEADAPIIAAIRRESRSSSQPARSSSVLGSVST
FT                   PIRAQTQSQRASIRSSKAKAVSADDKMDELVMRQEGNDDRRHQELLAVQERKISVQEKH
FT                   HADMMNIAQENVTIARENAATEKMKMLAESWNRKMEMLMRSGKSWEEAKVMVGPEPGAP
FT                   SL"
FT   gene            660919..662014
FT                   /locus_tag="CNA02520"
FT   mRNA            join(660919..661174,661269..661448,661498..661564,
FT                   661625..662014)
FT                   /locus_tag="CNA02520"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(661051..661174,661269..661448,661498..661564,
FT                   661625..661847)
FT                   /codon_start=1
FT                   /locus_tag="CNA02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40819"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPK0"
FT                   /protein_id="AAW40819.1"
FT                   /translation="MFARAFILLTAVAGVLADLTVSSPATLIECQPALLSWSGGTAPYY
FT                   LAIIPGGEASAASLKDFGEQSGTSLTWTVDIASGNSVSLKVTDSTGTINYSSPVTIQAG
FT                   SSSSCVSTSTAATGSTESTDSSSSASTADAAASSSSSDSTSASSAASAAASTTSASASA
FT                   STSASSDSGAKGFASVSLIATALFAVTAGAIALW"
FT   gene            complement(661950..663103)
FT                   /locus_tag="CNA02530"
FT   mRNA            complement(join(661950..662177,662239..662639,
FT                   662699..662934,663030..663103))
FT                   /locus_tag="CNA02530"
FT                   /product="Delta-12 fatty acid desaturase, putative"
FT   CDS_pept        complement(join(662168..662177,662239..662639,
FT                   662699..662791))
FT                   /codon_start=1
FT                   /locus_tag="CNA02530"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40820"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ9"
FT                   /protein_id="AAW40820.2"
FT                   /translation="MLLLAFVFCSFITFTFLLPGVFGSPTPDTIFLLKESSFTSLGCSK
FT                   FFTPTSILHQVPSPGACFSRCSPTEVAAYTQIQYGVLCSCGDKEMLQELDVMDPCTGNN
FT                   WYLYSNKEVDENEVIELEVEGTRELEGFDSAFSRKGRTSEASIPTAKLGMLTFGKQDRS
FT                   KILK"
FT   gene            complement(663206..664943)
FT                   /locus_tag="CNA02535"
FT   mRNA            complement(join(663206..663499,663566..663684,
FT                   663748..663854,663909..664027,664085..664175,
FT                   664236..664329,664406..664513,664578..664943))
FT                   /locus_tag="CNA02535"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(663609..663684,663748..663854,
FT                   663909..664027,664085..664175,664236..664329,
FT                   664406..664513,664578..664705))
FT                   /codon_start=1
FT                   /locus_tag="CNA02535"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHX9"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHX9"
FT                   /protein_id="ALO60306.1"
FT                   /translation="MDHIAASSFNTSTWMPNGLPEHNGAPPPPMNNSSIINGNSEWKYE
FT                   MRREAQLIIPGLYLGPFQASLNSNKMKQMGITHVLCIRDQKEARLIFPRFPEEFKYMTL
FT                   DISDHPDQNLITIFPTCRDFVEEALSTGGTVLAHCNGGIALSPAIVVGYLMWKFNWTAE
FT                   HALAHVQNKRYCVSTMSFQNQFKEYEPIYMAQKMVETAAKRETTTSKRQVEEEDEEGDG
FT                   YRRKQRYVQGEASDMILD"
FT   gene            complement(665118..667419)
FT                   /locus_tag="CNA02540"
FT   mRNA            complement(join(665118..666336,666404..666481,
FT                   666534..666564,666625..666843,666894..667064,
FT                   667127..667419))
FT                   /locus_tag="CNA02540"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(665724..666336,666404..666481,
FT                   666534..666564,666625..666843,666894..667064,
FT                   667127..667196))
FT                   /codon_start=1
FT                   /locus_tag="CNA02540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40821"
FT                   /db_xref="GOA:Q5KPJ8"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ8"
FT                   /protein_id="AAW40821.1"
FT                   /translation="MKLLPLAVVVASALPSALSWGAAGHEMVATIAQIHLFPSTRAKLC
FT                   SILPEEANCHLAPVAAWADIVRNRYRGTAPMHYINARNDHPQDHCEFGQHGWQNEDVNV
FT                   ITAIQNFTRLIMDGKGGKDVDIPLRFLVHFIGDSHQPLHLAGRDKGGNGAKFLFEGRER
FT                   NLHSVWDSGIITKNIRELSNYTSPLPSKHIERCLPGAIFDPYVRWIVWEGIRLWWRDEV
FT                   DSWISCPATGDPYPHSSQNSIPPSASTIIKDHFRSAASFALSLLPGRLSELAELSFALP
FT                   VIETANFEDQTLALTPKILAVKEVNMTFPSCPYHWISPIHQLNCDIVWPSKYTGQPNEP
FT                   LIELDTDEYLGEIGRQKILEKMMAMAGLRLAKVLNEALAEEGDSVHGVYFGYS"
FT   gene            667702..669001
FT                   /locus_tag="CNA02550"
FT   mRNA            join(667702..667945,668007..668201,668249..668386,
FT                   668442..668555,668614..669001)
FT                   /locus_tag="CNA02550"
FT                   /product="isopentenyl-diphosphate delta-isomerase,
FT                   putative"
FT   CDS_pept        join(667774..667945,668007..668201,668249..668386,
FT                   668442..668555,668614..668792)
FT                   /codon_start=1
FT                   /locus_tag="CNA02550"
FT                   /product="isopentenyl-diphosphate delta-isomerase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40822"
FT                   /db_xref="GOA:Q5KPJ7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ7"
FT                   /protein_id="AAW40822.1"
FT                   /translation="MSTTAVETVTTSPATLTTAVNDINLDSYDEEQVRLMEERCILVTP
FT                   EDKVYGEGSKKVCHLMSNINTGLLHRAFSVFLFRPADGRLLLQKRADEKITFPSMWTNT
FT                   CCSHPLSIKAELVEEHQAGVKAAAIRKLPQELGIPESQLKPEDFHFLTRIHYLAPSSGV
FT                   WGEHEIDYILFSTLNVDLDLNPNEVSDAKYVSKSELEAMFTDPSNSFTPWFKLIARDLL
FT                   FPWWDEMLAKSRSAGWDEESGVGEVRADVLANGPKINELIRMI"
FT   gene            complement(668627..670044)
FT                   /locus_tag="CNA02555"
FT   mRNA            complement(join(668627..669048,669098..669437,
FT                   669493..669739,669818..669856,669924..670044))
FT                   /locus_tag="CNA02555"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(668930..669048,669098..669437,
FT                   669493..669739,669818..669856,669924..669976))
FT                   /codon_start=1
FT                   /locus_tag="CNA02555"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW7"
FT                   /protein_id="ALO60307.1"
FT                   /translation="MQVTPEQLVNEIAKKYNELPKDRRLLVAIAGPPGSGKSTLAYPLA
FT                   DALNSFILGHPPTNPSHIENPVSSLLAEGNIQQGNDDEVALTIGLDGWHYRREELDDFD
FT                   DPQDAHWRRGASFTFNLNSYRSFLSLLRIPLYPHPPRNIPFPTFDHASKDPKPSPFPIL
FT                   PGHRIILIEGLYTLLDQPGWRECAAMMDMGVWVDVDENVARKRVIKRNWEAGIVEDVKK
FT                   CEERVDAVDMKNNEQVRNYLVDPTYIIRSIEGEFISKQNFRFD"
FT   gene            670164..672283
FT                   /locus_tag="CNA02560"
FT   mRNA            join(670164..670388,670443..670587,670640..670818,
FT                   670872..670973,671035..671232,671291..672283)
FT                   /locus_tag="CNA02560"
FT                   /product="expressed protein"
FT   CDS_pept        join(670236..670388,670443..670587,670640..670818,
FT                   670872..670973,671035..671232,671291..672040)
FT                   /codon_start=1
FT                   /locus_tag="CNA02560"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40823"
FT                   /db_xref="GOA:Q5KPJ6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ6"
FT                   /protein_id="AAW40823.1"
FT                   /translation="MYSLPTQSLSHINSPSHPSSPQPAAFPSSPSLLRDVGDEQMIWEP
FT                   IEPIVPDTSQMHYLALDTNILINYLNTVRTLHTLLSASVDRLRLLILIPIKVIQEIDGL
FT                   KHSQKLPYPDSPVDIGRLARLANTWLLETNRIKREGGLSAVRCQSLKERYDRSMIGGKG
FT                   DDDILDCCMYFDQHGAKVVLWTNDKNLSLKAEANNIQTLGGHPSSLSALLKVSGADLPS
FT                   DLWDQAAALDGDAQKSAESPETHKDNSDIHMNDADHLVESCHDFDSLSSPIFDQSNSGK
FT                   PKYFADLPPIFSHGSREINQVHTPPQADTVQRRYPLLSNPGQDDDIEIDEEPLSHCSAF
FT                   SSRTTHSAASTSHASSIHAELSSHRRFARHPSSLMLSSLRISLLSPTLALISHPSYAPH
FT                   VSSSPPPSTLPSVSILSTLLSSLTSLDSYLSSQSYPIEHPLRLSLMRGTIAVKTIQKYI
FT                   EYHENPQANGGTRRIKTNDMLVAVNNLRDTLKDLDVEMGMDVLDDFKGYD"
FT   gene            complement(672092..674808)
FT                   /locus_tag="CNA02570"
FT   mRNA            complement(join(672092..672375,672426..672661,
FT                   672718..673017,673073..673375,673429..674348,
FT                   674397..674808))
FT                   /locus_tag="CNA02570"
FT                   /product="acetolactate synthase, putative"
FT   CDS_pept        complement(join(672343..672375,672426..672661,
FT                   672718..673017,673073..673375,673429..674348,
FT                   674397..674761))
FT                   /codon_start=1
FT                   /locus_tag="CNA02570"
FT                   /product="acetolactate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40825"
FT                   /db_xref="GOA:Q5KPJ5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KPJ5"
FT                   /protein_id="AAW40825.1"
FT                   /translation="MLTRQSRLLRRIPPPNAVLQSGLQRRHRSTDRYSNNIHTSSTQNA
FT                   PAPVYDAPIREKGMTIEAKERVRAHARKIQSSASTAAASPAVRPQPAQHFQAAPQPMPA
FT                   NTPRFESDGQVKNGLDYSFIGLSGGQIFQEMMLRHDVKQVFGYPGGAILPVFDAIYNSP
FT                   HFDFVLPRHEQGAGHMAEGYARVSGKPGVVLVTSGPGATNVITPMQDALSDGVPMVVFC
FT                   GQVATNLIGSDAFQEADVVGISRSCTKWNVMVKDIAELPRRINEAFKIATTGRPGPVLV
FT                   DLPKDVTAAILRTPIPAKSAQPGHSPYLPSNPLNPSSQPSDPLPGDADLITEAAQMINK
FT                   AKRPIIFAGNGVLSSPEGPKLLKELSDKGRIPVTTTLQGLGAFDERDEKSLHMIGMHGS
FT                   AYANFAMQEADVLIALGVRFDDRVTGKVDTFAPAAKAAAAEGRGGIIHFEIQPKNINKI
FT                   VEAQIPVLGDVVASLAELVPQIEAVDRSAWIGRCKATKERYPFTYTPSQEGQKLKPQEV
FT                   VQELDRQAEALGKEKFIISTGVGQHQMWACQYYRWTEPRSWVSSGGLGTMGFGLPSAIG
FT                   AKVAAPEKYVIDIDGDASFSMTAMELATASQYDIGVKVLLFNNEFQGMVEQWQDLFYEN
FT                   RYSHTRMTNPDFVKLSESMGTKGLRCTKLEDLPRMMKEFLEYDGKRPIVLECLVSSEHV
FT                   YPMIPAGKALHEQLLHPLLRNGSE"
FT   gene            675683..677610
FT                   /locus_tag="CNA02580"
FT   mRNA            join(675683..675857,675923..675976,676027..676051,
FT                   676119..676384,676440..676510,676564..676834,
FT                   676893..677062,677123..677218,677275..677610)
FT                   /locus_tag="CNA02580"
FT                   /product="sorbitol dehydrogenase, putative"
FT   CDS_pept        join(675744..675857,675923..675976,676027..676051,
FT                   676119..676384,676440..676510,676564..676834,
FT                   676893..677062,677123..677218,677275..677458)
FT                   /codon_start=1
FT                   /locus_tag="CNA02580"
FT                   /product="sorbitol dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40827"
FT                   /db_xref="GOA:Q5KPJ4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ4"
FT                   /protein_id="AAW40827.1"
FT                   /translation="MPTSLPLESKQPPKPEVFEAKSNLGFMLHSPLKTSFEEQSVPEIG
FT                   PDEVLVEIKKTGICGSDVHFYNTGKMGLAALTESMCLGHESSGIVVQLGSNIVQQAARS
FT                   NVMATARGEAEESNKGTVSNRPLQVGDKVALEPGVTCRMCVDCKGGKYQICEHMIFAAY
FT                   PPSTGGTLQRYYALPADLVYPLPDNVDLSFGAMMEPLSVATHAVANIGGMRTGWNVLIT
FT                   GAGPVGLLAMAVAKGLGAGKVIAVDINEERLHFAKQYAATDTYIPIPPNEGESRGDHAV
FT                   RAAEDLLRSTGTPARGPGSIDLVVDATGAETCVLMGLNAIKPGGIYVQIGFGPPNVSVP
FT                   MFRIVTNEITIRGAWRYGSGDYPLAIDMVARGLVNLKPLLTHTFKFEDALEAFEITKNG
FT                   RDKNGKGVIKCVIDGPE"
FT   gene            678038..679147
FT                   /locus_tag="CNA02590"
FT   mRNA            join(678038..678064,678121..678123,678222..678271,
FT                   678319..678338,678442..678542,678632..678986,
FT                   679079..679147)
FT                   /locus_tag="CNA02590"
FT                   /product="expressed protein"
FT   CDS_pept        join(678060..678064,678121..678123,678222..678271,
FT                   678319..678338,678442..678542,678632..678845)
FT                   /codon_start=1
FT                   /locus_tag="CNA02590"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40829"
FT                   /db_xref="GOA:Q5KPJ3"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ3"
FT                   /protein_id="AAW40829.1"
FT                   /translation="MASTFVNWAKSPAARQYFFSTHFWGPIANWGLPLAALADIANKDE
FT                   ETISGVMSPTLAVYSLIFMRFAWRVQPRNYLLFACHATNAAAQLTQEARFLNYWYFGGK
FT                   EKKHPVGAKVDDVKEKVQEGVEKVKA"
FT   gene            complement(678902..680201)
FT                   /locus_tag="CNA02600"
FT   mRNA            complement(join(678902..679010,679057..679196,
FT                   679240..679714,679770..679851,679904..680026,
FT                   680088..680201))
FT                   /locus_tag="CNA02600"
FT                   /product="nucleus protein, putative"
FT   CDS_pept        complement(join(678951..679010,679057..679196,
FT                   679240..679714,679770..679851,679904..679905))
FT                   /codon_start=1
FT                   /locus_tag="CNA02600"
FT                   /product="nucleus protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40831"
FT                   /db_xref="GOA:Q5KPJ2"
FT                   /db_xref="InterPro:IPR013272"
FT                   /db_xref="InterPro:IPR029525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ2"
FT                   /protein_id="AAW40831.2"
FT                   /translation="MPSKPQKNVPRKSNTGTPVASEDGVSIAAVIDRLSYADAPRPFKS
FT                   ASFASHLPSRTATSSSTSVRKNAKQILALERERYLGGDGFLSAQHVAMRKRGEKIELGK
FT                   KKKGVAKKGNIQNLLKGKMKRDVEEMSGTQEQTPAESRMTSEGTTPTLEEDEDMDVSQK
FT                   ERPATQAPNDHPEDSRPKQEIVTYLTPTAPPSLLPPKKYCDITGLHASYTDPRTKLRYK
FT                   GLDVWHVVRGLGPGGDQAYLSLRGAQTSLK"
FT   gene            680386..686795
FT                   /locus_tag="CNA02610"
FT   mRNA            join(680386..680621,680679..680711,680770..680906,
FT                   680957..681063,681128..681165,681219..681632,
FT                   681680..683321,683385..683650,683697..684094,
FT                   684157..684738,684791..685697,685757..685897,
FT                   685947..686000,686051..686145,686202..686287,
FT                   686340..686359,686413..686481,686546..686563,
FT                   686614..686795)
FT                   /locus_tag="CNA02610"
FT                   /product="conserved expressed protein"
FT   CDS_pept        join(680540..680621,680679..680711,680770..680906,
FT                   680957..681063,681128..681165,681219..681632,
FT                   681680..683321,683385..683650,683697..684094,
FT                   684157..684738,684791..685697,685757..685897,
FT                   685947..686000,686051..686145,686202..686287,
FT                   686340..686359,686413..686481,686546..686563,
FT                   686614..686720)
FT                   /codon_start=1
FT                   /locus_tag="CNA02610"
FT                   /product="conserved expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40833"
FT                   /db_xref="InterPro:IPR022155"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ1"
FT                   /protein_id="AAW40833.1"
FT                   /translation="MPPLTKEELWSSGQDEDVEVNQRALIDKILARYSGEHTIFRELLQ
FT                   NSDDAGAQHVQVKFYTKEGLEALKSDQKPSKLPDAKTALIHSYIVSNDGIPFRTEDWQR
FT                   LKKIAEGNPDEEKIGAFGVGFYSLFSVCDGPFVESGDKWMAFHWKDGKDKLLARSGHLP
FT                   KAMDNASSLSGNPWTTFSMTLREPSLLEGPLELARFFVTSITFMRTVKKIEMLVDGISV
FT                   LEVEKVVKRKERAERGGLHTMAAGGIMTVMNVDVTDMVITAKIMKWLEVAGFSPPPLPS
FT                   AISQFAKPARGLASMISSSFFGRYSSSPTPPPSSSVREPPSTAEDIMEITTFYRDILIY
FT                   QGNVKVNVSPAFARELERATKKAAPDRMPASIVYSRGTDDDEAKDLNGKPFKKDVAGVF
FT                   DGLCPKLDSDMSAKVFIGQPTGQTTGIGGHVASRFIPTVERESIDLVNKHVSHWNRQLL
FT                   WVAGYLCRLIYELEMQDIADEWIKTSKTDDLGLSRLTARALHVIRFFNFRPTTPSTVVG
FT                   QEMEASFYGCSKNNQLFPILSEQGVQPVKDVRMPQASISKFLPELPVISSAVLDQAIRL
FT                   TGRLHAQRLLVDISYDDVVKQLGKRPLTQGEAVDCLKWWEDMASIEGFNLSLRNRLLDA
FT                   AIVLRDDGKILPLSMVQTFIRPHSGTISPDMPIPQHTIPYSITKNLRANSISRVFGWTE
FT                   LNLLQYISFLTNPPMSKPATDPSTDIRSSPEFSEKVLAMLSRSWPNLPSNIQSAISIEL
FT                   KDVECIPTKMGMKKACETYFEGNLLFDDLPIIALSKGTALRGSMEKMLLAIGVRKTVDL
FT                   QLVFSRLIGGGTWSCQDLMRYLVSVKDTLSDEEMKRLRQTAAFPLFVEHPEDGKEPHPV
FT                   RQKPWQLYEPTEAMKDLGLPVLDWANGKWRSNSDEAKLLFTLGLNRYPPIDALLKIAAG
FT                   RAPLNQKALEYLLSNHQNHYPTFKSDAYPDIAFIPAINTKGVNILAKPGEVFTNPECAM
FT                   LGFAVAQPYVASPENAAKLGVQKDPPLEQLVIALTNNLTTDVGAARKIFEYIGTFIGHA
FT                   TPSSVDPLRHTAFIPVQKGAGPSSVVMFKPSQVYFVSGDSEDNLYSSAFTFIDFGLKAN
FT                   MFLRYCGVKSEPSVKDITLLLMKDSQGMLRQAGSSERYLEQLRLIAANWNRLDNQTRSA
FT                   MKAAPFLLASQRIPMSKKSLSMATQPVIGGDDEYYREWVLCRASEAVLVDRVAYAQYFG
FT                   QYILSAPEERILEDFYLELGAKPLSSLVESKYISTPLRNHSTSDKALALRQHVLERLAI
FT                   FLSDRRKSAIYTVDELARENKFRVEEVQSLKVQHLYRKGNKEQIHLQSLYAFASAGKGR
FT                   SIILTISVTAEPDYYDVASALCEVLFKSQKADEALLLFSMLTTPLLALRKRGFNVDRIL
FT                   NQQREEKLRLEAEARRNKETVVPHEQGQTEVKTQNKENSARRASVSGESSGVKGLFSKL
FT                   SRGSTGRGKEKEVEMPGGMPGGLPESTVQRVAKQNQSSIGGASEGLMNGNKSSGVTGET
FT                   RHGRSTKRPTDLLNIRATVKKAMDASRPETSTLIRDSRQAVNDVSESQDDYCDASVHVD
FT                   LVMAFDASPQSGMPLQVWCPRDVSHPNDFLRDKMEICVRFARDVLIPICQVFLLRPAVI
FT                   NIFWDHEGPTIAFNRGGTIFCNARYFGAWHNDMCIRGQHKEPWISWYFSIAHELAHNLE
FT                   SAHNASHEFYFSSIAEQYLLSLAALVQERTSFNR"
FT   gene            complement(686351..687507)
FT                   /locus_tag="CNA02620"
FT   mRNA            complement(join(686351..686985,687048..687340,
FT                   687394..687507))
FT                   /locus_tag="CNA02620"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(686827..686985,687048..687340,
FT                   687394..687439))
FT                   /codon_start=1
FT                   /locus_tag="CNA02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW2"
FT                   /protein_id="ALO60308.1"
FT                   /translation="MEDPSAPSLVQIPSTGVEFFEYRRRLFMAGLPFPETPTTQPLPAT
FT                   YLVPEQPPPPLPRPPRQPKHPSVTRIEEALSQEGAEASRDLWEGGMKELAKNLHDGRKF
FT                   TKGMRLGLVIKILIASWINDGFWPVDPLTGLPEKPPASPLIEGVDLFPEDTLESTQQSN
FT                   KS"
FT   gene            687655..690110
FT                   /locus_tag="CNA02625"
FT   mRNA            join(687655..687836,687887..688845,688904..688959,
FT                   689012..689108,689167..689233,689285..689309,
FT                   689359..689435,689480..689656,689721..689753,
FT                   689801..690110)
FT                   /locus_tag="CNA02625"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(687696..687836,687887..688845,688904..688959,
FT                   689012..689108,689167..689233,689285..689309,
FT                   689359..689435,689480..689656,689721..689753,
FT                   689801..690013)
FT                   /codon_start=1
FT                   /locus_tag="CNA02625"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHV8"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV8"
FT                   /protein_id="ALO60309.1"
FT                   /translation="MATPPVAFLNSQPNTTLSANENHSSGEQPSSKTPLQRQDSLQNTR
FT                   NFYGVQPDLPLGGSAHLPSSIASRLRGKVIRAQSSSHLSALSQSTSPSSGPLPTASPQR
FT                   SSIPLPTPRGFLTPKKPAAAQRLEKSKARPLMPAGVSSGASTFDAKISGNSEVEGNDAL
FT                   RAPSPIERHSAFDLPLSQGLRTNSSPAERDSPLHSTLMASETGLTIASHNVRPVIAATS
FT                   SSQGGRDRSLRHSLTTASSPPRGAPMELSSDNLVRREAGEKPSLTNLKRQSHSRTTFER
FT                   IRHQNNSSKPNRQRKYMSFENPLSTFILGGHVLIGGDTWYSMGLVLAVLLGISGVWLGT
FT                   TGVWMWLHGTEYGLAKGGGVAATIIFVYLFGITTTSFVVTAFRDPGIIPRKLDPDPPMA
FT                   QVDDWWEAYPRELTVQNGRVSVKYCETCATYRPPRCSHCRLCGNCVDGIDHHCSYLHTC
FT                   VGKRNYFSFIVLLITTSISDIYIVILSAIHFSLLCHHDNVSFKSALSDSPGAAVSFLLG
FT                   IIAIIPVLFLLQYHVRLLLFNITTIEQIRANTSKSLFAMPKRPDNPFSSPSLVSNVLLA
FT                   SLARPQFPSWIDASGWKQEDRRKINPALKDWRFGREWA"
FT   gene            complement(690028..691510)
FT                   /locus_tag="CNA02630"
FT   mRNA            complement(join(690028..690380,690431..690532,
FT                   690592..690711,690769..690966,691037..691510))
FT                   /locus_tag="CNA02630"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(690169..690380,690431..690532,
FT                   690592..690711,690769..690966,691037..691361))
FT                   /codon_start=1
FT                   /locus_tag="CNA02630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40835"
FT                   /db_xref="GOA:Q5KPJ0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPJ0"
FT                   /protein_id="AAW40835.2"
FT                   /translation="MSPRFGYIGLGNMGVPIVRNLAKYAAASGFPSISIWNRSSAKYAL
FT                   VKDAIPDAFYADDVEEVVMKSDIVLSSLIDDKAAEDVYEKMFKATEGRNVIFVDQSSLK
FT                   AVTSAKLAEQAKSIGATYIASPVFGRPPAAEASKLLIVLSGPANVKSEVKKHLIPAIGD
FT                   RFVDVGEDVKLASSLKSMGNMVLLGWIELLAEAFTLGDAVGLEPSVFNGFIQQFFPAPP
FT                   LTAYSNLISKGEFPSGSGFSVNGGLKDARNMMSLGADLGHPCPLPTIQRAHDNLERAKE
FT                   LGGPDQDWSALAAAVREQAGFSPYREGTNNGQGEKQI"
FT   gene            691577..693029
FT                   /locus_tag="CNA02640"
FT   mRNA            join(691577..691840,691922..692022,692162..692260,
FT                   692307..692364,692442..692552,692666..693029)
FT                   /locus_tag="CNA02640"
FT                   /product="expressed protein"
FT   CDS_pept        join(691740..691840,691922..692022,692162..692260,
FT                   692307..692364,692442..692552,692666..692924)
FT                   /codon_start=1
FT                   /locus_tag="CNA02640"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40837"
FT                   /db_xref="GOA:Q5KPI9"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI9"
FT                   /protein_id="AAW40837.1"
FT                   /translation="MIPSPRSFLAGWRPETQTSPDIPPLVAAEIAQEYASLRVPNGCPK
FT                   GMFLVPTEETLLRWHGVLFLHHGPYSGSILRFTVDFPSNYPQSGPTVRFNSDVFHPLVD
FT                   ARTKIWHPRGNKMQWRPKVDHISRLLHELKSSFSRVTLDLIEEREAVNKHVWSLYQHSR
FT                   QTFISLTAQRAVHSASQTVLFPAVYSQSPSSTTPPRRRQTSLNSLSSDDGLGPTEPLIN
FT                   FKEVNLDEKEQLLARLRSAY"
FT   gene            693424..694654
FT                   /locus_tag="CNA02645"
FT   mRNA            join(693424..693665,693722..693731,693800..693916,
FT                   693965..693992,694058..694176,694226..694654)
FT                   /locus_tag="CNA02645"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(693525..693665,693722..693731,693800..693916,
FT                   693965..693992,694058..694176,694226..694419)
FT                   /codon_start=1
FT                   /locus_tag="CNA02645"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHX8"
FT                   /protein_id="ALO60310.1"
FT                   /translation="MSLANPVQLLHKPGSTHPSLSDGPDGFDRSWFMGKWGVVWSTLPM
FT                   WKDKKDVTITYTPVAKRCEAKIVEFEDLVEYKTKSSTNGGKTNTIKGIDTLSPGSNGAT
FT                   FDWKGKGLLFFVHSHWEVLGYGKDVEQGLEWAVTYFSRTLFTPAGIDIYVRTIPSSSKS
FT                   QNLTAPEDLLQQLVNEIQNIDVNSIRTLATQGFRVPGSV"
FT   gene            complement(694347..695928)
FT                   /locus_tag="CNA02650"
FT   mRNA            complement(join(694347..694598,694653..694771,
FT                   694848..694945,695002..695208,695262..695277,
FT                   695333..695465,695521..695928))
FT                   /locus_tag="CNA02650"
FT                   /product="methionyl aminopeptidase, putative"
FT   CDS_pept        complement(join(694524..694598,694653..694771,
FT                   694848..694945,695002..695208,695262..695277,
FT                   695333..695465,695521..695847))
FT                   /codon_start=1
FT                   /locus_tag="CNA02650"
FT                   /product="methionyl aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40838"
FT                   /db_xref="GOA:Q5KPI8"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI8"
FT                   /protein_id="AAW40838.2"
FT                   /translation="MFRAPSQILKRAYHPGPSRFGSYPLLPSSSAITSYPEPLPVPEHI
FT                   RRPQYVPINFFTAPWGEHNIPEMGVDNETEGARIALGSKEEWGVRMACRVAADILKRAG
FT                   HRIVKPGITTAQVDKAIHEMIIEHGAYPSPLGYSNYPKSCTTSINNVIVHGIPDNRPLH
FT                   PQDIINIDLTIYLDGYHGDTSATFVLPEVDKLGRELVSATQEALDLGIRVCKPGVQISE
FT                   IGKVIGEFSKRHGFSVNSQISGHGIGKVFHQPPWIFHDVNSEPGKMMPGDCFTIEPCLV
FT                   QGVNSRGDIWDDGWTLATRTGARAAQFEHQVLITDDGVEILSI"
FT   gene            696103..697249
FT                   /locus_tag="CNA02660"
FT   mRNA            join(696103..696173,696223..696294,696344..696462,
FT                   696518..696600,696647..697249)
FT                   /locus_tag="CNA02660"
FT                   /product="expressed protein"
FT   CDS_pept        join(696170..696173,696223..696294,696344..696462,
FT                   696518..696600,696647..697121)
FT                   /codon_start=1
FT                   /locus_tag="CNA02660"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40840"
FT                   /db_xref="GOA:Q5KPI7"
FT                   /db_xref="InterPro:IPR005595"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI7"
FT                   /protein_id="AAW40840.1"
FT                   /translation="MGIFTHSAEDDVLVSASFPETNAFGNVVNGEDNNILIHLINSGSK
FT                   NYTLVSASASYHDPANHWALVKNATTLKYGVPLVSGANFSAPYHVYSEFRPQELGLTVT
FT                   VNLAETGTKDLHYITAMNRTVSIVEAPGSWLDFQLIFLYLILGTALTLGGWWAYDSYFA
FT                   PKSKVKGKKKSGPGPKKVQAVVPGKESVYPEVKPYEEEWIPEQLLKSKQNKLKKRNVDG
FT                   ASSAGEITSGGETSGAEGKGKKRKGKKA"
FT   gene            697940..699225
FT                   /locus_tag="CNA02670"
FT   mRNA            join(697940..698207,698264..698441,698500..698780,
FT                   698836..698913,698968..699008,699065..699225)
FT                   /locus_tag="CNA02670"
FT                   /product="aerobic respiration-related protein, putative"
FT   CDS_pept        join(698030..698207,698264..698441,698500..698780,
FT                   698836..698913,698968..699008,699065..699112)
FT                   /codon_start=1
FT                   /locus_tag="CNA02670"
FT                   /product="aerobic respiration-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40842"
FT                   /db_xref="GOA:Q5KPI6"
FT                   /db_xref="InterPro:IPR003428"
FT                   /db_xref="InterPro:IPR036561"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI6"
FT                   /protein_id="AAW40842.1"
FT                   /translation="MSLPLRAARPLLRASTLTAARRISVASAIRPLSRADCGECGCVSS
FT                   RAFSTTPLRRGSGETDGTLISALAAEHKYELESAAAQPEVPAFIESFKAQGVWNIEDTA
FT                   GSDDIVLTRKFGNETIKLTFQVSDLDATAFDPEYPAAEEDSEGPASGPASITCSLVITK
FT                   SAAPGALMVDLETCDEGFEITNVAVYDKALADAKGAEGDWERRSRYMGPQFDHLDETVQ
FT                   EAFGSYLAERGVDESLADFVLSYCEHKEQKDYVSWIDQVRGFVEQ"
FT   gene            699381..701219
FT                   /locus_tag="CNA02680"
FT   mRNA            join(699381..699884,699933..700074,700121..701041,
FT                   701112..701219)
FT                   /locus_tag="CNA02680"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(699396..699884,699933..700074,700121..700893)
FT                   /codon_start=1
FT                   /locus_tag="CNA02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40844"
FT                   /db_xref="GOA:Q5KPI5"
FT                   /db_xref="InterPro:IPR014476"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI5"
FT                   /protein_id="AAW40844.1"
FT                   /translation="MSAAADNPHPHIDPSLVALAAQVQAHANAQAQRHVSISIPHRHIP
FT                   PAATDNHLGLGLPSEALGSALQIDPSLFEIEQVVNDVRRGKIRLGEDRRDEQEPERSVQ
FT                   HPNDTAHHSQHQQQDDHPGEHGGMEGHGGLGDASDGLQMDDEIDPTLREIVNSLTNAQQ
FT                   SSHLNAPGLSHAQAAAAIGAHLTDAEERERLQQSLQASLEDLTHASFGSLFPPNYSNSP
FT                   SQGFLTLNDHHNIHDTEVDLSNPSLDVNAEVGSSSTSLDASPMADPESSNSVKRGRGRP
FT                   KGSKNKPKPGPPPPKPPKPPKPPARPKGRPPKQRTPAEQAEYELRKHEKELGIKRQKGR
FT                   PRKFPGYLVREMRLKKNREEFNELMREYEEKRREEELANLEMAGVDTQIHLGEGPSLAS
FT                   HDHHVHDPHLHGEHHGHHEQHDFSDWSVQDDQTLLDVVGVGHHEMSVGIGEEEQDHHEG
FT                   MDEVFGIRS"
FT   gene            complement(701076..702328)
FT                   /locus_tag="CNA02690"
FT   mRNA            complement(join(701076..701306,701354..701428,
FT                   701485..701540,701609..701668,701726..701773,
FT                   701833..701842,701900..701917,701992..702010,
FT                   702068..702144,702195..702216,702266..702328))
FT                   /locus_tag="CNA02690"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(701235..701306,701354..701428,
FT                   701485..701540,701609..701668,701726..701773,
FT                   701833..701842,701900..701917,701992..702010,
FT                   702068..702144,702195..702216,702266..702303))
FT                   /codon_start=1
FT                   /locus_tag="CNA02690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40846"
FT                   /db_xref="GOA:Q5KPI4"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI4"
FT                   /protein_id="AAW40846.1"
FT                   /translation="MSELCPPWAPFFGFAGVTSAIVFSTVGAAYGTSKAGIGIAGLGTF
FT                   RPDLIMKSLIPVVMSGIIAVYGLVVSVLIAGNISPSEPYSLFAGFVHLAAGLACGFTGL
FT                   AAGYAIGIVGDACVRAYLYESKVFVSMVLILIFAEVIGLYGLIVALILNTAVGEAVCGA
FT                   N"
FT   gene            702598..704868
FT                   /locus_tag="CNA02700"
FT   mRNA            join(702598..702674,702724..702748,702846..702992,
FT                   703052..703172,703222..703315,703368..703420,
FT                   703470..704265,704318..704868)
FT                   /locus_tag="CNA02700"
FT                   /product="t-complex protein 1, eta subunit (tcp-1-eta),
FT                   putative"
FT   CDS_pept        join(702651..702674,702724..702748,702846..702992,
FT                   703052..703172,703222..703315,703368..703420,
FT                   703470..704265,704318..704740)
FT                   /codon_start=1
FT                   /locus_tag="CNA02700"
FT                   /product="t-complex protein 1, eta subunit (tcp-1-eta),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40848"
FT                   /db_xref="GOA:Q5KPI3"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012720"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI3"
FT                   /protein_id="AAW40848.1"
FT                   /translation="MQGRLPQMQPTVVLLREGTDTSQGTPQLLSNISACLAVAQTIATT
FT                   LGPRGMDKLIVDDRGLATISNDGATILKLLDVVHPAARTLVDIARAQDAEVGDGTTSVT
FT                   LLAAEILKEVRPFIEEGVSPHVIIKGLREAKTLAIQKINEIAVTIDKSDPAEFRDLLMQ
FT                   CAATSMSSKLIHSQTPFFSNMVVDAVLSLDQNDLDESLIGIKKVPGGGMQDSKLIKGVA
FT                   FKKTFSYAGFEQQPKSFKDPKVLCLNVELELKAEKDNAEVRVNEVSEYQAIVDAEWSII
FT                   FRKLEAIVATGAKVVLSKLPIGDLATQYFADRDIFCAGRVADGDLKRVVQAVGGSIQST
FT                   CSDIEPHHLGQCGSFEEKQIGGERFNLFEGCPQAKTCTLILRGGAEQFIAEVERSLHDS
FT                   IMIVKRAIKNNSVVAGGGACEMETSKYLRAHSRTIMGKAQLIVGAVAKALEIIPRQICD
FT                   NAGLDATDILNKLRMRHAQGETWAGIDVDGEGVQDNMKSFVWEPALVKTNALSSAIDAA
FT                   CLILSVDETVRNPQSEQPQAGPPMPRGAAQQAMRGRGRGMPRR"
FT   gene            complement(704861..706669)
FT                   /locus_tag="CNA02710"
FT   mRNA            complement(join(704861..705646,705699..706004,
FT                   706116..706240,706300..706669))
FT                   /locus_tag="CNA02710"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(705042..705646,705699..706004,
FT                   706116..706240,706300..706616))
FT                   /codon_start=1
FT                   /locus_tag="CNA02710"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40850"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI2"
FT                   /protein_id="AAW40850.1"
FT                   /translation="MSSPAPTYARIRSLSHWATFFNQPDGLFRLPSTQGAAIQHLEIDL
FT                   RFVADHQVETVDPNLQADTPIHLPNVCILTFRGGEYVQEDDLRMDALAEVLLAINPVEV
FT                   RWLNATEDPSEQLSFATHLVHPAVIAAGEKWSAAGTLRKLVIQGGFPCPNLTAPTPFAL
FT                   TPAATPCPSPGPARTTFGLQDASSKHHPAPFVSGLSALSTIKPKTVDEDRLKGREERKR
FT                   QAEYTLKPRFEYAFGKWSVQELKWRLDGRYTAACVISIITHFIKAISSSFPSATRHFLV
FT                   DLPAAVSFTSIPAAVIPDLQSLPEKLELDIRVRDWLSDVGFGSLGDARHARLWDLPAPD
FT                   DENDHRNGLRTKAEMILLRDGATIVTLEELTQIVKDSSNEKGRGDRSAMSPADSIASLL
FT                   SGVTESPTEDENEAVTPHSTGSPFANPTDKTDKKMAGDNDSVRPIETSVVL"
FT   gene            706769..709293
FT                   /locus_tag="CNA02720"
FT   mRNA            join(706769..707373,707454..707602,707655..707704,
FT                   707770..707785,707841..707936,708001..708305,
FT                   708363..708524,708588..708707,708767..708963,
FT                   709018..709293)
FT                   /locus_tag="CNA02720"
FT                   /product="expressed protein"
FT   CDS_pept        join(707056..707373,707454..707602,707655..707704,
FT                   707770..707785,707841..707936,708001..708305,
FT                   708363..708524,708588..708707,708767..708963,
FT                   709018..709245)
FT                   /codon_start=1
FT                   /locus_tag="CNA02720"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40852"
FT                   /db_xref="GOA:Q5KPI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI1"
FT                   /protein_id="AAW40852.2"
FT                   /translation="MASVDPAEPSTLEIGSRQPSPPIMKESCDKVASLTSETSTKDKNT
FT                   LQLQDTRSGHILSDLSTFRKTVLLLTFALANFIDVCNVSGVAIAAAQISWDIGLETSQV
FT                   VWIITSYSLCFSAFLLFSGRLSDLFPAGLIFESGLFVLGVLSLATSFVTSNKYAFLILR
FT                   GLGGIAGSMAVPSSYHLTVHMYPESTEQAAKLALLGLAGGLGNVFGLVLAGLCMKASYH
FT                   WFFRVIAILCILSTAVTIIILPHTGSFSVSDGGMQRWKRMDVPGVVLIMGSLICFMLSL
FT                   TQGPIDGWRSASFIAPFVLSLPLGIGFFVWEANIPARTAILPSTVWNITNSVIASLVVL
FT                   VPMGFWGTSQLLFATYWQTTFNWAPLHVAAAMLPQGLTTLAVGILSQFIPAIITKPRYG
FT                   IPIGAILVVAAEVLQIKSNGGGHGKDYWRFLFPAFVIGSAGSMILTFASSVNFVQMCPP
FT                   EMAGVAGAWTSVLFEIGGAITLAVQAGMEKPDPFTFMDIGAKVYYFIIGWTVVLSGIYV
FT                   AFYKQPKALAVEHEETRTRIMQTKGDMRV"
FT   gene            complement(709265..715152)
FT                   /locus_tag="CNA02730"
FT   mRNA            complement(join(709265..709656,709711..710080,
FT                   710142..710257,710317..710391,710441..710594,
FT                   710647..711153,711204..711347,711403..711422,
FT                   711482..711555,711607..711744,711804..711910,
FT                   711965..712018,712081..712259,712326..712800,
FT                   712866..712906,712963..713007,713059..714351,
FT                   714444..714619,714711..715152))
FT                   /locus_tag="CNA02730"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(709582..709656,709711..710080,
FT                   710142..710257,710317..710391,710441..710594,
FT                   710647..711153,711204..711347,711403..711422,
FT                   711482..711555,711607..711744,711804..711910,
FT                   711965..712018,712081..712259,712326..712800,
FT                   712866..712906,712963..713007,713059..714141))
FT                   /codon_start=1
FT                   /locus_tag="CNA02730"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40854"
FT                   /db_xref="GOA:Q5KPI0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPI0"
FT                   /protein_id="AAW40854.2"
FT                   /translation="MNDQSYPTGSNLENHRRGFSSSSLDGRPTEEGVDGRNDRARGGNE
FT                   HPPALDPHSLPAQYKYHLHHYQGGPSPVATFFPQPVLQPSYNIHPMHLSGQPASYDSSN
FT                   ASFPGNPQSIPYLQGRPNQSRNVLSESTPDATQFIQPVDGRSENMPSLHEASENFTISQ
FT                   EMIPRHAQASQSPGGPIGTRASIKNSGNESMSLNKAYGHVPHTRLPSSDRNAAGITFRG
FT                   PSIAYPQNVPNLSDSGLITGSRATDENQPGSQPGKLDGASSAARGDNMAPVKQQSEEPL
FT                   LSWDEMSQAASRPTSSSQKDLQGKGSPDFQSKLNPHMDGGDELIESIEKNKNPDENIDH
FT                   RKRKRNRTIRSCVPCHNHKRKCDRKRPCGRCIALGLTGSCVYEIDEQRNMNDPEVAESE
FT                   RLRRRVAELEQVVRELRQKAPSRHANVSSASATTSLHPAPTTSTASGANAASPISDNGG
FT                   IKRRVIVDRFARFKMDEAQAAENVAGMGYIASEVSSQNGAQHVQNEEGLDEDYRGEPYS
FT                   THSLPDEEMVYDSGGRPVFLGSSAGKSMLRQLRELAASNEDEKLFSVPEDVAFTGVFPN
FT                   LRKTFPFTTIWSHENFCVEIIGLLPDQEQSETLWNAWTNGYQAYFSPFHLPTVRSEYAK
FT                   FFAKSTEDKLNTPLSSLAVFLMVCALGSLLRATAAEILGHPDPEVAMNARSKGEVPRDL
FT                   KDLTSSRLQSELYLSAAYHALRLCSFMANPTVPVLQCQLLIQVYLLASERAADAWAIGG
FT                   NMIKQAIALGLHKDPLSLDPNISMRDAEVRRRLWWSIAGFDTMLAIFFGRPSSITYYTT
FT                   NFPQDRSDDNLSDAPGSARQLLPPSNVLASETTDQTYHTAYYQLTIPSFELLEGIFHVD
FT                   RQFSRSALYGWFSPPPHSSMDGGGPKRHTYRHAIRLAEDIRQWYGHLPKGMRVDKEDTA
FT                   ESLSESRPKKQVVQTLGLCIKTWTLIMVIHRPYLRLDPAAYLESTEFCSQSAHMVLKAF
FT                   RAMADTPLSWMFWTMSYRAFQAGAVCAFLALRQPGTALAAKCVDDLRGAIALFEDRLST
FT                   WCSTHPVQNDLRQGLIQLEKLVTTQRSDIPRHAPAPSYGTNNSPTFGNSQTFSRPASES
FT                   NYQLASQAHDAPTLNNPIQATNSPLPLGVDGAGMFHGPGGIPYHSESLGMSKNGEAPLY
FT                   SQHPEQAGSLSTSLSGDFNGPSPLALSRFWASMFGIRMDDTKETSSPDMAWS"
FT   gene            complement(715715..718062)
FT                   /locus_tag="CNA02740"
FT   mRNA            complement(join(715715..716164,716237..716855,
FT                   716906..717531,717590..717607,717669..717704,
FT                   717762..717810,717867..718062))
FT                   /locus_tag="CNA02740"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(715929..716164,716237..716855,
FT                   716906..717531,717590..717607,717669..717704,
FT                   717762..717810,717867..717908))
FT                   /codon_start=1
FT                   /locus_tag="CNA02740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41333"
FT                   /db_xref="GOA:Q5KPH9"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH9"
FT                   /protein_id="AAW41333.1"
FT                   /translation="MAGQFTPEQSAQLQSEVQVELERREWAEPNDNVMAEYITVLLANG
FT                   SSRERVQSEMDDLVGSDFDPAFLDWLFAKSESIVSAGSATQPATTPLEAAETATSAATP
FT                   RGNSRLLSSALAPLTSQPEKRKLPDITHDGQNKRPAPEVPVGPRLGAVTPRSPNMPAVS
FT                   VRGRGMGIRGTSSGGRGTMVNQSPVNGSFIHQQPSQQTQPGFRPRQQMQPGRFNQQIGN
FT                   PGMLGMPNQQEMMAQMMMMQANMAQMGQMMSMMVGERQHTPQRQQPSISQSGYQASPPV
FT                   PVKLPPGTKLGSHSISSITPKSSTGPIPDKPTSVALCKFGVGCSNARCPYSHPSPVADE
FT                   KTGMVLSEEACEKGKDCKDPECIKSHVSPSAVLGDSVGPSRLLCKYQNCNNPSCPFRHE
FT                   DADGNPVPPPALTKSNKPTVVKAPASSSDDGSVEVINSHRDLLDGQLADGPKMIQCRFG
FT                   DRCTRADCKFLHPASRSLAKAKKPLQSSHARPSNAAISIAGGLSKSKKFGADGKQGGLN
FT                   PDAMEFKPTGHDEEKNGADLNVTL"
FT   gene            718387..720038
FT                   /locus_tag="CNA02750"
FT   mRNA            join(718387..718505,718568..718641,718696..719122,
FT                   719184..719489,719538..719678,719734..720038)
FT                   /locus_tag="CNA02750"
FT                   /product="alpha tubulin, putative"
FT   CDS_pept        join(718468..718505,718568..718641,718696..719122,
FT                   719184..719489,719538..719678,719734..719764)
FT                   /codon_start=1
FT                   /locus_tag="CNA02750"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40856"
FT                   /db_xref="GOA:Q5KPH8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR032374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH8"
FT                   /protein_id="AAW40856.1"
FT                   /translation="MADAKKKQLVYNIIDFLRTSSQDGTIKEDDKESLDVAVQCIAEAF
FT                   GVDPDSAEDDKAYSIKPASLVSILDVFLKTKAKSFASTSPQSEASLPQSSSDISQTDKI
FT                   KAESLKTKGNQLMGQKLYDSAIEQYTEAIKLDPNPVYYSNRAAAWGGAGQHEKAVEDAE
FT                   KALELDPKFTKAYSRLGHAHFSLGNYSDAVRAYENGLELDPDNANMKTALSTAKSKLSE
FT                   LSSRPTAADREPPQNGINGSSGGMPDLASLAGALGGGGGSGSGGMPDLASMMNNPQMMS
FT                   MAQQMMANGGLERLMQNPALRNMAENMRNGGGMPDFSSLASDPSMRDLAQQFMGGRQ"
FT   gene            720178..721395
FT                   /locus_tag="CNA02760"
FT   mRNA            join(720178..720306,720356..720495,720562..720735,
FT                   720796..720851,720912..721002,721056..721395)
FT                   /locus_tag="CNA02760"
FT                   /product="oligoribonuclease, putative"
FT   CDS_pept        join(720262..720306,720356..720495,720562..720735,
FT                   720796..720851,720912..721002,721056..721194)
FT                   /codon_start=1
FT                   /locus_tag="CNA02760"
FT                   /product="oligoribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40858"
FT                   /db_xref="GOA:Q5KPH7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH7"
FT                   /protein_id="AAW40858.2"
FT                   /translation="MASEPLLYDDGPLVWVDCEMTGLDFLNDRIIEIAVIITDGRLNPV
FT                   DGGISYIIKTPKEVLDNMGDWCREQHGKSGLIQACLDSPYSYDTVVEKVLDYIRRWIPE
FT                   RGAGLLAGSSVHADMRFMLMGMPEVMKHLSYRILDVSSVKEICRRWYPKVRAQEQESRT
FT                   TECSHRALDDIRASIHELKFYRDNIFLPLEPVTDGRTSTSQQENIGHKTAL"
FT   gene            complement(721226..722363)
FT                   /locus_tag="CNA02770"
FT   mRNA            complement(join(721226..721408,721479..721605,
FT                   721670..721675,721735..721765,721834..722023,
FT                   722077..722363))
FT                   /locus_tag="CNA02770"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(721266..721408,721479..721605,
FT                   721670..721675,721735..721765,721834..722023,
FT                   722077..722248))
FT                   /codon_start=1
FT                   /locus_tag="CNA02770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41334"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH6"
FT                   /protein_id="AAW41334.2"
FT                   /translation="MSAYGTIATSQPTSSLPVLSFPLPSAGLALVTYPVTGADAPEELL
FT                   RYFYTIFSNELESGCTYPQEGPITYEEFLSYFFAATTIIGIIQPVGTNGKVDIPGDLET
FT                   AKAERSWEECIGGCYYIKPNYPGRSSHNCNAGFLVPTNHRGKKLGIALGKSYLEYAPRL
FT                   GYRGSVFNLVYKNNIPSLSIWDQLGFQRVGVIPKAGRLKTGPNGSEEYVDAVIIYKSFV
FT                   "
FT   gene            722640..724649
FT                   /locus_tag="CNA02780"
FT   mRNA            join(722640..723499,723556..723867,723925..723992,
FT                   724043..724077,724150..724649)
FT                   /locus_tag="CNA02780"
FT                   /product="aminopeptidase, putative"
FT   CDS_pept        join(722659..723499,723556..723867,723925..723992,
FT                   724043..724077,724150..724444)
FT                   /codon_start=1
FT                   /locus_tag="CNA02780"
FT                   /product="aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40860"
FT                   /db_xref="GOA:Q5KPH5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH5"
FT                   /protein_id="AAW40860.1"
FT                   /translation="MASLLLPLFFHLLSSLAETAAAGATPSSSPALFVSSDPPAHDTAG
FT                   CLKTSYYGTYGGAPKEQDHIYLPTAECLLTVSALDAVTSGSIVSVNDLMLGDGDRLVWV
FT                   GRSGVSHKDSQVVPLIEESWNLISSHSRDIVSESNSRGVGYGTQHVLQKANELHHIRPI
FT                   TLVHQTEHSLLVNVPSSFLPIFDTLLPPHLVPVALPIAPLPISVSGWQSVPKKFAKHLA
FT                   NITEHLSFSPELDRIVSEGIRLNQIRRDVRWLTGEAPSGIESRHSFTSGAVKAAQWISS
FT                   QVESTGADCSLQYFLSGFAPNVICHYPSTLNSTERVIFSAHYDSRGSFGSTRAPGGDDD
FT                   GSGTGHLLSLARAISNQGIVFEKAVTLAFFAGEEQGLLGSHAYAEYLNSQNATVLLQVQ
FT                   ADMLGYHAPGEPLQLGLPETIHLPEASYLIGNLSQLYSPELVVGKTAACCSDHQSFVTY
FT                   GFPATQVFERNGPIVDPMYHNSGDVSQREGYDFEQIVSIAKVTLSALLTVAGYKRVPV"
FT   gene            724795..726912
FT                   /locus_tag="CNA02790"
FT   mRNA            join(724795..724901,724966..725208,725266..725346,
FT                   725407..726079,726136..726315,726365..726440,
FT                   726503..726575,726628..726912)
FT                   /locus_tag="CNA02790"
FT                   /product="expressed protein"
FT   CDS_pept        join(725179..725208,725266..725346,725407..726079,
FT                   726136..726315,726365..726440,726503..726575,
FT                   726628..726696)
FT                   /codon_start=1
FT                   /locus_tag="CNA02790"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40862"
FT                   /db_xref="GOA:Q5KPH4"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH4"
FT                   /protein_id="AAW40862.1"
FT                   /translation="MSTILQDWIDLLNAEQHVQVDKLKEHARHGIAAPIRGEVWLYLLG
FT                   VLSEDKTSEITSLISLDLSYKALSNSIPSHLASLLLKTALVHHTKRFRNETYADLITSI
FT                   TAEQPIVRETSWTATRPSISGVPKSPGDITTSSLTSPQNSSERQISASQGPATLPPDPT
FT                   SEEVESFNTIRSQLSRILPKPPSTPPTRHGFLSMLEEVLGKFWNAENLEGRDDEWRKDD
FT                   AGGFEGSEKDWVYLCTPFVCCLSRPVGVFLGFKSLMERMRAFPPLPVRLASFLTLFRQA
FT                   LPELHSYCEDEQVPYVQVALSWMTTLLAKEMWLGDVLRLWDTYLAAHDMFALHCYVCVA
FT                   IFSTCKETLEELDGSEAKLMLLDLPPMDVDRLLQDAANLRVTFPLARHADEEE"
FT   gene            727023..729248
FT                   /locus_tag="CNA02800"
FT   mRNA            join(727023..727099,727300..727459,727520..727640,
FT                   727698..728431,728483..728626,728678..729248)
FT                   /locus_tag="CNA02800"
FT                   /product="zinc-finger protein zpr1, putative"
FT   CDS_pept        join(727319..727459,727520..727640,727698..728431,
FT                   728483..728626,728678..729106)
FT                   /codon_start=1
FT                   /locus_tag="CNA02800"
FT                   /product="zinc-finger protein zpr1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40864"
FT                   /db_xref="GOA:Q5KPH3"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="InterPro:IPR042452"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH3"
FT                   /protein_id="AAW40864.1"
FT                   /translation="MSSDKTNLFPTLGEVADRTGKAESLEQEGDDRQMQEIESLCMRCH
FT                   ENGTTRLLLTSIPYFKEIVVSSFRCDHCGHRDTEIQSAGEIQPKGVSYTVHLLTRADLD
FT                   RQIVKSNWATITIPDIQLTIPPGRGQINTVEGIIRDTVRDLNISQPVRRVMDPETGKKI
FT                   DELLEKLRAAIDMEEDDEDDGGVGMDDDVKPVHHEPSNSSSKEEKPFVPFSMIVDDPSG
FT                   NSYFQFKGSQSDPQWNMRAYSRTFDQNVILGLVARPEDMSEEQPEGVPIVAADHKLSSA
FT                   EEFESKRNKNVINRDDGTVVPDEIYSFPATCSSCGHQLETLMQQVNIPYFQDIIIMSSN
FT                   CYACGYRDNEVKSGGSIAPKGKRITLKVEDEEDLSRDMLKSDTAGLSIPEIDLVLQPGT
FT                   LGGRFTTLEGLLNEIYTELSTKVFRAGDSTTAGIGQTDSSAGEDEANFGDFLKGLKECM
FT                   SAQRQFTLILDDPVSNSYLQNLYAPDPDPNMQIEVYERTFEQNEELGLNDMVVEGYNKE
FT                   AEGTA"
FT   gene            complement(729516..731326)
FT                   /locus_tag="CNA02810"
FT   mRNA            complement(join(729516..729874,729936..730054,
FT                   730112..730193,730250..730332,730386..730499,
FT                   730550..730566,730639..730649,730710..730753,
FT                   731024..731069,731122..731326))
FT                   /locus_tag="CNA02810"
FT                   /product="RAS small monomeric GTPase, putative"
FT   CDS_pept        complement(join(729749..729874,729936..730054,
FT                   730112..730193,730250..730332,730386..730499,
FT                   730550..730566,730639..730649,730710..730753,
FT                   731024..731069,731122..731130))
FT                   /codon_start=1
FT                   /locus_tag="CNA02810"
FT                   /product="RAS small monomeric GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40866"
FT                   /db_xref="GOA:P0CQ42"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ42"
FT                   /protein_id="AAW40866.1"
FT                   /translation="MSKAQFLREYKLVVVGGGGVGKSALTIQFIQSHFVDEYDPTIEDS
FT                   YRKQCIIDEEVALLDVLDTAGQEEYGAMREQYMRTGEGFLLVYSITSRSSFEEVSTFHQ
FT                   QILRVKDKDYFPVVVVANKCDLEYERQVQPHEGRDLAKRFNAQCIETSAKQRVNVDEAF
FT                   IAVVRAIRRYQKESGPPQAVNAPAKSQMSAVGGRAAEKDDHVDKGCCRGCVVL"
FT   gene            731534..735157
FT                   /locus_tag="CNA02820"
FT   mRNA            join(731534..731984,732035..732257,732308..732908,
FT                   732962..732987,733049..733557,733609..734958,
FT                   735008..735157)
FT                   /locus_tag="CNA02820"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(731538..731984,732035..732257,732308..732908,
FT                   732962..732987,733049..733557,733609..733671)
FT                   /codon_start=1
FT                   /locus_tag="CNA02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40868"
FT                   /db_xref="GOA:Q5KPH1"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH1"
FT                   /protein_id="AAW40868.1"
FT                   /translation="MSLYGGIKFSATNPEDEPEQRETPRPPDADAGSLPPAQSKQRQPP
FT                   AFSSALKFAPRINKKPLKPPVPTAHVSALPLNPSSADIVRSAEPVLHSRSPAAQDEGDA
FT                   QLVFGPDGLPLAKAPAMTIGTNKGGYKDRLGNDFSGEKKKKKKKKRKNPQPFFPTFDPE
FT                   EIYDPNRPNDLGEYQQYRKRAKEERRRKLMEAKRRRAEGLSSDESSYYTDSEEDIAPRR
FT                   DAPKMFAPPKMYSPSASKSTVSEEPETAVNRLPESQPAFGRDQDDRRMDVSRLSPSGDD
FT                   AYARRVAMTQQAPLHLHHPSQSGDDAYARRAAISQNPPPTTSFIPSSTASSSAAPDAYP
FT                   SSHLTQPPTTTPPPLPVIPNAQAELPQVQAAASASQDFQAMLEERKKAAEAIAAKFKAL
FT                   AGAAQPPSSPAPASASSSAAQLQDVGGGTFAEKMMRKWGHVEGTGLGARGEGIVHALTT
FT                   EHVAPVANLSQPLSKRALAKQKAAAANAKSRKWVQAPSARGRIVNDNKDERAKEEKERK
FT                   GEEGRVICLRGLVGSVEEIDEELVNEIGEECSNYGIVERVVLHLVEPPPPEPEECLRVF
FT                   VVFSGMAGAWRAIKELDGRFFGGRNIKATYFDETRFDKGDRDGPVL"
FT   gene            complement(735349..738534)
FT                   /locus_tag="CNA02830"
FT   mRNA            complement(join(735349..735701,735759..736714,
FT                   736768..737197,737253..737446,737502..737868,
FT                   737923..738360,738412..738534))
FT                   /locus_tag="CNA02830"
FT                   /product="heat shock protein, putative"
FT   CDS_pept        complement(join(735469..735701,735759..736714,
FT                   736768..737197,737253..737446,737502..737868,
FT                   737923..738360,738412..738490))
FT                   /codon_start=1
FT                   /locus_tag="CNA02830"
FT                   /product="heat shock protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40870"
FT                   /db_xref="GOA:Q5KPH0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPH0"
FT                   /protein_id="AAW40870.1"
FT                   /translation="MDNFTDKSSEVLKAALDKAAEMANAQVHPLHLISVLWEEPNQPSS
FT                   GPDQPTLLKAALEHVGGNPTLFNRALMHKINRLPVVDPPPSPPLPLANSFNAVIREAQK
FT                   LQKDQNDQFVAVDHLLLALLRTDASDMKELLRGTGAEPRALEAEIKRKRGGRKVDSKGA
FT                   EGQFDALNKYCVDLTALAEQGKLDPVIGRDNEIRRVIRILSRRTKGNPVLIGEPGVGKT
FT                   AIAEGLAQRIVDRDVPASLISRLLALDMGALMAGAKYKGEYEERVKAVLSEVEKSGDEG
FT                   TQIILFIDEIHLIMAGKDSSGGMDAANLLKPMLARGKLKVIGATTLNEYREYIEKDSAF
FT                   ERRFAQVIVDEPSVPDTVAIMRGIREKYETHHGVRIMDSALVLAAQLAKQYLTARRLPD
FT                   SAIDLLDEAASAVKVARETRPEAIDELERKKLGLEVEIHALEREKDEASKERLEVAKKA
FT                   IADLEDKLGPLKREYENDKHLGDQIHELRRKIDELRTKADEAERRYDLATAADIRYHSI
FT                   PQREQKLQELEQKEAEKGSGQQVAPEMIAEVVARWTGVPVSRLVETEKAKLLRLEKLIS
FT                   KKVIGQPEAVKSVANAIRLNRSGLGNQNRPIASFLLVGPSGTGKTLLAKTLAGVMFNSE
FT                   DAMVRIDASEYSEKHAISRLIGAGPGYVGHEAGGQLTEAVRRKPYSLILIDEIEKAARE
FT                   FHQLFLQVLDDGRLTDGKGRVVDFRNTIVMMTSNVGSMYLNEHPSEGAVDPAVRAKVNG
FT                   AIAKTFPPEFINRIDDIILYRSLSRADIRKVVDVRLKEIQQRLLDNNRKIKLDVDDPSC
FT                   EWLAQAGYSPTYGARPMARLIQTEILNPLSRLLLQGRVRDGEVAHITVDLRKNRLVVIP
FT                   NHEPDVIQPDDSEDEDDSMDIEVEEMD"
FT   gene            738757..740709
FT                   /locus_tag="CNA02840"
FT   mRNA            join(738757..738983,739063..739224,739288..739326,
FT                   739381..739470,739527..739701,739753..740709)
FT                   /locus_tag="CNA02840"
FT                   /product="protein phosphatase inhibitor, putative"
FT   CDS_pept        join(738807..738983,739063..739224,739288..739326,
FT                   739381..739470,739527..739701,739753..740087)
FT                   /codon_start=1
FT                   /locus_tag="CNA02840"
FT                   /product="protein phosphatase inhibitor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40872"
FT                   /db_xref="GOA:Q5KPG9"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG9"
FT                   /protein_id="AAW40872.2"
FT                   /translation="MQPTQTHAAPVRKKPSRPFVSSHHRPADEVDDGIFRVVLITSGSV
FT                   ASIKAPDIVGALVKSPNIDVQVVATKASTYFYSQEDVDNSVRSALNLPDEQIGEHFGVR
FT                   VWTDEDEWSDWKHVGEPILHIELRRWADLVVIAPCSADLLAKIAGGICDSLATSLLRAL
FT                   SPSTPVIVCPAMNTHMYQHRLTTRHLAVVQEDLEYLVSGPQGAGRLACGDDGPGKMTDW
FT                   RDIVSLIEGFATMHQGRRAVHHSGHSLDRSSDLPLPPFTEAPPTPGRPPKLSSPVESSS
FT                   VSMQGGSPAKGPSDDVLTGIADWRSMTNELGGDGTAWNRKWWLG"
FT   gene            complement(740002..741413)
FT                   /locus_tag="CNA02845"
FT   mRNA            complement(join(740002..740300,740358..740721,
FT                   740779..741164,741220..741413))
FT                   /locus_tag="CNA02845"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(740167..740300,740358..740721,
FT                   740779..741164,741220..741394))
FT                   /codon_start=1
FT                   /locus_tag="CNA02845"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHV4"
FT                   /db_xref="InterPro:IPR019363"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV4"
FT                   /protein_id="ALO60311.1"
FT                   /translation="MDPRLAFLRLTADSASSLPIPCSFQNRRPGAAGHVELNYWPPRNR
FT                   VSKAPDHLLLFILGNPGLLGYYPHFLSHLHSLLPASHAILATSHIGHSTKFPGPTVPLS
FT                   LSQQVTSKIELVETIRDYLDDWALKEGQNRPKFGLMGHSVGAYMACEVMKELNTEKTRP
FT                   VHAGYLLFPTLGWIANTWNGWTLWPIFHRPIKPILPYLSPLLRPLFSLVNLPETSQSLL
FT                   LSPPVLKDVLSLSSDEMRQIKGLDTDWFKTQGTDQTEEREGLFGVWTGGNGDGWVGKDG
FT                   PLVQECLGGESSERVKILDGVPHAFCLTREHSELVAKIVAGWICPKGFRPETPLIPAEQ
FT                   PQQPLGSNIAPM"
FT   gene            741590..746263
FT                   /locus_tag="CNA02850"
FT   mRNA            join(741590..742285,742336..742399,742460..742462,
FT                   742518..742577,742631..742843,742891..743146,
FT                   743197..743993,744047..744200,744250..744297,
FT                   744348..744489,744538..744683,744740..745027,
FT                   745081..745409,745459..745501,745556..745692,
FT                   745753..745896,745963..746263)
FT                   /locus_tag="CNA02850"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(741641..742285,742336..742399,742460..742462,
FT                   742518..742577,742631..742843,742891..743146,
FT                   743197..743993,744047..744200,744250..744297,
FT                   744348..744489,744538..744683,744740..745027,
FT                   745081..745409,745459..745501,745556..745692,
FT                   745753..745896,745963..746090)
FT                   /codon_start=1
FT                   /locus_tag="CNA02850"
FT                   /product="DNA repair protein RAD5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40874"
FT                   /db_xref="GOA:P0CQ66"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014905"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ66"
FT                   /protein_id="AAW40874.1"
FT                   /translation="MSAEASPETGRFRTKSSPELFFPATDSEGEEQNDVPLTIVHPTQS
FT                   TSSKFSINIASSSRPQHGITTGDFEATSQTSAHDNVDDDFSIVGHNPASSHPQGTIVAP
FT                   RRKRSLQQAHSHHSSSSSSPVPSAPVIRADFRKGFLGEFVCEGWSLSKGRGYCSPGTKI
FT                   VIERPKSKSTDVGAPKPGRKDSGPVRLVNGKVVGGVKSKQMTLGSMMAKKVEPAKKVKA
FT                   TTDQIIRFRNERGFEIGRLSIHEAGFLAHLLDTGVIQLSGNVIDCPQNLTTGCTILLNI
FT                   KVYLARKAFENFGKHKREEHFSFWKDQRETAMEEAMRLRKDSLRSLFERIGVKPIQSSA
FT                   LSKVTPIQGVLNRQKGPDLEGSRLRSSPSTSTAEEKGKGRAAMPAVDDDGEDSGDEAEK
FT                   LDEKQMNEIDSIYRKAQQGDTRLDEMDPPSTFLYTLRPYQKQALTWMNAREKGDSSVRN
FT                   ESLHPLWEEYLFKKDQLPGEPIEISDDDEQPDSTRKFYWNPYSGELSLKFPTSQNLSRG
FT                   GILADAMGMGKTCMMASLIHTNREEKPAGNLESQTRDGVEGEIDEEPASKRIKFKQVTL
FT                   SNQWRAVPTAPKVESFPRATLVVCPVSLAAQWHDELRKMSQQGSINSYVWYGGDRVDIE
FT                   ALLAGDGKERVDVIVTSYGTLTSEYQKWLRTKDRPNYEGGSLYDHEFLRIVLDEAHNIR
FT                   NRLAMVSKACYELKGQRRWALTGTPIVNRLEDLYSLLHFLRITPWGNYSFFRSFVTVPF
FT                   LNQDHKALNVVQYILESCLLRREKTMRDKDGRLIVDLPPKTVEIKVLQFSRAERQIYKF
FT                   LEERAKKRFIDLDADGRAMSNYTSILAMLMKLRQCVDHPLLVLGKSGEDGELGEKILES
FT                   GAGNGEGNLRDMIAMYAGGIRAETPEDVDKAYAAKVLKELGEQEDTPICELCSNEMFDE
FT                   VLLPCYHRSCQDCIVEWIGTCEDQNKIASCPSCGKGPIKLADLRSVQRRHKRVNPITDA
FT                   YPGGRDPNLKSSNDTTVTLGKVDLVTSTKLRALLRQLEEIRQEDPKAKALVFSQFTSFL
FT                   DLIEATLTKQGIRWLRFDGTMSQAQRANTIEEFGRKTNEPLILLISLKAGGVGLNLTMA
FT                   NYVFLMDTWWNEAIEQQAIDRVHRLGQNKPVYVTRYIIKGTVEKRIMKIQRSKTALVNA
FT                   SLSNGAKTKETTLADIKKIFGMDEEDSEGEVY"
FT   gene            complement(745784..749573)
FT                   /locus_tag="CNA02860"
FT   mRNA            complement(join(745784..746263,746312..746485,
FT                   746536..746951,746997..747334,747385..747477,
FT                   747527..747786,747844..748389,748439..748502,
FT                   748553..748634,748686..748785,748839..749191,
FT                   749247..749346,749398..749573))
FT                   /locus_tag="CNA02860"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(746168..746263,746312..746485,
FT                   746536..746951,746997..747334,747385..747477,
FT                   747527..747786,747844..748389,748439..748502,
FT                   748553..748634,748686..748785,748839..749191,
FT                   749247..749346,749398..749505))
FT                   /codon_start=1
FT                   /locus_tag="CNA02860"
FT                   /product="gamma-tubulin complex component 2 (gcp-2),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40876"
FT                   /db_xref="GOA:Q5KPG7"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG7"
FT                   /protein_id="AAW40876.1"
FT                   /translation="MPSSRPATSSTVPFTPKPRKRASSSKFTFTDKELNQFAGTLASVR
FT                   KVRPGAILEELEQSGEGSGILHRYESSLHRGNPEAQKRSASARAVENERDRSHFRTRPS
FT                   SSASITQREYNPSFLRAMSGSRDLLPESDHKGREKVNEPAKIEPVLERPTPMTELSAER
FT                   RLLDKVPLEVQEAWICEDLLFVLQGVEGVLIRYDEGYDPFDEEQRVKGAKWRVNPLLDA
FT                   SLLSLVKRLLPLASFFTAVEASMELRTAPEYGMVSHALCSGIRAMLKEFRVLTAQLESL
FT                   FLTSPTFTLQTLYLHLHPTLHTMSLLASLCHALEADQAGQGTDDLSDDDDGLGGMAEEL
FT                   GLGGAGLKGLMKNLKAREGLIGDGGDVLGGEVLGIICEREATMSGDPTASTLHSSLLLH
FT                   ASQPYCKMLIQWIATGHLSDPFDEFMVKESGHITKGVLESDYTDEYWERRYTLRDGAIP
FT                   GSSKVSARNNTPSISAGVPPPRQGTNRLPGGACIPQFLQPWKHKILLAGKYLNVIRECG
FT                   IEVKKPGEVDEKEMVTMNDPNFYKRIEDAYIYANKTLLKLMVEEQELIPHLRSMKHFFF
FT                   LNQSDFLTNFLDLAASELRKPAKSASIIKLQSLLDLAVRNPSSSSSNDPFKDDLKVVMQ
FT                   SQGLYDWLLKIVSKTGSLTEEGELDFALGDIHEEEGSKREKERPLIAIDALAFDYSVKF
FT                   PLSLIISRKTIARYQLIFRFLLHLHHLESALSAMWLEHKSPSWRNNSGNEDIERWKARI
FT                   FSLRTRMLAFVRQVLAFATGEVLEPNWKALEEKLAKVQTVDQLLRDHVDFLDTCLKQCM
FT                   LTTSKLLNIYAKLMTTISVFVSYQSSLNSALNKFLVDPIAESDPAKSKLRWTALSKFEI
FT                   NFNHHAKLHLDAVTYNAGSENVALLALVTRLHQITLRI"
FT   gene            750138..751731
FT                   /locus_tag="CNA02870"
FT   mRNA            join(750138..750247,750299..750392,750444..750673,
FT                   750730..750989,751043..751731)
FT                   /locus_tag="CNA02870"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(750192..750247,750299..750392,750444..750673,
FT                   750730..750989,751043..751221)
FT                   /codon_start=1
FT                   /locus_tag="CNA02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40878"
FT                   /db_xref="GOA:Q5KPG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG6"
FT                   /protein_id="AAW40878.1"
FT                   /translation="MRAASTFLALAASTSYAVALSTGCTTQLGALALGDLGSCLQLTSL
FT                   LPVLSSSGSVVDSVNTYLKSLCGSSTPTCSNDTLTSASSSINSGCSSDISDGGTNGAEV
FT                   TALLALINHYDQAYAAACSTNSSTGDYCVTDTLDTIQDASGSNLTLSSVASILSGTSSD
FT                   SSNITSMFSSGQLCTQCVSGMYYEALQANSSISDTTIGRALSSECGSDFGQTSPNTTAT
FT                   STSGDSSAAATSSASSSSGLVSVQYAGLAATAGIVGSVLGAVIIGSTIIL"
FT   gene            751869..752973
FT                   /locus_tag="CNA02875"
FT   mRNA            join(751869..751962,752030..752230,752309..752973)
FT                   /locus_tag="CNA02875"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(752209..752230,752309..752973)
FT                   /codon_start=1
FT                   /locus_tag="CNA02875"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIA2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIA2"
FT                   /protein_id="ALO60312.1"
FT                   /translation="MGIEIGPLEIVAIASAGVALILLIFASVLYLVRRKSKRQLQSLRD
FT                   HRPVTSATPLSPSRQSEFNRETFFGFGATGMVSLPHIQAQIASSPSTAQTSLVTPTNSS
FT                   HNGKKQKLKKARLGDMGHSSPESGRRKSEELVVITYEDGLRKLGIDPSGEVHRPNHILY
FT                   PEDYDDTEEIAVFEPQMKGRVDSPRAKLGRDRGAGRVAPPALESTWLPSYYHSSNSGEI
FT                   NDAVYE"
FT   gene            complement(753010..755873)
FT                   /locus_tag="CNA02880"
FT   mRNA            complement(join(753010..753383,753436..753595,
FT                   753651..753705,753760..753862,753921..754082,
FT                   754139..754150,754203..754307,754368..754415,
FT                   754479..754553,754610..754706,754760..754901,
FT                   754953..755012,755085..755111,755170..755184,
FT                   755252..755277,755347..755418,755498..755873))
FT                   /locus_tag="CNA02880"
FT                   /product="High-affinity nicotinic acid transporter,
FT                   putative"
FT   CDS_pept        complement(join(753165..753383,753436..753595,
FT                   753651..753705,753760..753862,753921..754082,
FT                   754139..754150,754203..754307,754368..754415,
FT                   754479..754553,754610..754706,754760..754901,
FT                   754953..755012,755085..755111,755170..755184,
FT                   755252..755277,755347..755418,755498..755658))
FT                   /codon_start=1
FT                   /locus_tag="CNA02880"
FT                   /product="High-affinity nicotinic acid transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40880"
FT                   /db_xref="GOA:Q5KPG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG5"
FT                   /protein_id="AAW40880.2"
FT                   /translation="MGNMSTFATAATNKAEDCSSEVGISEKGVEAQDLKDVADIEVQVA
FT                   GIDRAIERRMLRKQDFGLLPVLATVYLFNALDKGNLSNAKTDGLDKDLGLVGNQYYLMI
FT                   TVFYIPLCLCGTPLSIAAKRFSAARVIPLMMIGFGSCSLLSACVTNFGGLFALRFLLGI
FT                   FESPMLPSVVFYLSQFYTRGELARRVGVFYAASSISGAFSGLLAFGIFQIKSGRLHGWQ
FT                   YLFLIEGAGTVAFAIFAFFWLPRSPATCWFFNEEEKQLSRMRMLRDGTSEIGEKVDFRD
FT                   AFMPFIKDWRYIVWAFLALGLGVPLASVGNFLPQIVGRLGYSTVKTNLYTVAPNIVGTC
FT                   FLVLFTQSSDYFRERAIHIVIPLIITMIGFIILGTIDVLNYKGVAYFACFLLCIGSNTP
FT                   SVLLSTWYSNNSISENKRVVLTGVMVGIANASGLISANIFRAQDEPKYIPALAASAAFG
FT                   GFTALLACSFGLYMRIENRRRNFAQGLPKSYGSKDVPTEYLGRGPKDQAFRYMF"
FT   gene            complement(756703..757498)
FT                   /locus_tag="CNA02885"
FT   mRNA            complement(join(756703..756780,756855..756911,
FT                   756978..757163,757215..757498))
FT                   /locus_tag="CNA02885"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(756901..756911,756978..757163,
FT                   757215..757392))
FT                   /codon_start=1
FT                   /locus_tag="CNA02885"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LI50"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI50"
FT                   /protein_id="ALO60313.1"
FT                   /translation="MISAAPSRFKALLASVYRRPLPRTAQSARHYTNGQKQEEPVIPPI
FT                   NELLSKKSIKNAWAALSTTKKLLFGVVVIIGGAGEYALMKRYILEPAKERKRLRDQDSK
FT                   LNAQLDLAGGENKNVLPESQ"
FT   gene            757677..759413
FT                   /locus_tag="CNA02890"
FT   mRNA            join(757677..757756,757804..757946,758005..758137,
FT                   758193..758697,758753..758806,758868..758946,
FT                   758997..759011,759255..759413)
FT                   /locus_tag="CNA02890"
FT                   /product="chaperone activator, putative"
FT   CDS_pept        join(757709..757756,757804..757946,758005..758137,
FT                   758193..758697,758753..758806,758868..758946,
FT                   758997..759011,759255..759273)
FT                   /codon_start=1
FT                   /locus_tag="CNA02890"
FT                   /product="chaperone activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40882"
FT                   /db_xref="GOA:Q5KPG4"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR015310"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036338"
FT                   /db_xref="InterPro:IPR039981"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG4"
FT                   /protein_id="AAW40882.1"
FT                   /translation="MEPKPLTAYQQTYHWRNKNCAPFAYDWIKQSLPGLKVDDGQQSAE
FT                   ISSVTSVSGDCDLGQRKGKLLTIYDLEVQASWIGKTKDGNEVKGTLKIPEVSHEAIDGV
FT                   SDYVYEFSITGGSSSASEELLFYIRKSFPPLLSDKFNSFRPALLAAHGSATADAASAPD
FT                   SGASTPAAYTPAPPTKGADEPINEEQKKEKKSVGATVTVEVKADLQASADDLWGLLTDE
FT                   NKIPMWSRSAAKLSLKAGSPYELFGGNVRGKVITADPPKKLVQTWQVKSPSWPSEHYGT
FT                   MTLSLSQGSDTTAATFTLDGVPAGTQADVEKALNSFYIQGLKQMGLGTFL"
FT   gene            complement(759458..761381)
FT                   /locus_tag="CNA02895"
FT   mRNA            complement(join(759458..759782,759843..759909,
FT                   759973..760095,760174..760393,760456..760894,
FT                   761008..761178,761295..761381))
FT                   /locus_tag="CNA02895"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(759717..759782,759843..759909,
FT                   759973..760095,760174..760274))
FT                   /codon_start=1
FT                   /locus_tag="CNA02895"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHV6"
FT                   /protein_id="ALO60314.1"
FT                   /translation="MFHFRLGHASPQAELKRLKQASALNPNYNMVIKYLDCLNRLADQM
FT                   IPNSNLPIWLIEVQHLITLLQKRVFSRVPLTPVERSALLNFAQYWRSMTRPPYSMGRPE
FT                   AQIVMITLAEFATR"
FT   gene            761990..763420
FT                   /locus_tag="CNA02900"
FT   mRNA            join(761990..762176,762239..762277,762334..762432,
FT                   762489..762521,762587..762679,762837..762932,
FT                   762995..763102,763245..763420)
FT                   /locus_tag="CNA02900"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(762172..762176,762239..762277,762334..762432,
FT                   762489..762521,762587..762679,762837..762932,
FT                   762995..763102,763245..763323)
FT                   /codon_start=1
FT                   /locus_tag="CNA02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG3"
FT                   /protein_id="AAW40883.2"
FT                   /translation="MAFNSNPEKTTSCCSTSEAQDKCTCPEGKCECEACPKFTKAPGSG
FT                   PCDCGVKEKVSTCGCNGSGAACTCPPGQCACDSCPKKAKSVSTCGCGGSGAACSCPPGK
FT                   CACDNCPKQAQEKVSSCGCNGSGAACSCPPGQCSCSGCPAQAKESPVDQATTCGCQGVG
FT                   VACTCPPGQCACDGCPAKAK"
FT   gene            complement(763759..764417)
FT                   /locus_tag="CNA02905"
FT   mRNA            complement(join(763759..763838,763906..763982,
FT                   764049..764128,764218..764227,764299..764417))
FT                   /locus_tag="CNA02905"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(763961..763982,764049..764128,
FT                   764218..764227,764299..764345))
FT                   /codon_start=1
FT                   /locus_tag="CNA02905"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHW3"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW3"
FT                   /protein_id="ALO60315.1"
FT                   /translation="MPLSDETKDRYNAVLGIAKTVFSVGWIPLIIYIGYRNSSPQPSLI
FT                   KLITPLA"
FT   gene            complement(764968..767127)
FT                   /locus_tag="CNA02910"
FT   mRNA            complement(join(764968..765108,765164..765264,
FT                   765316..765597,765658..765942,765993..766215,
FT                   766259..767127))
FT                   /locus_tag="CNA02910"
FT                   /product="Gly-X carboxypeptidase, putative"
FT   CDS_pept        complement(join(765025..765108,765164..765264,
FT                   765316..765597,765658..765942,765993..766215,
FT                   766259..767005))
FT                   /codon_start=1
FT                   /locus_tag="CNA02910"
FT                   /product="Gly-X carboxypeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40885"
FT                   /db_xref="GOA:Q5KPG2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG2"
FT                   /protein_id="AAW40885.1"
FT                   /translation="MSTHEKVYLPTASLGRPSPPRPYGPRLKFLLPLFGIVVFLLYQNS
FT                   STVLSKLHACSHSSLDKISDSDKCPVQPNPLNVGEDWNPLTDQAYGELAAKRLSRAVQI
FT                   PTESFDNLPKDGSDPSFDKHYVFSNFIESEYPKLYQTLKHETVNSHAHLFTWEGSNKSL
FT                   KPILFMAHTDTVPVLPETLSQWSYPPFEGSITRNATPDTPGTWLWGRGVSDCKNSLLGI
FT                   YGAVERLVIEGYKPERTIIISNGYDEEIGGIRGSGVIAKILEERYGTEGISFLVDEGFT
FT                   GVSQDYGALVASLGMAEKGSVNVQIKVETLGGHSSVPPVHTGIGIMSLILAELEKNPFE
FT                   PSLVPSTPYFKYLSCMSEHAPEVPKSIKSRIKNPKKWKKLAHDLASSDRILNSFLATTQ
FT                   AIDLISGGVKVNALPEYVEATINYRIAFTSSVNETLEHISQLIVPLAQSLNFTISAFEP
FT                   PVKRASHFHITLDAPFGFESAPITSSDSKSFELMAGTCKHVFGKDTIVSPSGMFANTDT
FT                   KQMWNVTKNIYRFTPALLSENVNQHTVDERISLNAHLNTTRFFYKLLRNAEGWDAE"
FT   gene            767258..771232
FT                   /locus_tag="CNA02920"
FT   mRNA            join(767258..767735,767786..767990,768050..768275,
FT                   768332..768400,768456..768568,768637..768669,
FT                   768730..768824,768880..769070,769118..769183,
FT                   769240..769437,769495..769559,769619..769806,
FT                   769861..769900,769952..770043,770095..770153,
FT                   770213..770291,770335..770755,770811..770876,
FT                   770931..770949,771007..771232)
FT                   /locus_tag="CNA02920"
FT                   /product="protein-vacuolar targeting-related protein,
FT                   putative"
FT   CDS_pept        join(767287..767735,767786..767990,768050..768275,
FT                   768332..768400,768456..768568,768637..768669,
FT                   768730..768824,768880..769070,769118..769183,
FT                   769240..769437,769495..769559,769619..769806,
FT                   769861..769900,769952..770043,770095..770153,
FT                   770213..770291,770335..770755,770811..770876,
FT                   770931..770949,771007..771101)
FT                   /codon_start=1
FT                   /locus_tag="CNA02920"
FT                   /product="protein-vacuolar targeting-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40887"
FT                   /db_xref="GOA:Q5KPG1"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG1"
FT                   /protein_id="AAW40887.2"
FT                   /translation="MGKEDSQRSANHPVTVTPHISSTHDLIQLPLPNTISHNNARSGAS
FT                   FAVRVTIGTLILLWTLFNIDVVTSPFRQNPSIDSLDDSSAAGYLRGIATKSMKWALPAP
FT                   NHQLHSTYGDLESTEIGEEGIKMSLIPPKLAEKIFLDVPSNDSVAAASKRYTGYAHPAG
FT                   SGYDYASALTLKNEWEKELGLRVSGPQEFIYDAGSPESQARVKNGMDKLGVWIDTYYPV
FT                   MNTPVYAAATLLTDPPFHAKLREDIVDGDSDSELRDEVPVFHGLSVSGDVRGNFVYVGY
FT                   GRKKDFDLLKQRGVDIDGKIVLAKYGGCFRGLKVKAAQEAGATGVIIFTDPGNDGEITE
FT                   ENGYEVYPKGPARQPSSVQRGSVQFLSKYPGDPSTPGEPAYKNASRLEGGNQPSIPSIP
FT                   MSYEDVIPFLKALEGKGIHASDLGPDWVGGLGYHGVDYYIGPSDVDLHLVNEVNTRVMP
FT                   IWNTMAVIPGHITDEVIILGNHRDAWVLGASDPNSGTASQFEVIRGLGTLLRKGWKPLR
FT                   TIMLASWDAEEYGLIGSTEWAEDFGDWLQTNAAAYLNMDSSASGSNFHASASPSLALLV
FT                   RSAAEEVESSSSPSKSVFDTRFDAGNWEQFNMEKLGNHVGLGVPLSEKKGSGIGALGSG
FT                   SDFTPFLQRYGIASSELGHKGGPKDAVYHYHSIYDSFTWQKKFGDVGFHRHTDAAKVIG
FT                   LLLLRLADGLILPLNTTQYTRDLEYYLEKVQDVSKIDLRTLEIDFEPLADAIEAAQTAS
FT                   GELDKQRHKALKKLHKLIGKPAHGKYGIFKTMLRGCGWRVEEGKEVDYSLQTWEEGPKE
FT                   GISSFPHPRLPFPLPTPGRIREIKKVLKEIRIINRKLQNFESGFLSQDGLKDREWYKHK
FT                   GTAPGLWLGYGATTFPALTEAITIDHSPKLAQKEVHELAKMINKIAKYLVA"
FT   gene            771394..773222
FT                   /locus_tag="CNA02930"
FT   mRNA            join(771394..771871,771923..772040,772091..772647,
FT                   772697..772972,773019..773222)
FT                   /locus_tag="CNA02930"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(771449..771871,771923..772040,772091..772647,
FT                   772697..772972,773019..773186)
FT                   /codon_start=1
FT                   /locus_tag="CNA02930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41417"
FT                   /db_xref="GOA:Q5KPG0"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPG0"
FT                   /protein_id="AAW41417.2"
FT                   /translation="MAECLKTLLSVPSAPSFIYLHHPHHSSLSLPLPYSQKHLVKIDTI
FT                   EHRTPRLLLNGILLRLIGGDTDVGEARTWDEFSLRLKRWWSDKVYLAEGKSKGKQTETY
FT                   AKDEAQERSLVLVITHAERLKTVMGNNWPVIVRLAELTGVRSTVVLASSVPWDYVRPPR
FT                   ADAPEPLHVYLPSPSRDEIRTALLPASAHPLYPRFLDLLLSTILPLVTPPIEELHYLSK
FT                   SLWPLYTSTLPPHYEMTHLGLPYPDPAKPPPKLAVDVKLFTTLQHHITLPLASAVESLL
FT                   PRQIGHLEFVSALRPHPGKERALPKLPERPLPLAARLLLIAAYCASYNPSKTDSRLFGR
FT                   GYSANGKRKKGGGMRRTGYGKVRMGKVPQRLLGPKPFPVDRLLSLFFAIYAEHAPRPAE
FT                   LEHLEESSSDDESVPLTWPPTIATDNGKRDRKRKREREQEQAWDDEVEWLMGSTKFWGM
FT                   LPELESQGLLKRVSPPDRLDNIMLRCEIDYEMAKNLAKDSKLGFTLDDYLYEAIM"
FT   gene            complement(773179..775223)
FT                   /locus_tag="CNA02940"
FT   mRNA            complement(join(773179..774169,774220..774412,
FT                   774459..774584,774639..774720,774793..774906,
FT                   774978..775223))
FT                   /locus_tag="CNA02940"
FT                   /product="3-hydroxyisobutyryl-CoA hydrolase, putative"
FT   CDS_pept        complement(join(773254..774169,774220..774412,
FT                   774459..774584,774639..774720,774793..774906,
FT                   774978..775097))
FT                   /codon_start=1
FT                   /locus_tag="CNA02940"
FT                   /product="3-hydroxyisobutyryl-CoA hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40889"
FT                   /db_xref="GOA:Q5KPF9"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF9"
FT                   /protein_id="AAW40889.1"
FT                   /translation="MSSTARIQLLQRMSRPTATSRLAVLNRHLSSSAQMAAPREELVLF
FT                   ESQQDTRIYKLNRSAKLNSLNLEMIDSLSSKIKAWRELDSCKVIIGTGDSRAFCAGGDV
FT                   KQLVLDLKEGKQTAVPFFKSEFQLNWLLARLGKPYVAVIDGVTMGGGGGLSLPAHIRIA
FT                   TPRTIFAMPETKIGYSPDVGSNYYFAQLDGFIGAWLAVTGQEVYGRAAYELGIATHYVT
FT                   ENNISDIVYQITQHPSPTPANISSLISAYTAPASATSEASSKSSPDGHTPIKGEIRKFL
FT                   DKTFNKKSIQEIYAALDKSQSDDKLSSEVKEWAAHQKLQMEARSPTGMAVALQNYRKAR
FT                   EIRRLDRTLLNDISMATAYSGTNRATDDFITGVSAVLIDRSKGPVAWAPKDINEESLSP
FT                   QNINSRFFSASSPHVADKPEIEFTPSSASKLDSGRDSTWGQFRKYGLPSEEAVRAAVDG
FT                   YAPGSGAFALLEEELIEQFVDAQGDVGGTRRDEVIKRVKEVVNACCKKGKDGYLEWTA"
FT   gene            775791..777242
FT                   /locus_tag="CNA02950"
FT   mRNA            join(775791..776092,776192..776294,776363..776441,
FT                   776489..776853,776906..777242)
FT                   /locus_tag="CNA02950"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(775996..776092,776192..776294,776363..776441,
FT                   776489..776853,776906..776987)
FT                   /codon_start=1
FT                   /locus_tag="CNA02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40891"
FT                   /db_xref="GOA:Q5KPF8"
FT                   /db_xref="InterPro:IPR027027"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF8"
FT                   /protein_id="AAW40891.2"
FT                   /translation="MQSLNALGNRQIASLNADLSRMENGEGGPAIQGQITTTLSALSRL
FT                   IDDYDSMARKEMVTVARDKANTRVARLKNEHKELKSRFEQAKNESQLKARQDLLGSSSS
FT                   SSPYPSTASTSVSQRRAPNQSSFAESPFASSDPLFRPNHPPSSREDFALREHTFLQESE
FT                   NSIDQYIAQGRAVLGNLVEQKGMLKGTKRRLLDAANTLGMSRETIGWVERRTKQDAWIF
FT                   GAGATFTLFSFWAIWYYLG"
FT   gene            777502..781058
FT                   /locus_tag="CNA02960"
FT   mRNA            join(777502..778195,778252..778619,778670..778843,
FT                   778896..779344,779392..779562,779612..779676,
FT                   779732..780033,780080..780211,780273..780287,
FT                   780345..780579,780627..781058)
FT                   /locus_tag="CNA02960"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(777550..778195,778252..778619,778670..778843,
FT                   778896..779344,779392..779562,779612..779676,
FT                   779732..780033,780080..780211,780273..780287,
FT                   780345..780579,780627..780658)
FT                   /codon_start=1
FT                   /locus_tag="CNA02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40893"
FT                   /db_xref="GOA:Q5KPF7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF7"
FT                   /protein_id="AAW40893.2"
FT                   /translation="MSQQVISEVRRDTKSSPGNLSSQSSPRHATFIATNSGQDSDSESQ
FT                   SSRAASEADDDEPNNWDRDRGPDISDNSEGASNHSSNPSTSSFSTDQQFYRPEKATEVG
FT                   SDSDSDTDHSSIPSQRSSDIEYEDEAEKVPGRQYNSSPSLFIDPSPGVFAISSNESYSV
FT                   VATETGSQQGSTTLVSSKEERYTLAEDSRYLLAAHSKRDRTVQQVMARFSALYIFPILV
FT                   AVPLTLLLSLNTILLTPLYNTIPLSLHNVTLYALYTAPPTLLYWAMTLERSAREVVSAN
FT                   VCISLAALNGDLVAVLGRRLGSLMGRLAGPEWGACFAKAILGFGAVGGGLIFALLCFDH
FT                   ILPITPAKSLAGRIRNLANISARSTAFMLHLWFGQRLLDRRLSGSVMFLTQSPEKAILF
FT                   ITLYLTTIHLFVRPGPSLASSLNGLYGFISVGLGVAPSKRSEISKYTALLPKRAPSFIL
FT                   FLRLPLLVLALRQQIFLRPPGQRTDPYVTAHGELRVLSSEQSFTGRVVVGDNLKDGYRF
FT                   LRCDHSILGGRWFRERENNGEKTIELGDSIFAVFNLQEVMTLAHRSDEKESLITTLDLT
FT                   TDLKVTSEGKEDEEPSRGSRSNRALVIGLGAGITAQGFLRRGFNVDVVEIDPAVFTATE
FT                   IYFNLSSSHLTSVNLLDGSVFVSELATLSRVNITDPSLDSETLTALERLPKWDFVVQDC
FT                   FTGGSVPGEMFTKEFWEDLGEMVAEDGLIAMNFVGLKMSKASKAVLVTLTSVFPQCRAF
FT                   GDGYEVNQGPNDITNMVVFCTKTYSPILTFRRPRPSDVHRSPLRSHVFSTFLPNEIQLD
FT                   SIISEEDYHDTLMTLRRGDTKRLDYWQKETAIATWRAMQNILTPEMWMAY"
FT   gene            complement(780335..782263)
FT                   /locus_tag="CNA02970"
FT   mRNA            complement(join(780335..780611,780660..780887,
FT                   780943..781240,781295..781380,781434..781605,
FT                   781653..782012,782060..782142,782187..782263))
FT                   /locus_tag="CNA02970"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(780784..780887,780943..781240,
FT                   781295..781380,781434..781605,781653..782012,
FT                   782060..782142,782187..782238))
FT                   /codon_start=1
FT                   /locus_tag="CNA02970"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41335"
FT                   /db_xref="GOA:Q5KPF6"
FT                   /db_xref="InterPro:IPR005373"
FT                   /db_xref="InterPro:IPR039156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF6"
FT                   /protein_id="AAW41335.1"
FT                   /translation="MAHYQISPGRAVGIFHLGDTLWHVLDLLRTRKNEYPKFSLSWDPQ
FT                   HPHESAVVIHLPSLTLYFPHPSQTLTLISFPSLAFSNITLTFETQLLYAPEQPLTRAKV
FT                   GRIFGPTFADEGRGLVFPGIKFEMSSEGKGGREDLVRRLDVNGKEGERLSLPGQLISCN
FT                   VQPNKGVVLSIAEEEPLEIILGQTTAQDLLLDLGHPLRKFWKEDDRLEKMWGGTSEPGY
FT                   CFWNYFQYGLDFLISPQFKVHKILCYSNIPGTPLFQRYARCPWTVSTSSGTLNLTSSVA
FT                   AFHSSLFPKPSQYEEEIDEQKRSTSDKTRKASKSGAGSTKKKRSGEPPVMVLDRVVEGG
FT                   LDGVMNVGESRLIGYEGLIIEEDQLSGGICSVLVWRNEGVQSLS"
FT   gene            783277..784267
FT                   /locus_tag="CNA02980"
FT   mRNA            join(783277..783676,783730..783966,784035..784267)
FT                   /locus_tag="CNA02980"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(783332..783676,783730..783966,784035..784115)
FT                   /codon_start=1
FT                   /locus_tag="CNA02980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40895"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF5"
FT                   /protein_id="AAW40895.1"
FT                   /translation="MLSSRAFSPRTIFNRAALSPLAISTRFFASPTTSSMAGNTSVADA
FT                   VKHDHRELEEYYDQIIKATDADTKTRYQNLFTWELARHSVGEELVVYPALEKYVDGGKA
FT                   LADRDREEHQKVKEMLYKFQQLSPSDSEFEPTIKKLMSDLAEHIKEEETEDLVKLEQAV
FT                   PSSESSSLAASFKRTKMFAPTRSHPSAPDKPPFETVAGLLAAPLDKLGDVFRKFPNE"
FT   gene            784741..786376
FT                   /locus_tag="CNA02990"
FT   mRNA            join(784741..785135,785185..785206,785259..785919,
FT                   785970..786376)
FT                   /locus_tag="CNA02990"
FT                   /product="expressed protein"
FT   CDS_pept        join(784778..785135,785185..785206,785259..785919,
FT                   785970..786080)
FT                   /codon_start=1
FT                   /locus_tag="CNA02990"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA02990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40897"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF4"
FT                   /protein_id="AAW40897.1"
FT                   /translation="MTTPTAQSQPVTFSSAQDENSAIAQSLAARRRRSLASILRDFRIR
FT                   QSAHKTTGDRVVEEESEEEEEEEDEYDHPERINTLDLEAYKRAMGDMIKMEQSGEVIDP
FT                   DSIETEAAGLEFVWDVLFENQRGIYLLGTAYYSSNTLLPKDPSTFTRPDRTAPITSSFA
FT                   LADPSQNPTVQPVKSSKKYLRKVKAKSSTPTQSNKTSYTLETYQPPSPEWEYLTPWMVN
FT                   MRTGTDELGWRYNAWFRKKGWSSHAGNLGWWGWVRRREWVRLRVRKPRRKEEDKPSEKI
FT                   YRTPSYKLEDLLNGEVSGNALRILKLMGELGVDRERLELWKSWLDGIQKGGQVWNRLQE
FT                   LLADREASTLLHRQFIHLPSYQKFMDLLSDHSLSTSPAHSDTP"
FT   gene            complement(785533..786917)
FT                   /locus_tag="CNA03000"
FT   mRNA            complement(join(785533..785630,785708..785779,
FT                   785837..785889,785941..786338,786392..786497,
FT                   786555..786619,786685..786780,786834..786917))
FT                   /locus_tag="CNA03000"
FT                   /product="DNA repair-related protein, putative"
FT   CDS_pept        complement(join(786049..786338,786392..786497,
FT                   786555..786619,786685..786780,786834..786846))
FT                   /codon_start=1
FT                   /locus_tag="CNA03000"
FT                   /product="DNA repair-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40899"
FT                   /db_xref="GOA:Q5KPF3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR027502"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KPF3"
FT                   /protein_id="AAW40899.1"
FT                   /translation="MTSFVFVTGNANKLREVKAILAAGDSGIEVTSQSVDVPELQGTTQ
FT                   EIAIAKCKVAAEKLGTACVTEDTALCFEALNGLPGPYIKDFLANIGHEGLNTLLNGFPT
FT                   TRATALCTFAYSPGPGEEPILFEGRTEGNIVPARGSKVFGWDPIFQPLEGGGRTYAEMD
FT                   GEEKNKISHRYRALEKLRAYLSEQAK"
FT   gene            787055..789018
FT                   /locus_tag="CNA03010"
FT   mRNA            join(787055..787766,787817..788298,788352..789018)
FT                   /locus_tag="CNA03010"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(787596..787766,787817..788298,788352..788394)
FT                   /codon_start=1
FT                   /locus_tag="CNA03010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40901"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF2"
FT                   /protein_id="AAW40901.1"
FT                   /translation="MSTSSTPSRQRTIVNWMNTSLVAPLEGWERGCFGVGTRGRGGRRR
FT                   PHAKFEGLGGNQSSPAPQAAAEGPLTPHNLRILCVNKWISQPTSSTPTDLRLLRSTKFS
FT                   PYFDNCVGALDGTHIRTTVRGEEAKRSWRNRYSYISTNVLAACDFSLRFVYVRPGYEGS
FT                   ANDQNVLNNALEDNFVIPKDRFYLADAGYGAHPGLRLPFRGVRYHLKEWGRANTRPRSK
FT                   EELYNLRHA"
FT   gene            complement(789024..792221)
FT                   /locus_tag="CNA03020"
FT   mRNA            complement(join(789024..789405,789471..790021,
FT                   790089..791476,791546..791833,791905..791998,
FT                   792047..792078,792134..792221))
FT                   /locus_tag="CNA03020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(790590..791476,791546..791833,
FT                   791905..791998,792047..792078,792134..792170))
FT                   /codon_start=1
FT                   /locus_tag="CNA03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40903"
FT                   /db_xref="GOA:Q5KPF1"
FT                   /db_xref="InterPro:IPR019007"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF1"
FT                   /protein_id="AAW40903.2"
FT                   /translation="MAKKSHNPAEAYRKQLKAKELKKNKEARQKARETQTVKKDTRELE
FT                   TEIRSLKAENNPANKKKIQELESELQYVSKLKEKYVSEHPEEHDRIYNIRRKTEQDQDG
FT                   EGEGSGSGKQLYDERGRLRNPKRSVYYDPVYNPFGVPPPGMPYRERTAEEEESEEDESD
FT                   DDIVMPEGPPPDSDEEGDGDDSDDSDDIPLPEGPPPEPQAILPVPPLPSGPPLPPSGSG
FT                   FFPPSAGYRPPHHFAYGVPPPPPPSFRPPMPPRPHAPNVAHNRPPVPVQDPLSNKPTIP
FT                   YQAHKMAHALPTRPSGPSGTGVSTSASPKPIPVAASSDAKAPITQSAGVPGASGEISAA
FT                   PVLRDLRKETTAFVPRGVRRRKAGPGGSSNGAGGMTVNAAPGAGEIDEDGDEIKRPKLA
FT                   EGEGLLGKLSGVLGGAHGVLGKNGSEEKRDVDDDYQKFLEGLGDIG"
FT   gene            792392..793238
FT                   /locus_tag="CNA03030"
FT   mRNA            join(792392..792573,792677..792749,792819..793004,
FT                   793092..793238)
FT                   /locus_tag="CNA03030"
FT                   /product="arp2/3 complex 16 kda subunit (p16-arc),
FT                   putative"
FT   CDS_pept        join(792419..792573,792677..792749,792819..793004,
FT                   793092..793154)
FT                   /codon_start=1
FT                   /locus_tag="CNA03030"
FT                   /product="arp2/3 complex 16 kda subunit (p16-arc),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40905"
FT                   /db_xref="GOA:Q5KPF0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006789"
FT                   /db_xref="InterPro:IPR036743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPF0"
FT                   /protein_id="AAW40905.1"
FT                   /translation="MSDYAFRKIDIDALDEDVLLPSDLYDPDPRGPDGVLEDAKRRSAD
FT                   VRGLVSRGDVAGALSTILTDPPYGDGVDEAKSLTTSSLLLILNSTRSADIPTMIKNLDQ
FT                   VQQDRLMAYLYKGMAVLAQGGEVSGSVLLTWHEKLTEVAGVGCIVRVMTDRKTL"
FT   gene            complement(793270..794435)
FT                   /locus_tag="CNA03040"
FT   mRNA            complement(join(793270..793458,793518..793665,
FT                   793717..793957,794014..794349,794389..794435))
FT                   /locus_tag="CNA03040"
FT                   /product="ER to Golgi transport-related protein, putative"
FT   CDS_pept        complement(join(793392..793458,793518..793665,
FT                   793717..793957,794014..794349,794389..794394))
FT                   /codon_start=1
FT                   /locus_tag="CNA03040"
FT                   /product="ER to Golgi transport-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40907"
FT                   /db_xref="GOA:Q5KPE9"
FT                   /db_xref="InterPro:IPR004932"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE9"
FT                   /protein_id="AAW40907.1"
FT                   /translation="MNPQTYPAVNPYPPTQAAPSAGPGSGFPPKSGLAGMTPHSMSSTP
FT                   VPNMAPGAGVRGGLPEERNVAQLVRENTNVWARKWQGLLDRSTPHVLERWLVTLGLFLL
FT                   FALNVILRQGWYIVCYALAIYILNLFLAFLQPRFDPSLAEDLAADDVEEGAPGLPGAGP
FT                   AKTPGGLKGLLNGFSNGEEDEEFRPFIRRLPEFKFWYSATKANAIALLCTITRATDVPV
FT                   YWPILLVYFFTLFGLTMRRQIQHMIKYRYVPFDLGKKARYGRK"
FT   gene            794573..797283
FT                   /locus_tag="CNA03050"
FT   mRNA            join(794573..794938,794988..795152,795219..795477,
FT                   795532..796168,796228..796589,796641..796758,
FT                   796820..797283)
FT                   /locus_tag="CNA03050"
FT                   /product="ubiquitin-protein ligase, putative"
FT   CDS_pept        join(794578..794938,794988..795152,795219..795477,
FT                   795532..796168,796228..796589,796641..796758,
FT                   796820..797158)
FT                   /codon_start=1
FT                   /locus_tag="CNA03050"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40909"
FT                   /db_xref="GOA:Q5KPE8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE8"
FT                   /protein_id="AAW40909.2"
FT                   /translation="MNTHLAARLQHLASSYPPHTALFYARIWHTLAPTTDSNHDSLHAL
FT                   ALAFLQAAEPYSAIHLVRDHTGLDNLDLDLEIRFERTDKVCGGCAMIVARCCEKLGRYS
FT                   EGQAVLARALKRGANINLALPAPSSNAATAYLLLANLSHKGKSPETAIENYRKALDEDP
FT                   WMWEAFTNLCDVGAPPPIESLFPAGAGLSLSRHASRSSRPPLSPNIHRQKSPIEPAPGV
FT                   LRLHQAQAGAGNSGGLFTPDVEGIGGKTGLGMMGNPSSWDSSSIIGDTTFAVPEQPTKR
FT                   PFPSFMSTATSFLPSSLRGGTSTPAGSDSPPKLPTMKRPRGKDPVKRPVETPQSQMSSG
FT                   LPLAKELRPNGAKYEDSDAPRRSSRLKTTTSKPAPKIPRDPHATRSRSVTSSNSNNEVP
FT                   SPPSLTSQDAILQREADEYLKDIVKKCARVYKSLSRYQCQQAIKEVDALPGELKTSPWA
FT                   MEILGRAFYEIANYAMARRAFTFLQQQEPYRIQSMEQLSTLLWHLTDLPALSHLSQSLI
FT                   SISRSSPQAWIAVGNCFSLQKDHDEAMRCFRRATQVDEGCAYAWTLCGYEAVEMEEYER
FT                   AMAFYRTAIRTDARHYNAWYGMGLVYLKTDRPRYAEHHFRRAVEINPTNPVLLCCVGMA
FT                   LEKSDDVVQALHFYERASKYAPTSAMVQFKRIRALVALQRYDEAISALVPLTHSAPDEA
FT                   NVFFLLGKCLLKKERRQEATVAFTNARELEPKLEGVINAVLAANGEEGEDEE"
FT   gene            797323..802325
FT                   /locus_tag="CNA03060"
FT   mRNA            join(797323..797645,797699..797836,797915..797970,
FT                   798027..798217,798275..798987,798989..800475,
FT                   800530..800656,800716..800961,801014..801240,
FT                   801303..801568,801638..802325)
FT                   /locus_tag="CNA03060"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(797390..797645,797699..797836,797915..797970,
FT                   798027..798217,798275..798987,798989..800475,
FT                   800530..800656,800716..800961,801014..801240,
FT                   801303..801568,801638..802241)
FT                   /codon_start=1
FT                   /locus_tag="CNA03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40911"
FT                   /db_xref="GOA:Q5KPE7"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE7"
FT                   /protein_id="AAW40911.2"
FT                   /translation="MQNSVPPATFRRINSLPLSHSHSPTPTDNASSGWVTTTSSWTSST
FT                   KDPPSTLDVLSKGGGPLAWTEVRHRLQEGEHVDVDGEGNNVGHCSQAVILSCLHLAHEM
FT                   ALREVGMYAWTVPAVKDPTGSMMKIMKQYEKQIKAMSRHADLRCRSVPDPSKLSIQHHL
FT                   QKARQAAGLNSYVAVIYSGHGIQEPPTEAGELWCYDKNFEECLQSGCGPSEYIPILLFD
FT                   LLTWAGASTCYVWDCKNAGRFIRAAKTEAEEIDSQLRTAAAQNPSVAETQPATYAKRQI
FT                   HFAACSTEQVLPKVKGLPDDLFTACLTTPLRIALLFHNLQCFPLTRKNAEKATIKSPAY
FT                   MDGLWENMSQSLKDRLWSELTAILHTIAWQTLDGSEYQKLFGKSGDVVNNIASGFLLSQ
FT                   RVLGAFKVTPESVPSIPSSVSNHALWTTWDLILDNLFEQLPKYFDDAHPNVTWEKDLKL
FT                   VSFMADQLESITTAGQSLLFTETPKSGMMPGLTRLPIICRASMTEEFRVQACSALDACL
FT                   NALDARGLARAVQGGALDVAVELLALQDERIKDQVISIWSSLVKYDSCVLALAKEGLTA
FT                   DRLTDVPAVKFFLIVLQENLAHDKLSPDAGDSGPDTQEDCSDFNLVPTVQIAAVLSTIA
FT                   NFVVGRSAPRFVSRSLNMANIMLHSSCDLIRQWGALLAAEVLGSLSISDEERLSEELKG
FT                   ELLRMVDSGNVENRAAGIYALSRWLPVGDEWGASELEGILELSDHLVKHSKVEGSPLVR
FT                   RELAEVFIQILKSAKGFTAMALWTQLLGYALDARRQDISVAEKAIINLGMNLKMAPKQK
FT                   LLLNRIAAILSAVCVQRYDPDPMVAKIVHQPLCKALDMLRSQSQESKKDANVWSEIQSA
FT                   TFLSSKNKPEWTNEMFETILAASERVKELYQGTSSGNDPCRFTAERPQHAKEAKSRKRV
FT                   NHGLFERNKRALQAHITQARRKAEITSHDSSPIKSTSSGDTWTMRHRVLEDSLVIAEQQ
FT                   VGLPWKWSMKDIICPDPWTTLTFHSFHSTVMSCNRDHDLLMWDWNSSRKIGHVKLNLAS
FT                   HTSITSARFVNELHEQIVILAEICNGDIHILAGPQDASRIKPIASFQALNMHSSRNMLV
FT                   EDEDHRRLVTTWFRQSGKLCVGGASEVINVWDCPAERCVQVLETKANVPVTTLITEPVS
FT                   GNLVIGGQADGMVQLFDLRQCRRTSVLSWKADLPGLSIQQEDMRLFNTKKDGVAKMGVI
FT                   LGESKHVTSACFNGLINVHDIRNLSQSAASVLAHPDGIASASFQPHSGLMSTVSLLNKP
FT                   PLNSSKGTIMSVTPAYSHSSTQSKLSTALSHFHLRSRSNSSPKIRPSYTMNNNITLHPS
FT                   AASIRSSANWSLHRTSLGSCNPVTVESISFDSQPADVMAQGFRPYTVMHPLRPFLGIGF
FT                   GETCYLRGCGVGKGDDTDSGSYTFLREQAKYGVL"
FT                   /artificial_location="low-quality sequence region"
FT   gene            complement(802024..803833)
FT                   /locus_tag="CNA03065"
FT   mRNA            complement(join(802024..802463,802525..802670,
FT                   802726..803313,803364..803676,803737..803833))
FT                   /locus_tag="CNA03065"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(802401..802463,802525..802670,
FT                   802726..803313,803364..803676,803737..803769))
FT                   /codon_start=1
FT                   /locus_tag="CNA03065"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR024964"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIM1"
FT                   /protein_id="ALO60316.1"
FT                   /translation="MHPHHTPLLSLHQVVLDYVITNAYASTAKSLSQSCASGRGASPSG
FT                   DTAMPSDLKTGSKSDANGDQKTNGEADGMDVDVEMDGSDDNANSGEDSNKNLDRGPALD
FT                   EQALDMIERRREILEYILSGSIDKAVELLDRHFPLVLSCSEPMPSNYGAATNGATSNGT
FT                   ATPKSRLSSSGGPLHSESSINHSVPVLNSSVHPDHIRLNLQIQRFIESFRQMNPSSPSS
FT                   PSSSTSSPANSQTFNGGSGVTLTHALSAAHGLHSEAKKLPAEVRAIYLQEIKDVGALFA
FT                   YENAEMSPLKGFLEQSRRVKLAEQVNKAILRSEGRAPQSQLEEYSKRLEVYYKVLEGNE
FT                   IDPTPPWTAKDGLAKEHLAAYWKYHDIKNFNLHDFASLSW"
FT   gene            complement(805134..809468)
FT                   /locus_tag="CNA03070"
FT   mRNA            complement(join(805134..805654,805708..807161,
FT                   807211..807828,807879..808085,808134..808640,
FT                   808690..808956,809015..809323,809378..809468))
FT                   /locus_tag="CNA03070"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(805236..805654,805708..807161,
FT                   807211..807828,807879..808085,808134..808640,
FT                   808690..808956,809015..809175))
FT                   /codon_start=1
FT                   /locus_tag="CNA03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LI56"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018834"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI56"
FT                   /protein_id="ALO60317.1"
FT                   /translation="MGEIPLAGPSRPRRRNNTESDGISIRVAALQKQNATLVGVAANES
FT                   GKTRPPPASPSRSRPHSSLPSRPDIDDDYYRGISGPMPSSLTSNLEFNDADGLGVAGSS
FT                   RPRRKDYAAVNGASSRAATLPKHGAAVKDEGETQQLPTSPSRPHSRPHPSLPTRPRRDN
FT                   EFSRGASGSSTNKVLFDPTKLHEVRRVEPGSTKKLFDPVAHDPRSFTSLATPPSLPDTE
FT                   SAPSTSTTAKRLLRRAAPGTGSGSGQSGSSKHTWEIDADRERERRRRREGSERGSTLSG
FT                   KKKDSDARSKGSKSSEGSESFKDRERGKGKNDTGVKPILKKIHDEIKELEQELIEIHRK
FT                   MAQDPEAGISALSSRKMDSRTPKSPSDDAVAWVQLISKHKQLADLHDHFLTTLFDPLVP
FT                   SSYHQLSIKYNIPSRLWQTAFFLILEQLRHAWVSHHPSALDLLTDVVYDAYRFYSELLE
FT                   NQALSGLRGAWIEALGDLARYRMTIASHVADIDPRKETERIRDQRQGADDDNDQDPEGK
FT                   PPLSGASIGAEVAQNWDVEDKETWRVTARDWYTMGITEKPGEGRLHHHLALLCRDMKGQ
FT                   EGRALHHFVKSLVVTHEFSTSRETILPLFDTALQSQRSLPEATAMDLFIRLHGMLFTRI
FT                   SLDSFPDVMSRYVERLEEDARLDGVSRKATISQVDWMIMGVVNIAGVLQYGSASGIIRK
FT                   ALAQEGAERRKAQAQNADDEEGEDVGENLEEVNGISKDTELVSLPASVAESDLPITFTH
FT                   ALFLTFAVFGFSLAHPNRIQGFHQVLNPYIIIVLTFLATLFRQPHVGVHLLPYVPWQLL
FT                   ADFINSANLSLVEEKRLANGAPLPEDWLIRGSEWVGRRVYERGFWKGKSPSGRGSSGLL
FT                   QAQPRSGERFQSEMDVLLSNFDASVDIQEGVVDEAEGTDLTDGPAAVNQRRWKRVAWAV
FT                   GVLAKSVEGFEIRDGKVYVEGTLQEKVKERERRKEEEERREREVLERKRQEREKEEKLL
FT                   GLEMGEESDDQELVDLRRKLQDLKAQAGVQVSRKSRKAASNILDVVAGYTMLIFDTNIL
FT                   LDSLELVNRIVESGQWSVVVPLPVVTELDGLSKEHGALGAAARAAVALLEERIRTHALC
FT                   LKIQTTKGNYLSDLLIRTEQIDSSTYASSEAIARTMDDRIVHIASFAQEHFVDRTILLA
FT                   MPRPEKGATKVLLISNDRNLRLKAKARGVEVANEKELGVVLARV"
FT   gene            809729..811979
FT                   /locus_tag="CNA03090"
FT   mRNA            join(809729..809863,809939..809972,810023..810078,
FT                   810135..810265,810329..810345,810387..810986,
FT                   811040..811182,811233..811380,811435..811586,
FT                   811639..811979)
FT                   /locus_tag="CNA03090"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(809802..809863,809939..809972,810023..810078,
FT                   810135..810265,810329..810345,810387..810986,
FT                   811040..811182,811233..811380,811435..811586,
FT                   811639..811768)
FT                   /codon_start=1
FT                   /locus_tag="CNA03090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40917"
FT                   /db_xref="GOA:Q5KPE4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE4"
FT                   /protein_id="AAW40917.1"
FT                   /translation="MVKDTQLYDLLEVQPDATDIQLKKAYRKLAIKYHPDKNPAPEAAE
FT                   KFKDIGEAYQILSDPDSRAFYDKVGKDAMNRPEGGNIDPQEIFSQIFGGEAFFDYIGEI
FT                   ALVKDFTTTMDVVMSPEEKAEMEAAAKADAEASAEATEPSSKTSAAASAAAASAAADPL
FT                   GQSAAGAANEAAQAEVGVSGENQALALHSSASGTNTPTGKADGEADAVGAAKKPESSKK
FT                   GKPKLTPEQKAQLEALEKKQDEEKQKRIETLQDRLVQRIRPFVDAKNPGDINDAETKAF
FT                   ENRIRIEAEDLKLESFGVEMLHTIGQVYITKAGNFLKSKKFFGGGFFGRLKEKGGMMKE
FT                   GWNLLGSAVGVQSAMAEMERLEAKGDASQEEIEALAQELSSKMLLTTWRATRWEVINVL
FT                   NVVVDRVLYEQGIHKDMALRRAKAIMTIGGIFKAVEADESDDERRELERLVMNAGKKKK
FT                   EEKEKKGWFSRSHAHKPEATTPDKEEGPKVTA"
FT   gene            complement(811892..812800)
FT                   /locus_tag="CNA03093"
FT   mRNA            complement(join(811892..812168,812261..812800))
FT                   /locus_tag="CNA03093"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(811936..812168,812261..812498))
FT                   /codon_start=1
FT                   /locus_tag="CNA03093"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIG7"
FT                   /protein_id="ALO60318.1"
FT                   /translation="MLADNLNHSFNPISLGGTFLLLAPRLVHSQPLNDWKNKLIKDLTQ
FT                   PLETRGLLSRGDESYSEKAEGWCNDNPSECKAVVSTLSIFGLFLVIFVLFKCYRRRKRR
FT                   QAVARDSLEQTEAKAAQDALEQRVEERFFHRQREMKLRHDMEMLGLSNDKGK"
FT   gene            complement(812976..813720)
FT                   /locus_tag="CNA03095"
FT   mRNA            complement(join(812976..813278,813330..813386,
FT                   813438..813720))
FT                   /locus_tag="CNA03095"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(813118..813278,813330..813386,
FT                   813438..813606))
FT                   /codon_start=1
FT                   /locus_tag="CNA03095"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHW4"
FT                   /db_xref="InterPro:IPR013963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW4"
FT                   /protein_id="ALO60319.1"
FT                   /translation="MSRPSIEMNLPPSLLNFYQKQQEYAGLQALREASADLVARAEKLA
FT                   EMSNIMADGGEAIGGVLRNWPHVFSILSLFTAQMEKASGDHSRQEDEDEEPLPCLVRLA
FT                   YGGETASVESSAPTTTTASDKTKQ"
FT   gene            813868..818294
FT                   /locus_tag="CNA03100"
FT   mRNA            join(813868..813982,814033..814090,814153..814210,
FT                   814274..814368,814425..814531,814585..815358,
FT                   815415..816933,817002..817484,817550..817632,
FT                   817699..818294)
FT                   /locus_tag="CNA03100"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(813930..813982,814033..814090,814153..814210,
FT                   814274..814368,814425..814531,814585..815358,
FT                   815415..816933,817002..817484,817550..817632,
FT                   817699..818248)
FT                   /codon_start=1
FT                   /locus_tag="CNA03100"
FT                   /product="single-stranded DNA specific
FT                   endodeoxyribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40919"
FT                   /db_xref="GOA:Q5KPE3"
FT                   /db_xref="InterPro:IPR001044"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE3"
FT                   /protein_id="AAW40919.2"
FT                   /translation="MGVKGLWSLLNPVARPVQIESMEGKRLAIDSSIWLYQFQATMRDK
FT                   DGRVLVNAHVLGFLRRINKLLFHGIKPVFVFDGGAPALKRSTIAERKRKKTGAAANHAK
FT                   VAEKLFAAQMRREAVKAAQVAQEQKEAKASAEAAAEYARRYPDEAGEQIAEGAVYLEDL
FT                   EGRAGPSRPRSPGPAQTEGVDPSAVPTDPEKRRKYFKKHDPYRLPAAEMPTVSTSDRPD
FT                   ARLATEEELKQFIDEVHPEDIDIESAEFRALPTEVQYEIIGDLRIRSRQQSHRRLADML
FT                   RAAPTPLDFSKAQIKHLSQRNALTQQLLTVTDMVGKAHLTIPVRIAAERNREYVLVKKD
FT                   ETEGGGWALGIREGSKEKPIEVEPAEPKTESEHESDIEPLSPPPQAAMDQDLREYRRQQ
FT                   VLEAIAARYAPKRQARAPLDVAVKPFGPSRTASSKPLFDVDGEEEEGEEEVVPTANDEA
FT                   LALALQQEELGDDETEVDEDLAKALALSRREAERKSRSENEGFRVVDVGKDELTEEEDG
FT                   DMEEVELVPSGTVTPAQVDIEAEDSEDEDEFEEVDTPSTTLSSSRVSLGASIAPGMETP
FT                   EIVTIHPNSTRMIDPIVMDDDDDDDDDKGEPLVMSMFKEKRASVYLPPLASDLPERAAQ
FT                   SSGEQAPPAITSRSQISQSTAVPVRPKALQKLNSAVNVPSPLRNVAQPKSSPKSSPISV
FT                   DDVSVPAGAPDLPFTVEATDPTEIRGAPSPDMIPPRSPPSPELYGSGSLERPHFLERPS
FT                   PRSPVMYNEMDDEDGSEADEKDETRSTYSWSPSPTPPPRPLRTTESDVSLNTVASPSPA
FT                   LIAAPRDDDEDDGDLAPADVAAESDDYARFVASIKNRDLNEVRGEIDDEIRVLNSENRV
FT                   AMRDSDEITQSMIAQIQTLLRHFGIPYITAPMEAEAQCAKLAQLGLVDGIITDDSDVFL
FT                   FGGVQCFKNIFNDAKYAECFLLADVERELMLTRERLISLAYFLGSDYTLGLPGIGPVMG
FT                   LEILANFPGERGLYDFKEWWGRVQKGNDTEEESGTKWRKSFKKRFLKSIYLTADWPDPL
FT                   VREAYLYPTVDESEEPFHWGFPRLSALRTFLHEELSWSISKVDDELTPIVQRISLRGKH
FT                   GALNKQGTLDPFFDMSAGAGHYAPRKRGMNVSKRLMGVIKQFKEAEIRMSKGEDLDVDA
FT                   ILADEEKEKKRKAKGKRKMDEKEAGDDEKEEGRNSSSNKRKKTSARGRRRAGTASSVGD
FT                   SVASSEGGSRSTSTSGRGRGGSRARGRARGKGQE"
FT   gene            complement(818337..819109)
FT                   /locus_tag="CNA03110"
FT   mRNA            complement(join(818337..818524,818605..818682,
FT                   818769..818863,818943..819109))
FT                   /locus_tag="CNA03110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(818366..818524,818605..818682,
FT                   818769..818863,818943..819090))
FT                   /codon_start=1
FT                   /locus_tag="CNA03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40921"
FT                   /db_xref="GOA:Q5KPE2"
FT                   /db_xref="InterPro:IPR008699"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE2"
FT                   /protein_id="AAW40921.2"
FT                   /translation="MFAPALLRTARPAASRIAPIASRLASSSTKLTIANENFPLPTGEE
FT                   VDPQLNGYPQLPNVSLQNRYPFGWWDIQERKNFGEVVHESEDVLGMWGPDVHKTSWQSA
FT                   LLQLCTAFGLVGAVSYVLIKTRPERPVTARDYPYGGLEKELGGINVARKEQVDEE"
FT   gene            819487..821708
FT                   /locus_tag="CNA03120"
FT   mRNA            join(819487..820865,820935..821082,821203..821708)
FT                   /locus_tag="CNA03120"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(819687..820865,820935..821082,821203..821465)
FT                   /codon_start=1
FT                   /locus_tag="CNA03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40923"
FT                   /db_xref="GOA:Q5KPE1"
FT                   /db_xref="InterPro:IPR039467"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE1"
FT                   /protein_id="AAW40923.2"
FT                   /translation="MPPPSGEIRRKAPRRRRIPAASTEASKKKRAGKIPGTAASTPQAA
FT                   SDDDSVSQAGSKRAASVLDDDDETSLAGSVSSSRAGSLAPGRAKRAKTSRGPRVATIAL
FT                   TDVEPEEMVGSPVTEEMTMGDLATVLVSEGRVSSRAIKIDEFRRAEMLKKKEVAQKRAE
FT                   ETWKRNQIKRRKVRAAQNKDRAKRREEIRKQGGDEKDVSPDEMDSDEEFEVAPERLTPP
FT                   RSSSEEAGERAAAGFGQGDEEDGAVDSDVQDVAVDNGPLDEEDQAFENMFGDNARPNSL
FT                   APEDNAVIANEEEEDAATAALRAAGFTVTDDPVSPRSNDDGWGGPGGAEEFDVADYRLA
FT                   LQEKRLREFREREEEDGDVVEVDDETRFVNSATYGKNRKSQRWSKMETELFYEILGETG
FT                   ENYTLMKAYFPGRDIRSLRLKGARENKVNPEKMTAAIMARKPLDKDYLAKSAGYDASRS
FT                   WDKEEALFEEAKADVERLRKLDSEQPLGKDVEDLDEQSGDMMEADDDDGLQRIEEMDVE
FT                   EEEGKSEDGNDE"
FT   gene            complement(821630..823910)
FT                   /locus_tag="CNA03130"
FT   mRNA            complement(join(821630..822158,822232..822278,
FT                   822335..822643,822701..822945,822999..823173,
FT                   823242..823274,823379..823447,823507..823910))
FT                   /locus_tag="CNA03130"
FT                   /product="RNA polymerase II transcription factor, putative"
FT   CDS_pept        complement(join(821812..822158,822232..822278,
FT                   822335..822643,822701..822945,822999..823173,
FT                   823242..823274,823379..823447,823507..823757))
FT                   /codon_start=1
FT                   /locus_tag="CNA03130"
FT                   /product="anon-23da protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40935"
FT                   /db_xref="GOA:Q5KPE0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPE0"
FT                   /protein_id="AAW40935.2"
FT                   /translation="MDPAFHPPFSLPNLYQTLPFGTCCAIFILWAVHHILCQRYAPITI
FT                   TGPTRREEVGAHGETTEELVHKWCKSLKEGFTASWWLPNGHAQTIYSGLADFSMDDHVT
FT                   YQRQLLRLPDGGTIGVDVYPPLTTELADDAPVIVVNHGLTGGSHESYVRNLVVWLTKPI
FT                   AEGGLGGRAAVVNFRGCASTPLTSPHLYCSGNTIDNHTATTYLASLFPDAPLLGVGFSL
FT                   GAAVMTRYLGEQGDKSRLRAAVVLYCPLELKAMSAKLDSAHLFPRLYSLTMARKILKSI
FT                   SPHLLPPSPLSSPSSPLHVNIPEILSLSSSVKYKWTLRASKVTELVVTKVGGSAPCFPF
FT                   EGMDQFLEWACPSGWIGRIKRPTLAISALDDPIVSGDCLPYSAVRASSHMILAGVAQGG
FT                   HLGSFDSPSPFGPDRHRRWHVRPTIEFLRGVIKDLPKSASEQKLGRVQVEEREDGWSWA
FT                   GEVGWKLVGEEEECGWVGNGICESEMDGAGASV"
FT   gene            complement(824566..829205)
FT                   /locus_tag="CNA03140"
FT   mRNA            complement(join(824566..824865,825009..825118,
FT                   825169..825328,825383..825531,825588..825691,
FT                   825760..826444,826501..827908,827963..828084,
FT                   828143..828471,828571..828630,828982..829205))
FT                   /locus_tag="CNA03140"
FT                   /product="protein phosphatase 2A regulatory B subunit,
FT                   putative"
FT   CDS_pept        complement(join(824660..824865,825009..825118,
FT                   825169..825328,825383..825531,825588..825691,
FT                   825760..826444,826501..827908,827963..828084,
FT                   828143..828306))
FT                   /codon_start=1
FT                   /locus_tag="CNA03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40936"
FT                   /db_xref="GOA:Q5KPD9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD9"
FT                   /protein_id="AAW40936.2"
FT                   /translation="MAETGVQHFLRNAPNNGDTDNPEKSSACPVLPDNQQPVFEFEKPS
FT                   KELRISCDTCRIKKIKCPGERPTCRNCEQKGRPCTYPTAVRRRGPDKNPGARMKNKVQR
FT                   AKQSRKIQGRDEDPSQSTSLTKGIDLHQLASPPPKLLPKPPTHDIPIAQDAQETRLHLI
FT                   TQRLPILSQSPPISVPPQPSDQSTLHSTVGFRSSDSISSTLFNPESSKDMLLAQTRPLH
FT                   VPKATPSLSVQSLGPQPLQSIIDQAITPEIEHLALNTQSQLIPQSDPSPTEPSGQSLFN
FT                   LTQQQFQQKIPLRVTPLPTYDQSSFIPISAIPQDVATYNFFSAEANLSDTTKREPQAFF
FT                   AHTDLVNIGSAPSQSPFLPNHTSLCDSSSLESLFSPHITKSDINSCVKRPETNTGVETW
FT                   DGQPSSRGTEIAGLLPVKDVAIADGSLTCDQLPYATAGGTTGFSSLALFNDGLVQPSEG
FT                   PYGLSQIRDTKDGISKTVPAWNGFPPGSLDQSYVPFTATGILTQGVHSQDLKRKAEDPP
FT                   PEESEYEIYTPPGNIQAAMDGWWNWILAHYDKDKHTAMQSVVRACNSFFANAHIWLNFF
FT                   NKSLFFSSLFSQASDSNTLEYKATSLRAAPHVLLSILSLVTLLQKGHTPEGQQLALLFQ
FT                   REAQSILNYCISAGSQDPSLVAAAIVIATFEMQPHVEHTTDRLVAAVLMLDGIGLSVFS
FT                   SRLDADDVRVSTSITGLPRLTHSNVLATTAREREVQLEPSITKWAQVPAWANHWSAGDI
FT                   WKEEMRRMLWAASSISATLSLWLFMVGKSSYNLEISHPERFRLFFPGEMAVIEAGDGEQ
FT                   GKTTPWALYHRLISLWHFIVNNQPLNGVCKLDVVRELQAVEDDIQIFIDAGVLKIYIWQ
FT                   SADWAMFIRRVLGVMDSQALRRWFRNEITFFKALAGDRPGVPGVRQRPLYAWWYVMQVS
FT                   SALELSRMRKEFWEDSDLIYNMTLAGLDQVIKYWNCQNVLGPYFVYLQHKYRTVLEERQ
FT                   RLLHAEAQGRVQDLYLEQLKILRAEAEGQFAKIQNISEYRNSKLYY"
FT   gene            831531..833123
FT                   /locus_tag="CNA03150"
FT   mRNA            join(831531..831586,831675..831881,831935..832193,
FT                   832246..832800,832857..833123)
FT                   /locus_tag="CNA03150"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(831759..831881,831935..832193,832246..832800,
FT                   832857..832933)
FT                   /codon_start=1
FT                   /locus_tag="CNA03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40937"
FT                   /db_xref="GOA:Q5KPD8"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD8"
FT                   /protein_id="AAW40937.2"
FT                   /translation="MRLPLDIYLDDTRSSATPSLYSPSDSEEERNSAVLTSRSQRLPTS
FT                   KQRRASNVSRKRRREKSSSEDVFAVEHILARSLSKWRNPESNKYEYRYLVRWENYQPKD
FT                   DTWEGRSGLMEGSKQLLEEFENRGYQPFTILASKSAASKPTMYLVRYGVVSDSILPSPL
FT                   YEKVWHSASQINRVGGVPKAVVKNAIDKYEETERLEEGKGLARGGSPRTLQLQKDRCIL
FT                   DILERKEEGDEDPPTVIFHVRWRDKWKLKEEWMNYERIVFTFEEDGKQFLMKWEEKRGY
FT                   VKPTKVTTVRLVEKPDNMKRPATSSHAKERQPMTEYELERLKNIEANKELMRQLGL"
FT   gene            833732..836275
FT                   /locus_tag="CNA03160"
FT   mRNA            join(833732..833774,833825..833885,833946..833998,
FT                   834056..834068,834124..834189,834244..834347,
FT                   834402..834571,834621..835831,835881..836275)
FT                   /locus_tag="CNA03160"
FT                   /product="heat shock protein sks2 (heat shock cognate
FT                   protein hsc1), putative"
FT   CDS_pept        join(833846..833885,833946..833998,834056..834068,
FT                   834124..834189,834244..834347,834402..834571,
FT                   834621..835831,835881..836068)
FT                   /codon_start=1
FT                   /locus_tag="CNA03160"
FT                   /product="heat shock protein sks2 (heat shock cognate
FT                   protein hsc1), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40938"
FT                   /db_xref="GOA:Q5KPD7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD7"
FT                   /protein_id="AAW40938.1"
FT                   /translation="MSAEDVFEGAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSY
FT                   VAFTEGERLIGDAAKNQSAMNPLNTIFDAKRLIGRRYDDADVKKDMKHWPFSVIDKDGS
FT                   PYVEVDYLNEKKTFSPQEISAMVLTKMKEIAEAKIGKTVKKAVVTVPAYFNDSQRLATK
FT                   DAGAIAGLEVLRIINEPTAAAIAYGLDEKTEEERNVLIFDLGGGTFDVSLLTIQGKVFS
FT                   VKATAGDTHLGGEDFDNNLLEHFKAEFKRKTKLDISDDARALRRLRSACERAKRTLSSV
FT                   TQTTVEVDSLYQGNDFSSNITRARFEEINAVAFKSTVDPVEKVLKDSKIPAAKVDDIVL
FT                   VGGSTRIPKIQSLVSEYFGGRQLNKSINPDEAVAYGAAVQAAVLTGQTSDKTADLLLLD
FT                   VAPLSLGVAMQGDVFGVVLPRNTPIPSNKSRVFTTVEDNQTTVMFPVYEGERTQCKDNR
FT                   LLGEFELSGIPPMPRGQAELVCTFEVDANGLLKVSAQDRASGRKAQITIQNSVGRLSSE
FT                   EIQAMIKDAEQFKNADKDFSARHEAKSDLEAYLHTCEQSISAPELSMKIKRGARAAVES
FT                   EIAKALEKLEQEDATADELKKAQLGVKRAMQKAMASAR"
FT   gene            complement(836319..838137)
FT                   /locus_tag="CNA03170"
FT   mRNA            complement(join(836319..836601,836663..837207,
FT                   837281..837454,837522..837899,837976..838137))
FT                   /locus_tag="CNA03170"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(836427..836601,836663..837207,
FT                   837281..837454,837522..837827))
FT                   /codon_start=1
FT                   /locus_tag="CNA03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40939"
FT                   /db_xref="GOA:Q5KPD6"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD6"
FT                   /protein_id="AAW40939.1"
FT                   /translation="MSDLPLPQFYAHSLVPLAPIFDDTLSLSSPEAQSTLSIALDKLYL
FT                   IQRMLTSLGAFSENESVSEASNGQLLFMSIGWAIGSCEEKRNPGSMPERREALLKAEYA
FT                   FQAFVELLSSYGILSSQEASEYSVGNRAGLPNDPAKRREAKINQYKKEKELREKINAAI
FT                   SRRKQVSASTPVSFLISLLPEPPAEASTVQSTQARDVNEDDMAEESRETIINVLRLLYS
FT                   LALSSMASMKMELDILSSAPPVDPSQGIPHTDLRQGGRGENDDTWRLDQLPTSLARSSD
FT                   LISSKGKVLRPFTILPSDTGVAQREKLKAGVFKQSWRLPTMTIDEYLDIERQRGNVITG
FT                   GGQASYDKPTDSELLELDSEMDGTLHAEQQAEHKREKDEKWAQYTDDNPKGYGNTTNKG
FT                   "
FT   gene            839316..842782
FT                   /locus_tag="CNA03180"
FT   mRNA            join(839316..839735,839935..840717,840781..841817,
FT                   841876..842083,842152..842782)
FT                   /locus_tag="CNA03180"
FT                   /product="expressed protein"
FT   CDS_pept        join(839562..839735,839935..840717,840781..841817,
FT                   841876..842083,842152..842439)
FT                   /codon_start=1
FT                   /locus_tag="CNA03180"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD5"
FT                   /protein_id="AAW40940.1"
FT                   /translation="MTGNCSVPAYSDGPLPNVTDGNHEVLRSMSIGKRKLGLENGTEGR
FT                   MDPDEHGNRGLSEPPSSHTQSTNATMSPHPVLTASSALSMSRGSPYSSTTTTASETRGQ
FT                   HPLAQPPLNANGSNSPSPLPLDFTPIPLAQITNLRKSLSRRRSSYPPATTPGALDSLFS
FT                   WSASGTPKADLSSLLDSLPGLGEGVDGNKGTGWTPGSNAWEQFIDPSSDIVESTDVLTS
FT                   MDSQTLRKLQLSASRVVNAPPAAPQSDEAKGNSAPAAPQLSNVLRPPPPTPGKRNIQQS
FT                   HESEWRSALASVIQIDGVGDVPVLKILQEVWKRGGGDSVTALCLWPSIIVALAIPADSG
FT                   PDFRVPNPSAQSAMSLQQLYNLTIRHWEPAIFSGLLGHFASGNMPSPAALPADRAFQSQ
FT                   HYGPSTPMRDTDLSQWINLTPGAWSAQHDPFIGSTGQSNLFKPQAPEDAGFPFPLTSGL
FT                   KAGEKAEDVGRKSLANGVAEEDQMGQSIAEILARMEEEQDGDGPVSVAEDEIQTHSQPS
FT                   RMSFTELGSQRLNPVDQSFHLPTPETTSSESPNNHNAHNNKIAFSPPTSMSSPFVSAGS
FT                   TGSVVPTNNESGPGPTKCSAHVKTRPTQVPIPPVDFIPPPPMCMFFNPSFENLQDGKSG
FT                   VWRGDLEVRGRGGGKFSVLVIGESGMDHLWQSHLWPQSLSYPLKPNNSDECYTSSMIPV
FT                   SHLAREGLVPITMGMVLCNEPADRIDPYVKMVHGLHAEGVAFHLPCENPRLPVVFLPTK
FT                   FHANDPLLRLGVAFMGKAGLPYPSAPLSAPRARRHTYDLGATSREEPKNKKRRQSASTG
FT                   IKPKSGSRRNSKEKEGQ"
FT   gene            842925..844003
FT                   /locus_tag="CNA03190"
FT   mRNA            join(842925..842947,842993..843130,843181..843358,
FT                   843413..844003)
FT                   /locus_tag="CNA03190"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(842930..842947,842993..843130,843181..843358,
FT                   843413..843963)
FT                   /codon_start=1
FT                   /locus_tag="CNA03190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41418"
FT                   /db_xref="GOA:Q5KPD4"
FT                   /db_xref="InterPro:IPR019166"
FT                   /db_xref="InterPro:IPR033181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD4"
FT                   /protein_id="AAW41418.1"
FT                   /translation="MASPAARLLRAPRVPAAVLAASLAVSSADLAADDGAAPSSSVRPG
FT                   RSPSGEKLPIYPTPQHNPAITLVETHNPLVPYITQSRESVSSVLGDARNYVQSGVSKWI
FT                   TFERSVEREVKSVLPPDEALNPGLIYVLVAGLSGSVLSRTRSLPVRFLAPPLFTLLAFP
FT                   YFLPKTSHNIRQYLSNLEDKHLPEFAAKHDHFVQTGIAHWGMLWGRIEDATGDAREWGH
FT                   RAVEGVERTTGLRLGEAVSKVEKEKERLVEQERQRAVAVPAQKYETVGYVVEQKPVAEI
FT                   VAPMEPPKEKKLV"
FT   gene            complement(843942..845039)
FT                   /locus_tag="CNA03200"
FT   mRNA            complement(join(843942..844133,844186..844287,
FT                   844341..844598,844664..844729,844776..844802,
FT                   844855..845039))
FT                   /locus_tag="CNA03200"
FT                   /product="ubiquitin-dependent protein catabolism-related
FT                   protein, putative"
FT   CDS_pept        complement(join(844020..844133,844186..844287,
FT                   844341..844598,844664..844729,844776..844802,
FT                   844855..844998))
FT                   /codon_start=1
FT                   /locus_tag="CNA03200"
FT                   /product="ubiquitin-dependent protein catabolism-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41419"
FT                   /db_xref="GOA:Q5KPD3"
FT                   /db_xref="InterPro:IPR035269"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040815"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD3"
FT                   /protein_id="AAW41419.2"
FT                   /translation="MPQELVFPPPEEPSILSLPLPHAEAYPGEPREYALALIQRKDAIQ
FT                   KEIDVLNDVLSSHGATASTSLLDNEGYPRGDLDIYAIRHARSSLVRLQNDRQTVTDLLA
FT                   TALHDAFAISSPASEQQPNGSVSLPSSQANGYSARTRETPWPARAIAKVNTVTVNSPAS
FT                   EAGLKAQDVIYSFAGINHTSPGGLQAIGTAVAQSEGIPLPLLIMRGQERLQLTLTPRSG
FT                   WGGRGSLGCHILPA"
FT   gene            845175..846896
FT                   /locus_tag="CNA03210"
FT   mRNA            join(845175..845296,845353..845616,845686..845749,
FT                   845806..845812,845869..846062,846131..846896)
FT                   /locus_tag="CNA03210"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase, putative"
FT   CDS_pept        join(845217..845296,845353..845616,845686..845749,
FT                   845806..845812,845869..846062,846131..846598)
FT                   /codon_start=1
FT                   /locus_tag="CNA03210"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41336"
FT                   /db_xref="GOA:Q5KPD2"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD2"
FT                   /protein_id="AAW41336.2"
FT                   /translation="MASQLPFTRLVQETQIGILSVLRACYLTKNVQDTLVTKDTLLKSD
FT                   KSPVTVADLSAQSLISLHLLAHFQDPIIGEEDTSELRVNEPLRQRVVGLVNGGFEKEEG
FT                   WGKDKTFSEDEILSAIDAGSAKGGNKGRFWTIDPVDGTSGFIRHQQYAVCLALIVDGVV
FT                   ELGVIGCPNLGPEPAKIGEEIIPNGKGVLMVAVRGQGSWSRPLDSATYTKLNLPPTPPA
FT                   SNPLTFLESVESGHSAHSIQARIGALLDVQRPSLRMDSQAKYTCLSRGEGGVYLRIPTK
FT                   YVGGKIYEERIWDHAPGALLIHESGGICTDMWGKELNFGVGRTLKENDGIVAAGKDIHP
FT                   KAVEAVKKAIEEAQVENK"
FT   gene            complement(846209..848092)
FT                   /locus_tag="CNA03220"
FT   mRNA            complement(join(846209..847026,847094..847647,
FT                   847702..847827,847885..847909,847976..848092))
FT                   /locus_tag="CNA03220"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(846664..847026,847094..847647,
FT                   847702..847827,847885..847909,847976..848026))
FT                   /codon_start=1
FT                   /locus_tag="CNA03220"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD1"
FT                   /protein_id="AAW40941.2"
FT                   /translation="MDSDLRLDEIKCGSASEIMMAVRYSTSPPGPTFIPSLDDVLLEYR
FT                   PHDGHSSLRRGDLIELVGPSGSGKTTLLTFLLMITLLPAVLPPPLSTVVLGGKGGYAQV
FT                   FQPYTHRPIMLSLRRSIEAHIRSLAPEAQDDLIEDVIKESTSRLSVWRGRPRWKDLALG
FT                   LKGIVVELSPYPARSERRPGALDLVAIDGFADGYYPHLWADEERGRKQHGDGANIVGPD
FT                   ALGVRQVMEVIGQIRKDLGSVVAISVQGLRTTRETQPFYLPHLPTPYPNPFSISKSGPV
FT                   SRSNPTYWPLNIQITLLGRARGLQLPGDITLIDALRSKAREKKENGEVGQNGKYEGLVR
FT                   LVNMDGGILGKREGAKFHFHIGENGLQVWTDP"
FT   gene            848246..848341
FT                   /locus_tag="CNA03230"
FT   tRNA            848246..848341
FT                   /locus_tag="CNA03230"
FT                   /product="tRNA-Ala"
FT   gene            complement(848588..851241)
FT                   /locus_tag="CNA03240"
FT   mRNA            complement(join(848588..849602,849662..850790,
FT                   850848..851241))
FT                   /locus_tag="CNA03240"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(848844..849602,849662..850790,
FT                   850848..851008))
FT                   /codon_start=1
FT                   /locus_tag="CNA03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40942"
FT                   /db_xref="InterPro:IPR024771"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPD0"
FT                   /protein_id="AAW40942.2"
FT                   /translation="MAALGPSAPISAVPTSKFQRMLVYKAAEWYGLKAVAGPEASMVVG
FT                   VLGPLNEKSATLRLSDLVPAAPSPTQKFRIMQRAPAPGERPDLAASSDAQSTADGRASK
FT                   WKTLEEREAAYAAAREKIYGKGGDVEESPSISKTEGEPPSRAAAALEDDIDPVPRRRYP
FT                   AGGQFEVVYPSLYHPPKGSHTPSPAPGMADQYQQNPYGYQQAMGYNYQMDMNGYPLAGQ
FT                   MPSGYTQQQRQPQQGFAMQSYMDSQYNMSQQQAYTVPGWQPQAGGAYPQMTPNQQYSLM
FT                   QAQQSGQWQYQQMVSQPMPMIPQGMPYPAGPAFGYPSQPLQPQLQPPQAVRPAMYPSLV
FT                   QPSPQRPLPQPYSSASSSISSHSYHDGSRPHSRGSTTSTKSAASSVRLGAMYPAAQGPG
FT                   AGYRQKGMKQQGLNGMTSLGTEDKRTRGHSPSQSSTTTTASSHSSRRTSSINVPPPSQH
FT                   QLPQRPDWAANNVPYHPSPIIPNPSISDASAHQAIALGPNTAEFPPLLRSSTAAEPMQV
FT                   ERAKMRPMNGGGVWNGAAPSASMSNPLLPGQVVPSAEPRVSILPCPRAHSDTQIPQCQP
FT                   PQSNNDDPDFPRRAPCKTAPTLYDPSAPRLAVSQPVSQGSRPSSPGVNQDDTAFAGEAD
FT                   RGQGLLSPEEVIEAKLAAVSLSAGVSIGPPPSKQPQTASYAKIVQRD"
FT   gene            complement(851505..853175)
FT                   /locus_tag="CNA03250"
FT   mRNA            complement(join(851505..851725,851776..852240,
FT                   852300..852747,852844..853175))
FT                   /locus_tag="CNA03250"
FT                   /product="hst3 protein, putative"
FT   CDS_pept        complement(join(851628..851725,851776..852240,
FT                   852300..852747,852844..853002))
FT                   /codon_start=1
FT                   /locus_tag="CNA03250"
FT                   /product="hst3 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40943"
FT                   /db_xref="GOA:Q5KPC9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC9"
FT                   /protein_id="AAW40943.1"
FT                   /translation="MPPSLALDHLLCSTDHADFSARRQLSDVSIAVAKARRIVTVSGAG
FT                   ISCSSGIPDFRSEGGLYSLVKEKYPDAFFTGKDLFSAGTFANPQSTSIFYTFIAELFHC
FT                   CASAQPTRTHHFIRKLEQKGKLLRSYTQNIDGFERRMGLESGGRGKGLKKKETRNVELH
FT                   GDLGRVRCVLCFSDFEACDEWVEMFREGEAPDCPACWKRCESRINRSARATSVGRLRPS
FT                   IVLYDEPHPLGDDIGQLTAYDVSRRPDLLLIMGTSLKVHGLKRLVKDFAKAVHGGKKRG
FT                   LVVFVNATPPSKEWEGIIDVHIEGETDKWVEKVEEEWRRVKPGDWEVQTTLDSEVVSVV
FT                   KTGKPKGKTKAATPKGKALAKRDTNRLSPPPRLKASLRSQAIAASSETS"
FT   gene            853475..853569
FT                   /locus_tag="CNA03260"
FT   tRNA            853475..853569
FT                   /locus_tag="CNA03260"
FT                   /product="tRNA-Ala"
FT   gene            853611..855354
FT                   /locus_tag="CNA03265"
FT   mRNA            join(853611..854111,854170..854291,854355..854462,
FT                   854581..854703,854761..855354)
FT                   /locus_tag="CNA03265"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(854627..854703,854761..855040)
FT                   /codon_start=1
FT                   /locus_tag="CNA03265"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHY1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY1"
FT                   /protein_id="ALO60320.1"
FT                   /translation="MSRPAFFCGMIFITPLTALSYLFTSTTASIIYIALSWDLKRRASC
FT                   MAKCSGSTTFVAKNQTSPIRGFFDGIITNASRLVSGVLLLGWSHQALVQQFRQTHLHKA
FT                   QYPKEHVLAEELTY"
FT   gene            855458..855550
FT                   /locus_tag="CNA03270"
FT   tRNA            855458..855550
FT                   /locus_tag="CNA03270"
FT                   /product="tRNA-Ala"
FT   gene            855950..859042
FT                   /locus_tag="CNA03280"
FT   mRNA            join(855950..856710,856759..857382,857435..857746,
FT                   857798..858058,858110..858233,858291..858324,
FT                   858390..858538,858599..859042)
FT                   /locus_tag="CNA03280"
FT                   /product="transcriptional activator gcn5, putative"
FT   CDS_pept        join(856030..856710,856759..857382,857435..857746,
FT                   857798..858058,858110..858233,858291..858324,
FT                   858390..858538,858599..858795)
FT                   /codon_start=1
FT                   /locus_tag="CNA03280"
FT                   /product="transcriptional activator gcn5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40830"
FT                   /db_xref="GOA:Q5KPC8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR037800"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC8"
FT                   /protein_id="AAW40830.2"
FT                   /translation="MAPKQRRATNSKAKATPTSVTSPPDQSSPVRSRGGSSSLSPIRSP
FT                   QENSDLEDNNERHPGTNGSGLKAEDEGSTDLLDRDGDLEEVHACPDSITFRYPSSVPDF
FT                   TILSPREKAFKVARFLHCTAPSCACTGLEPPAGRTIRITKHDSSNEDEDDEDEDDDVSM
FT                   EDSENPLDFEDKKDEWRTKEGWWRICGKCGHGWESGGHVWADDVPPKERTRRGKVVGRI
FT                   EEILEDENKLVEFPTPQPESISSLLKQLHEFVPPPAGKTTISALPPPVDLSTPDDDTQE
FT                   DNSDGERPRKRRRQASESTHSDIEGEQHRGQGKKKQGKGPAKGAKPRVPRTVVRGAHGF
FT                   IPMATDPDGNQHVEGHLPISAGGTGADETFEEEEEEEEELSTAKRPELDETERRRRTEI
FT                   KVKEKEREEELVSRLAAGVNPEDAGGAVEIWEGIELQKLPLRPAAIEQANREIMLPVVS
FT                   SRNPTPVATILLVGLKNVFQRQLPKMPREYITRLVLDKNHISMAIVKRGYRVVGGICYR
FT                   PFEARGFAEIVFCAVDSSEQIKGYGSHLMNSLKDHVRKAHPTINVFLTYADNYAVGYFK
FT                   KQGFTKEISYPRERWVGYIKDYEGGTIMQGRMLPKVKYMEVHQMLADQKAAIIAKIKTL
FT                   TKSHIIHPGLQIFKERQPDEEIKLTKEQVPGLAESGWNPDLDDIVRQPKRNPYHVLLQH
FT                   VLNDLQNEPSAWPFVKPVDSSVVADYYDVIKDPMDLSTMEYKLENNHYESIEGFVADVK
FT                   LMCANCRQYNGEKSTYTKQANLLEKALDRILKKRKSVLAD"
FT   gene            complement(859293..861534)
FT                   /locus_tag="CNA03290"
FT   mRNA            complement(join(859293..860196,860247..860442,
FT                   860494..861123,861176..861219,861256..861534))
FT                   /locus_tag="CNA03290"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(859417..860196,860247..860442,
FT                   860494..861123,861176..861219,861256..861354))
FT                   /codon_start=1
FT                   /locus_tag="CNA03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40832"
FT                   /db_xref="GOA:Q5KPC7"
FT                   /db_xref="InterPro:IPR009686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC7"
FT                   /protein_id="AAW40832.2"
FT                   /translation="MSVSPHKSGTFSPVSEGVEAYVLLTIDHANVKQVFEGEEMDLAKG
FT                   QLSVQCVSLPIPPEIGHQTANPFAPSPSDPPVPTQDFWLVLHVGATFELVATPGQMFKP
FT                   YVQGDKITYEMTSKDIPGASLLFSTPYPTSGSDLESLQSLESLLHQYGCLAPETTALSG
FT                   ISTARNTGQPSQTAPDELRGKLVLVNEDNGEIIGEMDQQLELQEDSKIAQESKLNPVVL
FT                   DFEQFREGQEALRVKVKTIPEKDLDDWLLRGANSLSHGILSFGEWTSRQMLSGADLYIK
FT                   NTTPRTEPVQFGPQTKEGFLKVHSASVKTATVTKSTLNRLHGVIQGAVEKTYTHGFQPA
FT                   KDAYQRYNRSTPPLPPRPSQNSMDKPNIPPSRPIGDSKATDLTSSLPPDAPGALSEGKA
FT                   IDYPSHSQSLIAEKETLNPPSYETSQQKEAQQQSTSMVAAGDQPKKKQGLLSRVVLASE
FT                   VVLTSLEATAHDVLNSGTVAASSAAGHKFGKDAGELTALIGGSVKNVAVVYIDVAGTGR
FT                   KAILKSTAKGIIKTRLQSGETVELQAEGQGNGMKAGEAESKNGDIVVGMAELGTQTSGT
FT                   LTPSKK"
FT   gene            complement(862472..864877)
FT                   /locus_tag="CNA03300"
FT   mRNA            complement(join(862472..862916,862986..863234,
FT                   863283..863412,863462..863684,863747..864005,
FT                   864048..864217,864278..864877))
FT                   /locus_tag="CNA03300"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(862592..862916,862986..863234,
FT                   863283..863412,863462..863684,863747..864005,
FT                   864048..864217,864278..864502))
FT                   /codon_start=1
FT                   /locus_tag="CNA03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40834"
FT                   /db_xref="GOA:Q5KPC6"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC6"
FT                   /protein_id="AAW40834.1"
FT                   /translation="MWTNVLSVFIFATFFARSTRALSSWYTEPGGTPTGSVDGDKVRGV
FT                   NLGGWFILENWMMPSFFEESIVRDTYLNDEWSFCLVLGQDECLARLQQHWDTYITEDDF
FT                   KRFANYSLNTVRIPMGYWAWTTPEDYEPYIQGQLPYLERALNWSSWYGLDVMMDLHGLP
FT                   GGANGQDNQGYKGPIEFQLNSTNMDRAMEALANMTQYVTAEKFDGVVKAIELTNEPYIL
FT                   EYSSRGMDFYTLADFYVKGYQVVRANENIIDGANEVMVVIHDAFQPLLNWKYFWGEESL
FT                   GLNWTNYALDTHIYDAFGGADQKSYQEHLDTICALSASIAEAQQYFPVIVGEFALGVNT
FT                   YCVDYQSCWGLTMDEVIANFTSTYEASLFLRQFWEVQSDVYELGAGWIFWSVHHELAGP
FT                   WSWTQSAAQNWIPMDPSEKIWPFDSDASSYCLDTFNPLEGDQNLPYFPLYANNYTNIDI
FT                   SSVKPVRLNVNPASNSTVASATSSSTTSSSQSSTASPSSSSSESGSFYTAPLPSSLVLL
FT                   LMVVAVSHL"
FT   gene            865129..867534
FT                   /locus_tag="CNA03310"
FT   mRNA            join(865129..865608,865657..865941,865988..866380,
FT                   866430..867166,867225..867534)
FT                   /locus_tag="CNA03310"
FT                   /product="protein-nucleus import-related protein, putative"
FT   CDS_pept        join(865170..865608,865657..865941,865988..866380,
FT                   866430..867166,867225..867500)
FT                   /codon_start=1
FT                   /locus_tag="CNA03310"
FT                   /product="protein-nucleus import-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40836"
FT                   /db_xref="GOA:Q5KPC5"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC5"
FT                   /protein_id="AAW40836.1"
FT                   /translation="MSSRTRGKRAAVASPQASISAIEPTPRTRRVRRGQPDLEEYEELA
FT                   HSNVEDDGGEEDAEGEDAEDAEEDDDEEFMTVPEPPKRSRGRPKGSTNKRKAPVEDGDT
FT                   DLDQGDEDDETRSKRRGRESVSYKEIPIDDKMDGDEDEASTPAAVTTPRRRGRPPKRPV
FT                   DDDDDDDKNDSSYKKEKIPGGSGRGGFSVKGAAAAAARARWEKVRRERAERGEDDTPKS
FT                   ARRSTGTKKHAVGPPADYKMGATVSIKNEEYTVGDDELIIPDDPKGDTKIDAAGRLLGD
FT                   REYKLVTFTSVERRNPERIYALTIDAARACGYSDSLAFLRRYPTVLKLSCTAGERVKLI
FT                   DLGRISGNLKHRQVTMVAMRNVFKVMGAKVIKNGRHVVDDYYEDEAAAKCAENGIEPGS
FT                   IVQDEEYVPSANVNSERALRSAPGESSRSLAHLSTFYTVGGPTTHFAGNGVDPWTDSGW
FT                   GNKRSRLRTAGVTEEDWMLRTAEEARAVDEQLRKYREERLKLLEGVDAMRGWVFAAENA
FT                   TEGMMGKSEPTGETADVFRAPVPMESKKSGLSHEVTMEDVEDGEQSTSAEEALENEDAD
FT                   VHQAAVEDKEAVIIEEPGKLTSKYNWGLGKSWQPGAVRAAYEPHTNMPHIPLFTQPTIA
FT                   FLAQASPYPVLSSSTGTQHLHFVQSTITGSAARGLASVEYVLETDEDSQTQQRLTMVEE
FT                   AEKWERRMRAKKHVA"
FT   gene            complement(867496..868808)
FT                   /locus_tag="CNA03320"
FT   mRNA            complement(join(867496..867820,867886..868041,
FT                   868092..868321,868369..868406,868470..868808))
FT                   /locus_tag="CNA03320"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(867564..867820,867886..868041,
FT                   868092..868321,868369..868406,868470..868691))
FT                   /codon_start=1
FT                   /locus_tag="CNA03320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40839"
FT                   /db_xref="GOA:Q5KPC4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC4"
FT                   /protein_id="AAW40839.2"
FT                   /translation="MLLPLVRHVSKSLTKQRCFAAWGRTISTTPEPHAYLRPLLSTTAD
FT                   AKLPELDKVMTLMLNRPATKNALTVQMVSEMREALATLNPADSRLLLIQSSNPSLFCSG
FT                   ADLRERRTMSPMQVSNFLDNLRQLLAELEALPIPTVAVIDGYALGGGAELALGCDLRVG
FT                   GDNTKIALPETKLGIIPGAGGTQRLTRIVGMAKSKELIFTGRHVQGPEAERIGLLNIYA
FT                   SSPSSPFEAALILARQILTSAPLALAAAKRAISSAPELSLEAGLDLERAVYNGLLDTDD
FT                   RQEGLKAFAEKRRADFRGR"
FT   gene            869013..870078
FT                   /locus_tag="CNA03330"
FT   mRNA            join(869013..869055,869124..869143,869221..869378,
FT                   869588..869679,869735..869794,869853..870078)
FT                   /locus_tag="CNA03330"
FT                   /product="ubiquitin-carboxy extension protein fusion,
FT                   putative"
FT   CDS_pept        join(869124..869143,869221..869378,869588..869679,
FT                   869735..869794,869853..869912)
FT                   /codon_start=1
FT                   /locus_tag="CNA03330"
FT                   /product="ubiquitin-carboxy extension protein fusion,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40841"
FT                   /db_xref="GOA:P40909"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40909"
FT                   /protein_id="AAW40841.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKQICRKCYARLP
FT                   PRATNCRKRKCGHSSQIRPKKALKK"
FT   gene            870978..872564
FT                   /locus_tag="CNA03340"
FT   mRNA            join(870978..871174,871237..871258,871310..871347,
FT                   871399..871509,871565..871754,871813..872564)
FT                   /locus_tag="CNA03340"
FT                   /product="expressed protein"
FT   CDS_pept        join(871125..871174,871237..871258,871310..871347,
FT                   871399..871509,871565..871754,871813..872475)
FT                   /codon_start=1
FT                   /locus_tag="CNA03340"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40843"
FT                   /db_xref="GOA:P0CO74"
FT                   /db_xref="InterPro:IPR007018"
FT                   /db_xref="InterPro:IPR038566"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO74"
FT                   /protein_id="AAW40843.1"
FT                   /translation="MAQQVEEIEQDLSHIHWSWPEAIAANPARSLATPDLAMDYFAYSP
FT                   FWDAKSNNNVLRTQRRIENPAYGHAEEKVELNAFMSGFEYVVAHSQPPDLFVIHRREVE
FT                   SSGKRDRVTGAWFILHEKIYQCPTLFDVMSTRLKNATSLISKTLSTLSENRPPANPRTT
FT                   TLWRSIPSVTSNQPDGTQPSSLDQAEKPDEGKKDDSLNGSSPLDGSDGKASPAGPDWHL
FT                   FHALQATRASLVSLETLAKTPTQTTDPREELNNIEIAMDNQFGGQNQSLSGKGPNVKGG
FT                   AAAVKNISVPFVPKHSAGHATSTTGLTPSIWGGSASLGVSTAAVPAREAGGSPLKWPGG
FT                   DKSAPIAGATLAGQTGR"
FT   gene            complement(872535..875803)
FT                   /locus_tag="CNA03350"
FT   mRNA            complement(join(872535..872921,872979..873037,
FT                   873085..873167,873210..873286,873334..873403,
FT                   873457..873681,873732..873942,874003..874229,
FT                   874284..874387,874433..874763,874814..874900,
FT                   874949..875076,875126..875196,875245..875395,
FT                   875456..875601,875652..875803))
FT                   /locus_tag="CNA03350"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(872577..872921,872979..873037,
FT                   873085..873167,873210..873286,873334..873403,
FT                   873457..873681,873732..873942,874003..874229,
FT                   874284..874387,874433..874763,874814..874900,
FT                   874949..875076,875126..875196,875245..875395,
FT                   875456..875601,875652..875745))
FT                   /codon_start=1
FT                   /locus_tag="CNA03350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40845"
FT                   /db_xref="GOA:Q5KPC1"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="InterPro:IPR039766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC1"
FT                   /protein_id="AAW40845.2"
FT                   /translation="MPSSSTQLSTGHASAAASTSAMDRLAKEFPDAESLGRHKQIQAKL
FT                   QLEAMEIREEIARLKAELKRDQDPGKMSVIQSEIGQLMLQINVIREKAAEAEAIVKGIT
FT                   SDIQRLDVAKSNLTTTIQTLERWAMLRQAHQQLSQLLPTRRYKEISQALAAVMELLGPL
FT                   KPLSTIPTVSHLFKSAENDRKTVQEKVAVEMDAFFKQDPNKPIDKRTISEVCLAVDVLG
FT                   GDFRNHIIERYLQLQLAEYRRIFRATDEAGQLDNVPRRYAWFRRVLKHHDEEDAMLFPD
FT                   TWQVTRLLVANFSECTRSDLANVLAKQTPAVNVLLDALQGTLDFEGGMSRKFGMPFEEV
FT                   ISLSLRGGTSKWVISSVFDKYLSVYVDAQDRAISDMLSAYRGLKSRSSVEGAIQEETDA
FT                   PAPTILPSSTELFYFYGQQLEQCEKYSKGETMKKLSQVFAKWLRIYADDVLLAGLKPVR
FT                   KSLEGRDSLQEVKTACMVLNTAEYCLNTSLQLEERLKDKIDSKFREEISFQDERQTFSS
FT                   VMSTCITTILRELETACEPAFAAVLKTPWMHLENVSGRSAYVVDLVGSIKQVAEAVRGR
FT                   VESKKYIRNFADKAVGVVITKFTQSVIKSRPLKKIGAEQILLDVQAVKACLLDLPEPHP
FT                   ENSTTIYTKYVTKNTGQLETMLKVILAPDDPPEGFVQNYCLLIGDRSFTNFQKILDLKG
FT                   TPRTDQQRLLDIFLSVTSTNSELSDTSFLTHIDMDPPTSVDISRTVISPVGSSASLFSP
FT                   TSGVAGLPGLLRSGSTDGAERSETPKAFGEFRRLVNFATRRDNINTTPH"
FT   gene            875867..876865
FT                   /locus_tag="CNA03360"
FT   mRNA            join(875867..875970,876027..876225,876278..876392,
FT                   876457..876559,876611..876865)
FT                   /locus_tag="CNA03360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(875907..875970,876027..876225,876278..876392,
FT                   876457..876559,876611..876702)
FT                   /codon_start=1
FT                   /locus_tag="CNA03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40847"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPC0"
FT                   /protein_id="AAW40847.1"
FT                   /translation="MGAFDPAITYDRSTYIETDTGNKVSRKALIAGATNIVLGGKSIIQ
FT                   TSSILRGDLRRSAAGQHVVISVGRYCLIGEGAVIRPPGKMYKGTFTFYPLRIADFTHIG
FT                   PNCIVEAAQIGSCVEIGEGSIIGKFVVIKDLAVILPNTVLPEGTVVASMSVWGGNPGRM
FT                   IDTLPETYQETMEAKCKSYYQRFRPAH"
FT   gene            complement(876825..879456)
FT                   /locus_tag="CNA03370"
FT   mRNA            complement(join(876825..877578,877644..877994,
FT                   878054..878118,878177..878726,878798..878911,
FT                   878983..879102,879166..879456))
FT                   /locus_tag="CNA03370"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(876964..877578,877644..877994,
FT                   878054..878118,878177..878726,878798..878911,
FT                   878983..879102,879166..879357))
FT                   /codon_start=1
FT                   /locus_tag="CNA03370"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB9"
FT                   /protein_id="AAW41337.2"
FT                   /translation="MALSRPLPPHRKRIPSITPRIAPNLTTEDNAWDSLRDKSDDQLRA
FT                   ITRNDLVQALRGEWDLKDKMVGKIEMLENNRDKLERDIGELSRAMATLQSRFDESLNEQ
FT                   GRMEADLVERNALLDRLRKRVSETERQIREAQKRYADQETAFEAERRAFQAQEAHLRAR
FT                   INSLLSTPHKTAVAPAIAAQRREDGTISSLKDEIASLKLSCTTLRAKNSTLTQDIQELK
FT                   NLNNALQEDNEAWELFLRERTLNGDIREKDGLLNADQLQDRYERHEPEPLNEGLLLESP
FT                   LSRRGKIASDNGYSPLNGRNLASELGIFQEEREPGYLKKDINTEALENEIKQLKDTNKA
FT                   LNLYCSKIIDRIIAQEGFEHILSVDYKTGPAGSRNVSAIQTPLKHNAAPFAQAFNAEMT
FT                   SQASASSQDSASSKDKRGRPLSMIMARTFSGAAEKTPVVEEVLLPSPLTTSVEPSRATV
FT                   AKQEKRARRGFSLDFRSFGFGGVTSPGSPRPALRPLTLASRAISSTSPPLQQEKGATTG
FT                   RKLEPTEEDEEDKRERHRMEATLKLMGISKSADTSNVQDTMTKTPDNGKSPWSRLYSTI
FT                   CSTEHIYVVGNSNPAAAQAALKEYDRREAVRMESLAQGKSEAVYTTPPGVGIPRRRSSS
FT                   REKMMMSVGSVNTLWSMGSSSRPTSMDITRNGK"
FT   gene            complement(879501..881786)
FT                   /locus_tag="CNA03380"
FT   mRNA            complement(join(879501..880170,880209..880233,
FT                   880285..880383,880436..880588,880640..880985,
FT                   881039..881109,881150..881276,881314..881340,
FT                   881402..881628,881685..881786))
FT                   /locus_tag="CNA03380"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        complement(join(879578..880170,880209..880233,
FT                   880285..880383,880436..880588,880640..880985,
FT                   881039..881109,881150..881276,881314..881340,
FT                   881402..881628,881685..881750))
FT                   /codon_start=1
FT                   /locus_tag="CNA03380"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40849"
FT                   /db_xref="GOA:Q5KPB8"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB8"
FT                   /protein_id="AAW40849.2"
FT                   /translation="MFWDSLFTELSDVVGAPTDQLKLIFSLLVAFPLGSIFVRLPSAHP
FT                   NVAHLFSIAISTVFLVPLLGLGGGMLHMLFSSLGTYAIVNGMKDKNMPWVVFAFVMGHL
FT                   LFNHIKRSVLGLPASTIEITGSQMVLVMKLSTFAWNVHDGKVKEEELDANQLATRLIQI
FT                   PSLVAFLGYCFFFPSVLVGPSFDYATYDALIHKRLYSSPPAGSSPEQAKATKRRIPYGR
FT                   KRVAYLHLVIGLFFLGVYALYGDKYSYENVLSPIWTGWGWTRKFGFVQLAGLLARTKYY
FT                   AVWSLSEGACILTGIGFNGYDPKTGRTLWNRVRNINIKGIETAESFKILFDSWNCRTNV
FT                   WLRDVVYKRVTKKGKKPGFKESMATFLTSAFWHGISPGYYLAFFMGGLVTSLGRQFRRY
FT                   VRPYFLPPSETAQPGPPKRVYDLIGWISVQSTLNYLVAPFLLLNFKDSIGAWNRMYWYG
FT                   HVAVIISICFMSFGGRKALKRGLDKRKPRITPSVKVSPPSPPVDSTPPPPPEDEMDSTD
FT                   LRWVKHDLDNPEYQDSGEGVAMGVAIRDHGFLDKWIQGEETPGDTPGGTPKNEKDDPLR
FT                   K"
FT   gene            881884..883674
FT                   /locus_tag="CNA03390"
FT   mRNA            join(881884..881966,882005..882274,882326..882427,
FT                   882478..882697,882764..883029,883086..883161,
FT                   883212..883465,883524..883674)
FT                   /locus_tag="CNA03390"
FT                   /product="O-sialoglycoprotein endopeptidase, putative"
FT   CDS_pept        join(881939..881966,882005..882274,882326..882427,
FT                   882478..882697,882764..883029,883086..883161,
FT                   883212..883350)
FT                   /codon_start=1
FT                   /locus_tag="CNA03390"
FT                   /product="O-sialoglycoprotein endopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40851"
FT                   /db_xref="GOA:P0CQ14"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ14"
FT                   /protein_id="AAW40851.2"
FT                   /translation="MKQSPLHRPSRPLLALGIEGSANKLGCGIISHSPSPTGGPTLVMV
FT                   LSNVRHTYITPPGEGFLPSDTARHHREWVVKVIEEAVRKAGVRMGDLDCIAFTKGPGMG
FT                   TPLQVGALVARTLSLLHNIPLVGVNHCVGHIEMGRQITSSHNPIVLYVSGGNTQVIAYS
FT                   QQRYRIFGETLDIAIGNCLDRFARVIGLRNDPSPGYNIEKEAKKGKRLVQLPYGTKGMD
FT                   VSLAGILHSVEAYTKDKRYRSWDQVNDVEEDIITPYDLCFSLQETTFAMLVEITERAMA
FT                   HVGAKDVLIVGGVGCNLRLQEMMGIMASERGGRVFATDESFCIDNGIMIAQAGLLAFRM
FT                   GNTMPLEKTGVTQRYRTDAVHVAWRA"
FT   gene            complement(883359..889457)
FT                   /locus_tag="CNA03400"
FT   mRNA            complement(join(883359..883588,883656..883702,
FT                   883756..883998,884049..884125,884175..885371,
FT                   885423..885503,885555..886652,886700..886949,
FT                   886997..888876,888949..889457))
FT                   /locus_tag="CNA03400"
FT                   /product="two-component sensor molecule, putative"
FT   CDS_pept        complement(join(883575..883588,883656..883702,
FT                   883756..883998,884049..884125,884175..885371,
FT                   885423..885503,885555..886652,886700..886949,
FT                   886997..888873))
FT                   /codon_start=1
FT                   /locus_tag="CNA03400"
FT                   /product="two-component sensor molecule, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40853"
FT                   /db_xref="GOA:Q5KPB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB6"
FT                   /protein_id="AAW40853.2"
FT                   /translation="MSRTPISPRPNSNPRVPPSSAAFLQHLHSDPSSHHITLSGHRVSG
FT                   LSLSPQSLTGEGDLLDINGTSEPSISPSLHSHLSPVSSGTSSGPSPLGSVGRAPSKRAR
FT                   PKTAPSRNDEWPLGRSYETSPDLPPLIPPQADEHLRSSPVGDLCTNAMTMDEGLVDAME
FT                   ALSTSGEPKSYLIGRSESLAGTAESHTGPSKPSPASMNWSTFAQAYAHGLFDPNRVPNP
FT                   PTPNETPTEFQSARSSPGQKYSSLPLNHKYSMPTVPHNRSGSSSENYSSKSSKDSVSTN
FT                   ASSAPSTSSASASGKQMSMAASLAARKKAYELENIRSKPSGLALNTDKLSLPSYSLAAA
FT                   TVRMASTSILNDLAPLSMPSPERELTDPLASVVSFDSSSTKKDSARSDPGSSRFPLHHS
FT                   VSSAANPYTSSLRLPTIQASPVTTPLEGPHRPKGKDRSPPRARHGIVNSRIPSASAPLE
FT                   KTAEAESSTDYFGAVAVAAVSPQETDSSSTATDPTPTGPSLELRKTTPLRSNSVVPEPS
FT                   PRQQKDPLPPLVTPSDLNRIYDQYGWLPAPLPPDEAARRRALYRFSILHSAPDINFNRI
FT                   AHMTKLVFNPKAVLITLIDSDTQWFKSQSGFTVEQGGRISSFCAHTILPRTDEPFVVLD
FT                   TSSDWRFENNPNVVGPNSIRFYAGAPLRTADGFNVGALCILDDKPRTEFPPRSRLILKE
FT                   FAAVTMREMELWRDKLQLRVRDKIQTSMEKFTRECLEMDSASPTSDAETVNKMEHVYSR
FT                   AAQLVCSTIGLDGCFILDISQIEMVQTNTPTGKKSTYRANPYGAAENTSPVLERSESFG
FT                   PVNPFPVLAAVPTAKSTRALTPYEHEKLSDFMQNHHDGRIFEGAAPQWIRYMFPQSFRY
FT                   GMAVPIYGVDQQPFAMICAYTANPEKQFLEGYELQFLRAIGVIILSAVLRRRMALADKT
FT                   KSILISSVSHELRTPLHGILAAAELLSDTQLDSNQLSFLKTVQTCGNSLIETVNHVLDF
FT                   TKLSGTQSCKGSPSDLGKVNLAALVEQTVEGCWIGQRARFFMGDSDIGSFYAPPAPTSI
FT                   VPKSKRALVGEELSHVETVVDIDMREKGWMVRCEKGGLRRVLMNLVGNSFKFTKNGYIQ
FT                   VSLREMPHEPGSKTIPVEMTVVDTGKGIGKDFLKDQLFHPFSQENPLQTGTGLGLAIVN
FT                   TIVRSDSVNGKVDVWSAEGVGTEIKVTFDVEVVDDDDGQPSISSSSSVVSATSTFGHGL
FT                   SVSFVGFNPKHQGHMLSCEVFTRYVNYWYFSIEDQQRADILIVNELEELVNHPMAAQKP
FT                   ILLLSVQRGFESTALAEKINRGGGFCQVVYKPVGPSALQKALNAAVHWIEERDSSDKSD
FT                   ILGGNVTGINLEGNSYRPSISRGSSGESHESHSTISELSNARFNQQSSINSRLPLQRRR
FT                   SEENEQAPRRPSMAPRGMTYHSSRKMQRSSNDSAGSTPSQVPPSPTSSIPTIPLADGGV
FT                   MLKAATVSAEAPRKEKMGRVMVVEDNVINRRVLGAFLKKRGFEYAEAVDGQAGVELFEN
FT                   APPNYWDVILMDISMPIMNGHQATRAIRRIEATRRNSLSDIPIVPPPGKPVTISSQKAV
FT                   QARVKIFALTGLATPDDKREAFWSGVDGYLVKPVSLSSLDIIFKKIGF"
FT   gene            890301..892555
FT                   /locus_tag="CNA03410"
FT   mRNA            join(890301..890437,890492..890522,890595..890695,
FT                   890744..890870,890920..891120,891174..891252,
FT                   891307..891466,891528..891635,891694..891873,
FT                   891930..892555)
FT                   /locus_tag="CNA03410"
FT                   /product="expressed protein"
FT   CDS_pept        join(890408..890437,890492..890522,890595..890695,
FT                   890744..890870,890920..891120,891174..891252,
FT                   891307..891466,891528..891635,891694..891873,
FT                   891930..892487)
FT                   /codon_start=1
FT                   /locus_tag="CNA03410"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41434"
FT                   /db_xref="GOA:Q5KPB5"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB5"
FT                   /protein_id="AAW41434.1"
FT                   /translation="MEDRLHSLSKGVFVIPFEPAALNEEDREDTHSSTRDTLDRLYETT
FT                   LQIYEDAGAEYEQEKTNEQLDDIADWLERYKATAFLQLPQRTNRLPVAILQNASSSLPD
FT                   RITSLDATSYTLLGRDAPDVAAALRSIAIGFTGDTLGSGRKSSQASIDEVENWWQANGK
FT                   GLPLMLYIQDAQTIPASVLSEITYILALHAGLPIRLLLSVPSAAVFLSSWGHIEPSSVD
FT                   VSILRSGRSRRGAGGIDAIIRSSSEAPFKISDDLAEELRSNETLLGGGIAAAMKTLKWL
FT                   LLHHSLSSPLALLVEKTKNSEQERVMQSLLNAVKSSPVNPSIPRRDLFELNPHPDMFSV
FT                   LNPAPRTSILHSLSDPQDILPFFAASAPEKPSPNHHKSAKRKAVSASMDNEKRRKTGEL
FT                   EKLKINEEDQVLELKRLQTLFELWKSAGKTVNLWDWLDSFQGEDERGSEENKEANSAQV
FT                   GSEQTDKDENIDKESRNEAPKRAAQEENRLHATFIRFVEEARMLGLIRARGKGRKADEV
FT                   IKSVGLV"
FT   gene            892786..894674
FT                   /locus_tag="CNA03420"
FT   mRNA            join(892786..892897,892981..893021,893092..893119,
FT                   893189..893268,893328..893817,893864..894024,
FT                   894077..894674)
FT                   /locus_tag="CNA03420"
FT                   /product="Hob1p, putative"
FT   CDS_pept        join(892869..892897,892981..893021,893092..893119,
FT                   893189..893268,893328..893817,893864..894024,
FT                   894077..894549)
FT                   /codon_start=1
FT                   /locus_tag="CNA03420"
FT                   /product="Hob1p, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40855"
FT                   /db_xref="GOA:Q5KPB4"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB4"
FT                   /protein_id="AAW40855.1"
FT                   /translation="MKGFTKALQRTPHNLTTRIGLAKKSTDPEFNDYERKFAAVEAACQ
FT                   KMHKDSVVFRDSVSNLLASGSSFSGSLATLFSPMGAEYNLAAKHPQAETTVQNITIYQT
FT                   LMEEVRETLLPELELIESRIVGPCKELVEICKKIRKTISKREHKLIDYDRHNNSLNKLR
FT                   EKKEKSLSDEKNLFKVEQDFELASGEYEHYNNLLKSELPHFLGMATRFIDPLFHSFYYM
FT                   QLNVYYIMMEKLQSFADGKYDLTRKDIEDIYLEQRGDAAERIEELQITKRIISTAKLLQ
FT                   QRRSASGSSTPGRANSFASRTTSHTLGRKTSTDSYGSYSAAEKKTFSPPPPQSHAVSAP
FT                   PPYTAPAAGVATTGTVGKKAPPPPPPMKPKASYNNVKYATAIFDYEAQAEGDLSFRAGD
FT                   RIEIVEQTESAEDWWTGRLNGVTGVFPGNYTQVE"
FT   gene            895255..897336
FT                   /locus_tag="CNA03430"
FT   mRNA            join(895255..895723,895780..895827,895878..895988,
FT                   896036..896235,896283..896519,896572..896814,
FT                   896865..897069,897131..897336)
FT                   /locus_tag="CNA03430"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(895393..895723,895780..895827,895878..895988,
FT                   896036..896235,896283..896519,896572..896814,
FT                   896865..897011)
FT                   /codon_start=1
FT                   /locus_tag="CNA03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40857"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB3"
FT                   /protein_id="AAW40857.1"
FT                   /translation="MSSTSPTASFRPNQRSSQSYHPQISTSTASSTASQAFSDRAPVSI
FT                   ARRPSRATHPPMAPPRPLTHDEALEALRAFLKERSSYDVFPVSFRLIVLDTQLKVKKAL
FT                   DVMLLYGVVSAPLWNTSSAQFAGMFTVQDVIHLIQYYYHTSSWEGATADVEQFRLQSIR
FT                   DIEKVLHVPPPPLLYVHPLRPLYDACRYLIRTHARRLPLIDKDPQTNGEVVISVLTQYR
FT                   VLKFIAMNCRDITQYLTASVQELGIGTYVSPNPDPSNTNKFWPIAAATMKTTVFDVVHM
FT                   FSEQGISAVPIVDDQGKVLNLYETVDVITLVRNGAYTSLDLTIAQALKQRAVDFAGVVT
FT                   CSPKDSLSAIFSLIKIRRVHRLVVVAGQDDEQPGRLVGVISLSDIMRALIGNDIPLGGA
FT                   GVGAMGVDRALREEGEEGVFARSEGSKSAGTSTEGQSTE"
FT   gene            complement(897476..898258)
FT                   /pseudo
FT                   /locus_tag="CNA03440"
FT   gene            898792..900261
FT                   /locus_tag="CNA03450"
FT   mRNA            join(898792..899799,899847..900261)
FT                   /locus_tag="CNA03450"
FT                   /product="expressed protein"
FT   CDS_pept        join(899033..899799,899847..900135)
FT                   /codon_start=1
FT                   /locus_tag="CNA03450"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40859"
FT                   /db_xref="GOA:Q5KPB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB2"
FT                   /protein_id="AAW40859.1"
FT                   /translation="MRFTWLLVVAVGIVLSLADSAYCHAHGSGHFPKASRQRHHLQPRP
FT                   LLSPEQRHDHATLLLPRSNSTAISSNATNAVEASAEPSLPTRPSTVLTAPPSPVPTPLD
FT                   LSISTSLSSSCMLYLASLVSSETFLYCLPFSLLLTTSTAYSSIVAKALASGNYTTLNDL
FT                   VAYTSSPQPSIDQCVTFMSGVMTALTSKSNCASDISKNVPVAIKTKWGVGNYQVMREAE
FT                   SLVNEDTGVFCYIEAVASERPDDLYLWGLPGGISLPSSSRPSCTDCSASLLNTYESYLS
FT                   NTTTLNSTVINAAVKRINEACGSSFVNFGKDTQASGDSSCVAVKFIAGLKGAVAFASIV
FT                   AWMLIVYIDLN"
FT   gene            900470..902538
FT                   /locus_tag="CNA03460"
FT   mRNA            join(900470..900844,900892..901479,901532..901634,
FT                   901690..902041,902089..902202,902247..902538)
FT                   /locus_tag="CNA03460"
FT                   /product="tRNA isopentenyltransferase, putative"
FT   CDS_pept        join(900482..900844,900892..901479,901532..901634,
FT                   901690..902041,902089..902202,902247..902382)
FT                   /codon_start=1
FT                   /locus_tag="CNA03460"
FT                   /product="tRNA isopentenyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40861"
FT                   /db_xref="GOA:Q5KPB1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB1"
FT                   /protein_id="AAW40861.1"
FT                   /translation="MLNFIRSLQLFIRSQMTSQRPIVAVIGTTGVGKSQLAVSLAQSFS
FT                   LSRAPRLGMNNNENKTHPAVVLSADSMQLYTGLDVITNKVTVEEMGGIEHWGLNMVTPG
FT                   EDTSWEVGKWCNEANAKITTLPVDVLPIICGGTHYFIQHFLFPPPELSFVRDGEIKSQA
FT                   KDPMSVRWTPPGPRPPIPENLSPELLALLDTFWLTEPTWPSTSGSSVTERNPGPSKSSR
FT                   PTTREDEHLLALHRLLETIDPKESQRWHWRDGRKVRRSLERWWERGGTVDSVPSSNGLE
FT                   EPKGREARFRTLIFWVYEPMETLRPRLDRRVDKMLENGLLDEISELREIAQRIYGSTDA
FT                   TDHTEGIFQAIGYKEFASLPLPSPNPQSHPLFPTMVDRTKVSTQQYAKSQLKWIKKQFL
FT                   PAVREARSLGGEVEVYVVPGGETGVPLATEILHKFLKREKVPSNLEVGHVNAKELLHSL
FT                   EENGIVPNTADRQSINARKICEVCSTPNNPCSVLLREWDQHTKTRAHKHNANPIKMDKA
FT                   EWIARQKAMGEERKTERQRLKQESMAVGLDQKAD"
FT   gene            complement(901816..904105)
FT                   /locus_tag="CNA03470"
FT   mRNA            complement(join(901816..902409,902465..902591,
FT                   902656..902775,902835..903019,903080..903161,
FT                   903222..903279,903325..903681,903741..903839,
FT                   903887..904105))
FT                   /locus_tag="CNA03470"
FT                   /product="ribonuclease H, putative"
FT   CDS_pept        complement(join(902529..902591,902656..902775,
FT                   902835..903019,903080..903161,903222..903279,
FT                   903325..903681,903741..903839,903887..903888))
FT                   /codon_start=1
FT                   /locus_tag="CNA03470"
FT                   /product="ribonuclease H, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40863"
FT                   /db_xref="GOA:Q5KPB0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017067"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPB0"
FT                   /protein_id="AAW40863.1"
FT                   /translation="MAPKPGFYAVATGRHPGVYKTWPAAEEQVKGFPSAKYKKFATEQE
FT                   AKDFVTAAGDALPSQPPPIGKRKRAEMEDSKAPPVDTHFQATSPATVASPASLPPKLQK
FT                   IAQQGFSFTKSVPHYLVVYTDGSAKGNGQVGSRAGAGVWWGSRGEASKQNWAERVPGEP
FT                   QTNNRGELLAVIRAIERCPFPDIPLEIRCDSQYTISCMTIWLPKWMNNNFRNSYKQEVI
FT                   NTDLIKHLLVLLRRRGAAGRVKFKYVPAHSGVEGNEAADRLARTGGALPFVSDESNWLD
FT                   PEDEVVPCDSETNPTEVELEIDEDWLMTAEELAALEQQLV"
FT   gene            complement(904431..906324)
FT                   /locus_tag="CNA03480"
FT   mRNA            complement(join(904431..904743,904793..905203,
FT                   905267..905677,905743..905875,905955..906061,
FT                   906117..906219,906267..906324))
FT                   /locus_tag="CNA03480"
FT                   /product="D-lactaldehyde dehydrogenase, putative"
FT   CDS_pept        complement(join(904648..904743,904793..905203,
FT                   905267..905677,905743..905875,905955..906061,
FT                   906117..906219,906267..906280))
FT                   /codon_start=1
FT                   /locus_tag="CNA03480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41338"
FT                   /db_xref="GOA:Q5KPA9"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="InterPro:IPR033394"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA9"
FT                   /protein_id="AAW41338.1"
FT                   /translation="MSWFGSNKSSSNSPAGVTNFWPATSYNSGFGELTESDTAWLNASN
FT                   QGFQTETNVWYSVLEDGSLLMVQVIWSYLGIFLIPATTQMTFKHYNPTTKKAVWKSVHA
FT                   SNAKFDKQSCKSDLFEIRHSGSPTEGETYNITASLEKDVQITVEYTRPADTPGFKLGSG
FT                   PDGGISAFGKDRAKREGYVVHRFHPFIHSSGTLVINGQAVDAKGEGIFIHAIQGMRPNL
FT                   VASRWNFCFFSTAPGQDEEKLGSVRAFQMEFETTDDFGPKGAKSGRTKVNIGAIYCSKT
FT                   APVPFLITGQTHAPPSDSTYPAPSQDISSATHLNPVHDSETGYSVPSGLEFKWQGDRRD
FT                   GQGKAGATLVIEKAGKVPGEGGLIEKVDVLAEIPYVIKKGLTAVTGTNAYIYQYHNPAT
FT                   LEVNLDEEVIPVKGFVFNEATFISP"
FT   gene            complement(906477..907634)
FT                   /locus_tag="CNA03490"
FT   mRNA            complement(join(906477..907052,907110..907413,
FT                   907462..907521,907569..907634))
FT                   /locus_tag="CNA03490"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(906527..907052,907110..907413,
FT                   907462..907521,907569..907593))
FT                   /codon_start=1
FT                   /locus_tag="CNA03490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40865"
FT                   /db_xref="InterPro:IPR019315"
FT                   /db_xref="InterPro:IPR039207"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA8"
FT                   /protein_id="AAW40865.2"
FT                   /translation="MYDGPTRGGTRGGQGDFRWSAVANDKHRENYLGHSINAPVGRWSK
FT                   NKDIHWYNRDISEDDTAKAARERAEEVRRIKQQEDDALAAALGYAVPKRDTDGEGTGAN
FT                   DIPVKKSEKDDEIARLEKEERKREKALRREQRALKRAEKEIKREEKERHRHRRSESRRH
FT                   HHDDEDSPRHYEREQERIRARRHHDRYDEGDKDDWRSQDRENRERDYTSDRHARDHRLR
FT                   QREDERRQGELPYSNDRGKERDRYRDRREERPRYHLEDDMPRRKYERSRTRSKSPRRDH
FT                   RSSERHVGEVLDANPMREGLERR"
FT   gene            907759..910394
FT                   /locus_tag="CNA03500"
FT   mRNA            join(907759..907926,907989..908225,908281..908403,
FT                   908455..908577,908633..908755,908803..908931,
FT                   908980..909354,909401..909523,909573..909691,
FT                   909747..910394)
FT                   /locus_tag="CNA03500"
FT                   /product="beta-catenin, putative"
FT   CDS_pept        join(907815..907926,907989..908225,908281..908403,
FT                   908455..908577,908633..908755,908803..908931,
FT                   908980..909354,909401..909523,909573..909691,
FT                   909747..910175)
FT                   /codon_start=1
FT                   /locus_tag="CNA03500"
FT                   /product="beta-catenin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40867"
FT                   /db_xref="GOA:P0CM60"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM60"
FT                   /protein_id="AAW40867.2"
FT                   /translation="MGSALSSCCSPRRKNAYEPLLLETEREAVADLLQYLENRSTTNFF
FT                   AGSPLAALTTLSFSENVDLQRSAALAFAEITEKEVREVGRDTLDPVLYLLSSHDPEVQR
FT                   AASAALGNLAVNAENKLLVVSLGGLEPLIRQMLSPNVEVQCNAVGCITNLATHDENKTQ
FT                   IAKSGALVPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVAAGAIPVLVSLLNSPD
FT                   TDVQYYCTTALSNIAVDAANRKKLAQSEPKLVQSLVQLMDSQSLKVQCQAALALRNLAS
FT                   DSKYQLEIVKFGGLKPLLRLLHSSYLPLILSAAACVRNVSIHPANESPIIESGFLQPLI
FT                   ELLSFDENEEVQCHAISTLRNLAASSEKNKGAIVEAGAVEKIKSLVLTVPLAVQSEMTA
FT                   CVAVLALSDDLKPQLLEMGICEVLIPLTNSPSVEVQGNSAAALGNLSSKAAEDYAPFNA
FT                   VWNKPDGGLHAYLVRFLSSADITFQHIAVWTIVQLLEAEDEQLTNNIRSSPILISSIRQ
FT                   LAKSPPPSRAGGAPRHDPNDPSAGSSEDEFEDGLTDQEGEGEIVSLARRILDLTEVGEE
FT                   GDEFGERAGRNVPVGSHGQAPGQGQTSQVGSMGSEHAALRASVHRALSGGGRDR"
FT   gene            910501..911855
FT                   /locus_tag="CNA03510"
FT   mRNA            join(910501..910716,910777..910811,910875..910946,
FT                   911001..911116,911176..911442,911497..911855)
FT                   /locus_tag="CNA03510"
FT                   /product="prostatic steroid 5-alpha-reductase type I,
FT                   putative"
FT   CDS_pept        join(910578..910716,910777..910811,910875..910946,
FT                   911001..911116,911176..911442,911497..911785)
FT                   /codon_start=1
FT                   /locus_tag="CNA03510"
FT                   /product="prostatic steroid 5-alpha-reductase type I,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40869"
FT                   /db_xref="GOA:Q5KPA6"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR039357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA6"
FT                   /protein_id="AAW40869.2"
FT                   /translation="MLPPKNFFPSLIIFHLFPLHSPVTFFGLIDAPFGRFSRKTSRLNL
FT                   NGNLSWAIMELVSPITFLTTIVNSSHPSLNRPSRILSGLYLAHYAHRAIISPLILSPKR
FT                   SPLHITVVLAAMLFNLLNGYLLAVGLAFYPPKEIGWQFVLGVAGWAIGFFGNVYHDEML
FT                   NDLRRPPTKRIVMSHLPEDDASKLERYKVPRGGLFEWVSFPNYLCEWLEWTCWSFAANP
FT                   YPFISVPALPYLLRAPEYRNSHTVLSIISNFYWPSWLLAPSWAFVLAEVTSMLPRAMRG
FT                   HAWYKEKFGNKYPKSRKAAIPGIL"
FT   gene            complement(911823..913268)
FT                   /locus_tag="CNA03520"
FT   mRNA            complement(join(911823..912381,912440..913029,
FT                   913084..913268))
FT                   /locus_tag="CNA03520"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(911855..912381,912440..913029,
FT                   913084..913187))
FT                   /codon_start=1
FT                   /locus_tag="CNA03520"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40871"
FT                   /db_xref="GOA:Q5KPA5"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="InterPro:IPR033647"
FT                   /db_xref="InterPro:IPR033648"
FT                   /db_xref="InterPro:IPR038514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA5"
FT                   /protein_id="AAW40871.1"
FT                   /translation="MDQLSAEQAQALWEAGGFLIITDLPEGSEFGIDGTFHTVRKFSGI
FT                   KFLPPGFHFIAWSPPPSSTTAGPSVIPIRQAFVRNFSAKERYAVHYDKDTENISLPENG
FT                   TVISDDNLKTLDKELAPYPFERFEAWKSLTSHITPTILQSVIGPDGKVDGLMPVIDQEE
FT                   DTLTRDMREKLEEIKRRSQNFGFTKSLMFVRFSLKKSWRDGAVGEEVTVYSKDKSWLLG
FT                   NVIDEQLDRNPTALLGHLQLSFIFFLQISSYSSLLAYQRILALLCQSSSFLISPSTFLS
FT                   PPKRNPNAHVGEGMKIIYKELLKTLRVEIEALPDGVFDTELPEMDVFYLDQLESLRKNL
FT                   ASAIWGEVEEGTTWTELERQSFKSLWNALRDSAWKKWKWDIDELSHRVDEEDEDEEGEY
FT                   APVVIEI"
FT   gene            complement(913491..914413)
FT                   /locus_tag="CNA03523"
FT   mRNA            complement(join(913491..913810,913869..913996,
FT                   914069..914179,914235..914413))
FT                   /locus_tag="CNA03523"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(913559..913810,913869..913996,
FT                   914069..914179,914235..914304))
FT                   /codon_start=1
FT                   /locus_tag="CNA03523"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR027921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHW6"
FT                   /protein_id="ALO60321.1"
FT                   /translation="MSSNSPKREKLDVESPQDREARLGQLLQTITSTSNRSQESTPMNP
FT                   LNPLPSRPHGVPESDVISRVRAFLPQFQASNDALLAQARENPDSVDIEKGQSGQYISMD
FT                   LGLGVFDAPENPKGDMGPVIATQPPASLTRQQEDVDEEADSDSDGDDDVDGTESSSSES
FT                   ESEDEANGKVELNAKDKQESKKT"
FT   gene            914499..915533
FT                   /locus_tag="CNA03525"
FT   mRNA            join(914499..914838,914888..915133,915187..915533)
FT                   /locus_tag="CNA03525"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(914565..914838,914888..915133,915187..915515)
FT                   /codon_start=1
FT                   /locus_tag="CNA03525"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHZ3"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHZ3"
FT                   /protein_id="ALO60322.1"
FT                   /translation="MGMTRPLIRQAKSLASFTPTNLQSHLSNHPVLPLHLPSLTSAWPA
FT                   LTNWKLENGLQRLREKIGEGRVAEIELGKKGRSYLHKEWQQIHMPFGLFLDAFIFNLIP
FT                   SSSPAELPTAYLAQSDLLDSTPQLLDDVPALTHFYQGKEKSLYRRTIWIGPNGSFTPFH
FT                   KDPYVGIYSQIVGRKTFHLLPPDAFPYLDLSPIPRHANTSQIPVPVSRIISGVSPNEDV
FT                   QDLPQGTMQKCKEQLEKAFSIPGACQVNVAAGDSVLIPEGWWHAAEGVDGPGVGVNAWF
FT                   R"
FT   gene            complement(915591..916595)
FT                   /locus_tag="CNA03530"
FT   mRNA            complement(join(915591..915820,915933..916176,
FT                   916234..916339,916398..916443,916497..916595))
FT                   /locus_tag="CNA03530"
FT                   /product="succinate dehydrogenase (ubiquinone), putative"
FT   CDS_pept        complement(join(915732..915820,915933..916176,
FT                   916234..916339,916398..916443,916497..916545))
FT                   /codon_start=1
FT                   /locus_tag="CNA03530"
FT                   /product="succinate dehydrogenase (ubiquinone), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40873"
FT                   /db_xref="GOA:Q5KPA4"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA4"
FT                   /protein_id="AAW40873.2"
FT                   /translation="MSTSILRNSLARAVHKPSILRTTPGLMLAQRRLASTESVTAAESI
FT                   ALLNSQRQHRPTSPHLAIYQPQLTWYLSSLHRITGVAFGGALYLSAMAYLLHPLVPVID
FT                   SAHLIQLVHDLPGWFKGSAKFIIALPFTFHCYNGLRHLNWDIGKALTIKGVYRTGYAVL
FT                   GATVLSSLYLAFFI"
FT   gene            complement(916766..918236)
FT                   /locus_tag="CNA03540"
FT   mRNA            complement(join(916766..916997,917058..918018,
FT                   918089..918236))
FT                   /locus_tag="CNA03540"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(916790..916997,917058..917926))
FT                   /codon_start=1
FT                   /locus_tag="CNA03540"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41435"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA3"
FT                   /protein_id="AAW41435.1"
FT                   /translation="MTSSSRPATSIARLPPEIQLQIIHMLKQISSIPELINLLCTCRFI
FT                   LAECESGLYERVELSSSAAASFFKGFDLEENKERCFFVRSIEDQDQSNHTTVSQPRKTM
FT                   LQKLELFGNVKAMRFDDAESIIATSEAVMELKRYQKSISTSEIATQDPCGPYNILFPQL
FT                   RRISFGPSSLPKVCRDGLSWGAILDTLGSAWPDNPSLCFHLSPNSLDTYGRIAGYLETR
FT                   VKSLVLHQGYPSDLILLDKPSGIHAEQVTMYLKPHQIKGTYTCWEDHHWSIVNFCKKYF
FT                   GERRARHFVDPNSVHSPIFTFVNISGNLDDIREDIGRQLREMELEDGLVEAVQNKMRLV
FT                   GVGDVREGGCEVCGTWDT"
FT   gene            complement(918679..920491)
FT                   /locus_tag="CNA03550"
FT   mRNA            complement(join(918679..919744,919798..919889,
FT                   919941..920110,920162..920491))
FT                   /locus_tag="CNA03550"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(918739..919744,919798..919889,
FT                   919941..920110,920162..920483))
FT                   /codon_start=1
FT                   /locus_tag="CNA03550"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA2"
FT                   /protein_id="AAW40875.1"
FT                   /translation="MPKRKSNPSDHLPNPPPPLSSLDAALDLLVCDTFTRLNSVAAKFE
FT                   ACAGVKLNDGVVKARWEEAVSRYWVIKSMDELTCGAKKMEVKEGTAEADRDGMEQNGVD
FT                   GNQVGERADSNGRPLPASYPGAVVTHSLTPEEEHEWRKWTPKAGDVVLVDTFEDGLWPA
FT                   KIIDKKIFFQGRTVPRGNHFFPVRIYNEDMPPSITVKSRLIPFHLRANPPLMASTALLS
FT                   AYHHAANPTTFDMLASARETLAAHNRLHPCVIDEESKARFKAEKEAWNKQVNWVMGERR
FT                   VEKLRSTAEEREKRLREVARSTSTPVYESQGCADPCEEEMGSLFGCPKKRRTVPRNENS
FT                   VNASSDPCLTIFGPTTPTFPRTPPRSAASSVASYIRPSLSNTIRPSSPRRTPTREKRRV
FT                   HAFVSDLSPASRRTYTPPKILPSGDETAPPSFGSATLLSEVKAGKFDFVSPLGPVKRGK
FT                   LSSNPETIASSTSSTTSKPHSGRSGSLEIVREEEEEDGWTVVQRRGRRAGSEPVRQTME
FT                   AEEKTSVDDMEL"
FT   gene            920639..925951
FT                   /locus_tag="CNA03560"
FT   mRNA            join(920639..920736,920773..920999,921052..921166,
FT                   921220..921404,921451..921511,921564..921965,
FT                   922015..923964,924014..924028,924087..924150,
FT                   924205..924346,924397..924790,924852..924961,
FT                   925023..925063,925120..925179,925239..925419,
FT                   925473..925634,925690..925951)
FT                   /locus_tag="CNA03560"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(920709..920736,920773..920999,921052..921166,
FT                   921220..921404,921451..921511,921564..921965,
FT                   922015..923964,924014..924028,924087..924150,
FT                   924205..924346,924397..924790,924852..924961,
FT                   925023..925063,925120..925179,925239..925419,
FT                   925473..925634,925690..925914)
FT                   /codon_start=1
FT                   /locus_tag="CNA03560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40877"
FT                   /db_xref="GOA:Q5KPA1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA1"
FT                   /protein_id="AAW40877.2"
FT                   /translation="MAKKKLSLKPQNRGFATTSLPKKAAPPPAPPPADSPPAPPPQAPP
FT                   SSSPPPADWEHEEGAEEAALQSLVDRLQDKAEKEVARIVKAIEYDSRLAASFPKLDINQ
FT                   AIRDTALELALEEEKAACQDTDHPPVVTFPSTTVSDSDKGLLRYFVAYHVLQNLGFRQE
FT                   RIEQCLLQGIKEGEGWEEALEWMWLHLSEDECLQRGEYERTTEPSITENQESLVPAIEP
FT                   DVEPIAQPAQSSRPTRTALQATDASTEARTTAHKSLFQSQDTSDTESDSGTEDEYHINE
FT                   QWAKLQLELDTLRMASGEGKKGKKGKGNQVILETPEIRRLKDKIGKVEKEYMFTRKNAD
FT                   AILKVLRNQRDVAAIAAKFKGASIQDADQTETDSPSGNTQGDSIVEEKTNLMDGSSDEE
FT                   GDLFGGMLDEPTTLPGTPAETSTSTHITVRSMPIPKQMSFAGTIPKNVLKAALAKQTKQ
FT                   VVISYVNLSGASRAARAGLEIGWQGGGRKVWKMDDIACDDMVEAENYVSTLALSDLEAE
FT                   KTVAGVNWRTMPPSYRELWEELKVKRQEREDESRRGIWKMIKGIWDKKAVEATAEKNDT
FT                   SKPSTSNTPIDPPARPAKEKEDVIIQKLQDDFAKRKESSAYQTMLTQRNTLPIASFRDQ
FT                   IISTLDTNQILVFSGETGCGKSTQLPSFILEDQLARGKPCKIVVTEPRRISAISLAQRV
FT                   SQELGDAPGAVGTSSSLVGYSIRLESKTSANTRLSFVTNGIALRMLESGSSGSSRGTAF
FT                   DEVTHIIVDEVHERSIESDFLLIVLKNLCEARKDLKVVLMSATVDAEKISAFFGGCPFM
FT                   SVPGRTFPVTVQYLEDAVELAGWHIDGSSPYAIRGKKFKPASQMVEWNEEGAKSDSDPD
FT                   DEDEETAFNPAKLSSNKYSAQTVDTINILDSRLIPYDLIVLLLEKICFEAADYVPFSQA
FT                   TLVFMPGLAEIRKLNDMLLAHPKFGSTDFVVWPLHSSISSEGQSAVFKRPPEGVRKIVI
FT                   STNIAETGVTIPDITCVIDTGKQREMRYDEKRQLSRFVESYVARSNAKQRRGRAGRVQE
FT                   GLAFHLFTKARHDTQLPDHPIPEMLRLSLQDLALRIKILKVPLGKTVESVLLQALDPPS
FT                   SINIQRAIASLVEVKALTPNEEITPLGRLLSKLPMDVHLGKFLLVAAMLGCLDPALTIA
FT                   ATLNSKSPFVTPFGFESQARAAKRSFAIGNNDFFTIANVFASWRRASDNPHFVRTFCKK
FT                   NFVSHQNLQQIEELRQQLLAYLIDTSFVDATPAQRQAISQGRFSRGVRTKFVPVPPELN
FT                   INGEDLKVVGAALVSGLYPKLLALDASGGMKTITNQQPVAIHPSSVNFKVHKGEFGSNY
FT                   LAYFTIMHSKRLYAWETGPVDDAALALLCGDIADFKVSASSFILDRKIKYSLSPKTSIA
FT                   IKLIREQFYQVMSLRFRGKKLSDNQQRWFELGLKCLAAGLQDEEAAKICVV"
FT   gene            complement(925938..926797)
FT                   /locus_tag="CNA03570"
FT   mRNA            complement(join(925938..926235,926295..926493,
FT                   926592..926797))
FT                   /locus_tag="CNA03570"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(926112..926235,926295..926493,
FT                   926592..926781))
FT                   /codon_start=1
FT                   /locus_tag="CNA03570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41420"
FT                   /db_xref="GOA:Q5KPA0"
FT                   /db_xref="InterPro:IPR011107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KPA0"
FT                   /protein_id="AAW41420.2"
FT                   /translation="MSTAQRSPPSRTSTLTLTQTHTTPTDTPPQTVLHLRAGASTERRV
FT                   VWTEETVDNEGLGKKKSKICCIYHKPRAFDESSSDESSSDGSSSETDRRPSRGSNSHRH
FT                   RLKDDPNVEEEESSESDGGAGDGRARPLRKPRRHHHSHKCDHSDHAHKPNKYDVQPNGT
FT                   GKGKEKS"
FT   gene            926933..928344
FT                   /locus_tag="CNA03580"
FT   mRNA            join(926933..926986,927039..927288,927357..927745,
FT                   927804..927891,927941..928157,928216..928344)
FT                   /locus_tag="CNA03580"
FT                   /product="porphobilinogen synthase, putative"
FT   CDS_pept        join(926937..926986,927039..927288,927357..927745,
FT                   927804..927891,927941..928157,928216..928274)
FT                   /codon_start=1
FT                   /locus_tag="CNA03580"
FT                   /product="porphobilinogen synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40879"
FT                   /db_xref="GOA:Q5KP99"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP99"
FT                   /protein_id="AAW40879.1"
FT                   /translation="MSHQRTAHFQVPPLQISSVLHGGIHHPTLRTWQANGRNLTKSMLI
FT                   YPIFISDDPDAEQEVATLPGQKRWGINKLEAFLKPLVEKGLKSVILFGVPVTMEKDPRG
FT                   SAADDESTPVIQALKLLTNVFPQLMLCVDVCLCEYTSHGHCGILSSLPNPAHSNAPTLD
FT                   AEASAQRIAEVAVAYAKAGAHCVAPSDMMDGRIRAIKYGLMQVGLANRCALMSYSAKFA
FT                   SGLYGPFRDAAGSAPSFGNRKCYQLPPNARSLARRAIQRDASEGADILMVKPALPYLDI
FT                   ISDCAQYAPDHPTACYQVSGEYAMVVAGAEKGIYDLREMAFETTESMVRAGASIILTYF
FT                   TPQFLDWLDE"
FT   gene            complement(928342..931842)
FT                   /locus_tag="CNA03590"
FT   mRNA            complement(join(928342..928749,928810..928931,
FT                   928992..929330,929384..929582,929643..929816,
FT                   929874..929930,929989..930159,930210..930321,
FT                   930370..931842))
FT                   /locus_tag="CNA03590"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(928453..928749,928810..928931,
FT                   928992..929330,929384..929582,929643..929816,
FT                   929874..929930,929989..930159,930210..930321,
FT                   930370..931715))
FT                   /codon_start=1
FT                   /locus_tag="CNA03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41409"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP98"
FT                   /protein_id="AAW41409.2"
FT                   /translation="MHSSSPTAPLSDINRVAVTSTKLARRTYGRRSNAHKEKRKIGATE
FT                   WERSETPDVDFSDNGHGEDELHLSRSKRRNVEIGSPGNKERSRNLSNDTQPQNQANDSA
FT                   VHITSSLSPTPPSRSPTPPSRSTSPSPQVKGTAVFEPERLKSGWTRPRLMARARTQQYN
FT                   HGSGASSESPILSSESSAPASNRYTTRNCGRPLSPSLVNRREISELFSGFSSGASSHAS
FT                   VKSGDLQPVPPSSGGFHATSSARAGGLRRMLTKTQSLGVSEPSTPSKQDRRDDHEAGPA
FT                   SSRIVTAPSTPPRSALRRTQSMPSSPAEPSPQGVDIDSAFAVHPQIMQHPGSGGRAKKT
FT                   YGKVRTILVELSRGPEDGDQSSYDTMSQGDESQLQASYVELRQRYEVDNTIQHTSRSAS
FT                   LLQDMLQARAPETVSDMRSRGENRRFIDELGYLFDGISDPAANKSFQRSSAMDILQNML
FT                   DEYWLSKMKICGQVDKAWDCFTGAGEDEVMESACLVFLCILFVSGSGLEYVVHNDSQKS
FT                   VSLLLKLIKAREGPLDLSYKPKITNSISKLRTICEKLKDNWKISRSSTRYWASCVLNAI
FT                   CQSTMWAATGIDFEKEKALTNMLEVLKEEIKGVSDHFDLYEKGLDLQPDERSLDLGYLD
FT                   HCLRAILSLTEHSSTLREELLNSPQEVAQVLVDITLATTHLALTHDSNRSEASWCSLHA
FT                   VQILAQLGTASGQWAIAVMECEAGPICLARVILKRVDLVRNAKDAHEKYLTGQRTVLEK
FT                   EEGAKVTRPSINEPEISEEELLCYALALFTTSVLADKSFAFKIAHTNIQSDCAGVHACL
FT                   RRCRCTSALPLGLHFAHLYNQYSNSNDDPLASILKGNLALLLSKIIGVSAEIEGEVIQP
FT                   LFGHSRAAKLDGLIQSLRELGELQSMMQNTFRRLMPGGLSMEGGDEGDGSENTDVVLET
FT                   IRGVKSLL"
FT   gene            complement(932373..937544)
FT                   /locus_tag="CNA03600"
FT   mRNA            complement(join(932373..932608,932665..932781,
FT                   932835..933119,933169..933405,933454..933627,
FT                   933682..933794,933847..934378,934434..934817,
FT                   934867..935182,935233..935326,935390..935580,
FT                   935627..935853,935908..936102,936153..936235,
FT                   936287..936384,936438..936583,936636..936705,
FT                   936756..936868,936919..937137,937193..937544))
FT                   /locus_tag="CNA03600"
FT                   /product="DNA topoisomerase II, putative"
FT   CDS_pept        complement(join(932507..932608,932665..932781,
FT                   932835..933119,933169..933405,933454..933627,
FT                   933682..933794,933847..934378,934434..934817,
FT                   934867..935182,935233..935326,935390..935580,
FT                   935627..935853,935908..936102,936153..936235,
FT                   936287..936384,936438..936583,936636..936705,
FT                   936756..936868,936919..937137,937193..937315))
FT                   /codon_start=1
FT                   /locus_tag="CNA03600"
FT                   /product="DNA topoisomerase II, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40881"
FT                   /db_xref="GOA:Q5KP97"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR031660"
FT                   /db_xref="InterPro:IPR034157"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP97"
FT                   /protein_id="AAW40881.1"
FT                   /translation="MSDSEFDDFRIDDDGSESDYYVAPSKGKKAAVPKKKAPAAKAPAA
FT                   KKAAPKKINKAPLASKKHPNESLSDAGSDTVCSPPKKKTKADDDDGDFGTESSAKAPTS
FT                   NKNASEVYQKLSQREHVLKRPDTYIGSVEAITQPMWILNPETKTMVHRPITFVPGFLKI
FT                   FDEILVNASDNKINDPTMDSIKVVIDREKNAISVYNNGRGIPVEMHTKEGVMIPELIFG
FT                   HLLAGSNFDDDQKKLTGGRNGYGAKLANIYSHEFIVETADKVNSKKYKQIFSNNMSKKG
FT                   TPKITDNKKGEEWTKITFKPDLERFGMNGIDDDTNALLMKRVYDMAGTVKDVKVFLNDE
FT                   RIKVKNFKQYVEMYLNASTTATSEAAGGAAVTKPPIIYEVANKRWEVAFALSDGEFKQV
FT                   SFTNSIATTKGGTHVDMIATQLANKLMDQIKKKNKAAPVKPFQIKNHMWIFVNALIENP
FT                   AFDSQTKENLTLKSSAFGSKCELSEEFIKKVAKTGIIDNVLNWARFKQDQILKKTDGTK
FT                   RSRISGIVKLEDANNAGGRNSKNCTLILTEGDSAKALAVSGLAVVGRDEYGVFPLRGKL
FT                   LNVREAGHDQIVKNVEIQHIKQILGLKHNQDYATADSLRYGHLMIMTDQDHDGSHIKGL
FT                   IINFLDHFYPSLLRIPNFLVEFITPIVKVWKGKKEISFYTMPQYEEWKAQNNNGRGWES
FT                   KYYKGLGTSTSADAKKYFSDLDKHRLAFETMQPEDRQLIDMAFNKKKADDRKEWLRQFK
FT                   PGTYLDHDVQSLPISDFVNKELILFSMADNIRSIPSVADGLKPGQRKVLFGCFKRNLTK
FT                   EIKVAQLAGYVSEKTAYHHGEASLTSTIVGLAQNFVGSNNINLLDPNGQFGTRLAGGKD
FT                   AASARYIFTNLPRMTRAIFHPADDGLLNYLVEDGMSIEPDYFMPTVPMVLINGADGIGT
FT                   GWSTAIPNYNPVDIVENLRRMMRGEEPEKMTPWFRGFKGFIERIDQDKYKVSGIIEKIN
FT                   DTTLEITELPIRRWTQDFKEMLEEMTTGTDKVPQTIKDYEEHHTDTTVHFRVHMTEKNL
FT                   ADAEKEGFDKRFKLTTSLGTGNMVCFDLNGKIKKYASPEEILEEFFHKRLEFYGHRKQH
FT                   LADELNRQFERLSNQARFVHMIITKELVVSGKRRPDIVAELRSLKFKPFPKKERAKEEG
FT                   ENEAAEEEEDGDEGQASDYDYLLGMAIWSLTSEKVEKLLAERDAKEQELIELLKLSPNN
FT                   IWDRDLDNFLAEWQLALEADIADAKGSKPKAKAAAIKATQKPKKRAM"
FT   gene            938878..942381
FT                   /pseudo
FT                   /locus_tag="CNA03610"
FT   gene            947935..949689
FT                   /pseudo
FT                   /locus_tag="CNA03620"
FT   gene            950292..952208
FT                   /pseudo
FT                   /locus_tag="CNA03630"
FT   gene            complement(952224..958559)
FT                   /pseudo
FT                   /locus_tag="CNA03640"
FT   gene            958687..963360
FT                   /pseudo
FT                   /locus_tag="CNA03650"
FT   gene            complement(963349..968886)
FT                   /pseudo
FT                   /locus_tag="CNA03660"
FT   gene            complement(970224..972053)
FT                   /pseudo
FT                   /locus_tag="CNA03670"
FT   gene            972606..978104
FT                   /pseudo
FT                   /locus_tag="CNA03680"
FT   gene            complement(978965..986773)
FT                   /pseudo
FT                   /locus_tag="CNA03690"
FT   gene            988630..991902
FT                   /pseudo
FT                   /locus_tag="CNA03700"
FT   gene            992764..993699
FT                   /pseudo
FT                   /locus_tag="CNA03710"
FT   gene            998056..1003420
FT                   /locus_tag="CNA03720"
FT   mRNA            join(998056..998396,998461..998990,999043..999084,
FT                   999134..999243,999291..999496,999552..999842,
FT                   999887..1000062,1000109..1000172,1000224..1000550,
FT                   1000600..1000729,1000784..1001005,1001061..1001309,
FT                   1001357..1001440,1001501..1001615,1001663..1001736,
FT                   1001789..1001801,1001856..1002001,1002052..1002166,
FT                   1002217..1002260,1002315..1002548,1002601..1002743,
FT                   1002796..1002821,1002869..1003052,1003102..1003191,
FT                   1003235..1003420)
FT                   /locus_tag="CNA03720"
FT                   /product="asparagine-tRNA ligase, putative"
FT   CDS_pept        join(998182..998396,998461..998990,999043..999084,
FT                   999134..999243,999291..999496,999552..999842,
FT                   999887..1000062,1000109..1000172,1000224..1000550,
FT                   1000600..1000729,1000784..1001005,1001061..1001309,
FT                   1001357..1001440,1001501..1001615,1001663..1001736,
FT                   1001789..1001801,1001856..1002001,1002052..1002166,
FT                   1002217..1002260,1002315..1002548,1002601..1002743,
FT                   1002796..1002821,1002869..1003052,1003102..1003191,
FT                   1003235..1003385)
FT                   /codon_start=1
FT                   /locus_tag="CNA03720"
FT                   /product="calcium transporting ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40884"
FT                   /db_xref="GOA:Q5KP96"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP96"
FT                   /protein_id="AAW40884.1"
FT                   /translation="MPAQQQDPFDDLLGSDSPPAPPRNDIFHEGRHIDFFHQGSSTARA
FT                   PAAISQRGSSPDSVNQATYALDPFFDDDDEYGPAVSNSYSGYLAPHPSSALHSSQPLGR
FT                   SDPSLLESSMPLANAGAMPAGFSGPMDDNDVKGYQASSSTAYAAEDPFRDDEGPSAYAF
FT                   TAPGASSGWTQPRRSRWQMFRDDYLTDVDWSFGVNQLLRRRSKFDGVPREIALNEPEEN
FT                   RLKGFERNSVTTGKYGPITFLPKFLLSEFSRSANLFFLFTACIQQVPNVSPTGHWTTIV
FT                   PLGVVIIASAFKEIKEDFKRHASDRSLNNNLAQVLVDQQFQLRPWRRLRVGDIVRLEAN
FT                   SFIPADIVLISSSEPEGLCYVETANLDGETNLKIKQAHPSTASLTNPHSVSLLRGHILS
FT                   EPPNSSLYTYDGTFHLSSAHPGSAPTKIPVGPNQMLLRGAQLRNTGWVYGVIVNAGHET
FT                   KLMRNATEAPVKRTAVERQVNRQILYLFLLLIVLSLVSTIGSSIRTWLFDKNAWYLRLG
FT                   DESKNKARQFIEDILTFIILYNNLIPISLIMTMEVVKFQQASLINSDLDMYYAPTDTPA
FT                   LCRTSSLVEELGQIAYIFSDKTGTLTRNEMEFRECTIFGTMYAQTVDDNKRDQGQKTFD
FT                   SLRHRAQEDSQEGHVIREFLSLLSICHTVIPEEHDGKMVYQASSPDEAALVAGAEMLGY
FT                   RFQTRKPKSVFIDVNGETQEWEILNVCEFNSSRKRMSTVVRGPDGTIKLYTKGADTVIF
FT                   ERLAPKQEFSEPTLVHLEDYATEGLRTLCLAYRDISEEEYSSWSALYNNAASQMSGRAE
FT                   ALDKAAEVIEQNLQLLGATAVEDKLQDGVPDAIHTLQQAGIKIWVLTGDRQETAINIGL
FT                   SCRLISESMNLVIVNTETAVETSELLNKRLFAIKNQRLGGDTEELALIIDGKSLTYALE
FT                   KDCSDVFLELAIMCKAVICCRVSPLQKALVVKLVKRSTDAPLLAIGDGANDVSMIQAAH
FT                   VGVGISGVEGLQAARSADIAISQFRFLRKLLLVHGSWSYQRLTKLILYSFYKNITFALT
FT                   LFWYSWFNDYSGQIAFEGWSMSYYNVVFTILPPLVIGIFDQFVSARMLDRYPQLYHLGQ
FT                   QNYFFTPIRFFYWVGNAFYHSVLLFAFSVLVFYNDLLATDGKNSGLWVWGTTLYLAVLL
FT                   TVLGKAALISDVWTKYTLAAIPGSFIFTMIALPLYAIIAPLLNFSLEYTGIVPRLWADP
FT                   VFYFVLLLFPIICLLRDYVWKYYRRTYHPASYHIVQEIQKFSLSDYRPRQEQFQKAIKK
FT                   VRATQRMRRQRGFAFSQTETNNQDQARLIRAYDTSVARPSGY"
FT   gene            complement(1003182..1005168)
FT                   /locus_tag="CNA03725"
FT   mRNA            complement(join(1003182..1003532,1003590..1003723,
FT                   1003783..1003882,1003935..1003980,1004033..1004118,
FT                   1004172..1004278,1004339..1004404,1004452..1004820,
FT                   1004867..1004926,1004976..1005061,1005108..1005168))
FT                   /locus_tag="CNA03725"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1003461..1003532,1003590..1003723,
FT                   1003783..1003882,1003935..1003980,1004033..1004118,
FT                   1004172..1004278,1004339..1004404,1004452..1004820,
FT                   1004867..1004926,1004976..1005061,1005108..1005148))
FT                   /codon_start=1
FT                   /locus_tag="CNA03725"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHY0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY0"
FT                   /protein_id="ALO60323.1"
FT                   /translation="MPRPPTPLSALPLQRNLRTALTSAGYTTIEDIATISPDDLSTELG
FT                   IDVLQAEDAIQQTRQWLSNAPPDGPPSVLPQHFQAHVQSTTAADLLSTSDLPHFSTFSS
FT                   SLDALIGHLCSSTDALPTRGEESNQRGSIVPGMSIEISGPPGGGKSSLALAIAMSARLS
FT                   PGNLTNSVRADDQSEKGEVLLIDTEGSMTSERLFKAAQRIHGNTDTKSFLKGFYLVRIF
FT                   SQAQMIAFIYTLSDWLESHPKVNLVVIDTLSFHFRQPGLDLAARRKIMDLCKQTINHAT
FT                   ALRRCAVIVCNQLATKLFTAENKPASFGTSDRAVLMPQLGDWWTTNKTLRLVVFRGGSG
FT                   DEFRYVYASMSGSSKNIPWAAFDISKDGLPCDVPELIFQSCSQASLPS"
FT   gene            1005345..1006415
FT                   /locus_tag="CNA03730"
FT   mRNA            join(1005345..1005393,1005438..1005622,1005676..1005783,
FT                   1005843..1005938,1005991..1006087,1006147..1006241,
FT                   1006297..1006415)
FT                   /locus_tag="CNA03730"
FT                   /product="proteasome subunit beta type 3, putative"
FT   CDS_pept        join(1005391..1005393,1005438..1005622,1005676..1005783,
FT                   1005843..1005938,1005991..1006087,1006147..1006241,
FT                   1006297..1006345)
FT                   /codon_start=1
FT                   /locus_tag="CNA03730"
FT                   /product="proteasome subunit beta type 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40886"
FT                   /db_xref="GOA:Q5KP95"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033811"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP95"
FT                   /protein_id="AAW40886.1"
FT                   /translation="MSVMELNGGSVVAMIGKDCVAIASDLRLGNQQVGIAANFDKVFPI
FT                   NDKLYCGLPGLATDVYTLREHLRFRVNMYRMKEEREITPKTFTHLLSSTLYEKRFGPFF
FT                   LEPVVAGLPTPTSLEPHPRPYISTMDTIGCITTPKDFAVAGTAADKLYGIAEGLWEPDL
FT                   EPEDLFETISQTLLSAVDRDALSGWGAVVNIITHDKVITRTLRARMD"
FT   gene            1006721..1010553
FT                   /locus_tag="CNA03740"
FT   mRNA            join(1006721..1006934,1006996..1007700,1007760..1009367,
FT                   1009421..1010250,1010303..1010553)
FT                   /locus_tag="CNA03740"
FT                   /product="eukaryotic initiation factor 4F subunit P130,
FT                   putative"
FT   CDS_pept        join(1006773..1006934,1006996..1007700,1007760..1009367,
FT                   1009421..1010250,1010303..1010510)
FT                   /codon_start=1
FT                   /locus_tag="CNA03740"
FT                   /product="eukaryotic initiation factor 4F subunit P130,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40888"
FT                   /db_xref="GOA:Q5KP94"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="InterPro:IPR036211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP94"
FT                   /protein_id="AAW40888.2"
FT                   /translation="MPPQPAPARQNGVPQQPIPRPPVPQQGIPAHFPVPNQPPAQYPIM
FT                   AYPPQSGFYAGYNPYEQQQNFGMPPQWAPQHHPQNQFPGGYSARPVSPPSGTAPFQPAQ
FT                   QSFIHNSPFPGGSGPNGPQTPLRPSGPALNGHQQTSSNASQTSAPSTPNFSLSGASATF
FT                   TPRRSAAIKISRPDGTEFDLKKEALKVSSTTVSPAPTSPASTPHTPATPNSELKNVKVD
FT                   TPKKPVFGLPVTVKIERPEEKAARLLEEAKREKIRAQEEKEENERKERLEKKAKEEEEK
FT                   KAKDAAEKAEQANSAGEPTNTEVNGSVEEVISGAPSSVSSPALGAGLPPKPVSVVNGAN
FT                   ALPATLNLASASPPVVSEPSSASVSALSSARPIEDIHAISYPGSLKSPNPQLNVSAEPR
FT                   KFRYDREFLMQFMNICKDKPESLPPLEEIGLEADGGSGFGSRGSRGGRSSQGPSSRTGS
FT                   TGLGIGGVNRATMGSFSMGQFGSGSGSGSLRNSTSEQRYRASLPGRSSSQGGPGGLPSL
FT                   SGLPSMGLSSSRGGESRGSQRGSKRVPQSSQPSTPAAAPIPISENAWTRKRLGGDSEGT
FT                   PAYIERKVKALLNKLTEEMFDPISKQILEWANKSANETDGLTLKLVIKLIFEKATDEAH
FT                   WSSMYAKLCRLLHDEISNDVSDTIDGQVISGRSLFRRYLLGRCQVDFEAGWKAREDTAV
FT                   AAAAKKDEDEAKQEKAKAEDGGEEKEADLMSDEYYAAQKAKRRGLGLIQLIGELFKREI
FT                   VANRVISQCLLKLLSNVNDPDEEDIESACKLLATVGAAYDRAARENLNKAFDVLNQMMK
FT                   IESLPSRIKFMIMDLNDLRREGWKSRKNQSGVMTIAEIHEQNAKEKTAAAAAARESLSR
FT                   GGSRSGNRRDGTQPGEWQSVSSNPRSISRPTDFSNIGRNISSSSVTPSFGPSSVFANRK
FT                   GKAATASNAPSPTSRPSSANMFSALHEAQESESPAERRTSTDEGEAPQRKKLNLAPRTK
FT                   PLASEDDAREEGEEARSEEEAAGPELSEGDIKSKIDLDMKELWGDKDQGGSRNPADVAE
FT                   YFSSLPESRRPLLAARLLDDLFRISKLKDAEVVAKGWKVSLEQQAVSSEVLKQALEARM
FT                   PTLDDEAIDFPNAYDAVALLTRSLSLSDDDVSALGDKIEVDGTPRVTPKQKLEKALAKL
FT                   NEQA"
FT   gene            1010713..1013279
FT                   /locus_tag="CNA03750"
FT   mRNA            join(1010713..1010813,1010878..1010969,1011008..1011126,
FT                   1011164..1011205,1011260..1013279)
FT                   /locus_tag="CNA03750"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1010773..1010813,1010878..1010969,1011008..1011126,
FT                   1011164..1011205,1011260..1013194)
FT                   /codon_start=1
FT                   /locus_tag="CNA03750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41339"
FT                   /db_xref="GOA:Q5KP93"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP93"
FT                   /protein_id="AAW41339.1"
FT                   /translation="MFASNNDPSSPDTRMIAFQTLLDGSETALEKSVDIELLRKLCATG
FT                   IPSHPPHLRPLAYSLLLELLPLDKHQWKGTMRAQRRRYYNLMQTFMRELEAQPNSSSSG
FT                   TDNILNGISGDIKNLKSPFWHRPVSYRPSSPLRPVNSKVIRRSEGSNKEQEIEESFSDS
FT                   EEEFEEPILNRRAVFERLEVLSAARHATSVQKGPLNNITVQSPVSSVESTVLSPQITLS
FT                   FDPTPMPSPSGITRSPKLIQSAPQPMIDEQAPSSITLLSPRPLQSTIDSPAAPVKGALL
FT                   HPDSNREALIRLLYVFCQSNPQWRYRSSFVDIGAALYLIYAGGTKSDLDYVEEQTFWAL
FT                   SALAGDTSELLSDEGMDSALDRFERRLHWVNPALSKILRDRNVEPVLYAQRWLSSFFTL
FT                   DVPPTRIPLLFDIIVSARLSSPEEQPKVDLIMDIGVAMVSLLKDEIVYPNHLKVSHGMW
FT                   DNAVEEDEDSSDAMVRVLTLLRSYPLERAGDLPAVLEEASDLQETRLLSLQRGIDPDQI
FT                   PLPPRKPVSVKNLRDQAATNSSWGKAVGSLWSSISATSISAVKSAPAPLSSTLDSSSGR
FT                   SPVTDRRRSDSVTSSVSAIQERFASLSKHFSPTSSPKQSEDEPVNLPRPLLLSGSTRSV
FT                   SRSYRGDSTPSSSPRASPSMDKSLSPSNEFRSPPNRSLPSRQSPGGLYKIGNNYRNRHP
FT                   LRTAPTLAQRIHAGADHLWRSESAIDEKEMRKVDDNAHDDESSGWRSV"
FT   gene            complement(1013335..1016158)
FT                   /locus_tag="CNA03760"
FT   mRNA            complement(join(1013335..1013665,1013706..1014011,
FT                   1014057..1014741,1014795..1014874,1014914..1015986,
FT                   1016026..1016158))
FT                   /locus_tag="CNA03760"
FT                   /product="1-phosphatidylinositol-4-phosphate 5-kinase,
FT                   putative"
FT   CDS_pept        complement(join(1013414..1013665,1013706..1014011,
FT                   1014057..1014741,1014795..1014874,1014914..1015986,
FT                   1016026..1016158))
FT                   /codon_start=1
FT                   /locus_tag="CNA03760"
FT                   /product="1-phosphatidylinositol-4-phosphate 5-kinase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40890"
FT                   /db_xref="GOA:Q5KP92"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP92"
FT                   /protein_id="AAW40890.1"
FT                   /translation="MSTASLPDTQRSLPHPPPDPAAPQLTAHWTRHDEGDGEVDVLRIK
FT                   SSSPRINPFHLLSHPDSLSSLPPLPPSLQTIAAGPGNSDTRQPPVHITKVSANEVELKS
FT                   HSPEPSNYRNIIGKVSGVFKRNSHNSDADFAPSPVIMQGPPPSPPLSEGGLDESVIMSD
FT                   NTDETPVYHSAAAPVSENGPTIATGFTSEPSEMSPTVLAPPIPFSTRRVSSSSTSSRAG
FT                   SLTLVRSGRLAPQRDGESPGKGKDLPLLPHESDPNLERRDSAGSLLAPTPQLYRRSTVG
FT                   SSNFPSAPRSPLTNAHTAFTSPSSTPPPSGPPSAKGDLLDSAILAQEEHIRRERIERLE
FT                   RRQKKASTTSDSDPEPKIEEKPKEKPREKEKEETKVLVGNLIGEDHVNYVLMYNMLTGI
FT                   RIGVSRCQAKIKRPISDDDYTARHKFSFDIVGNELTPSAKYDFKFKDYAPWVFRELRDE
FT                   HFHLDPADYLLSLTAKYILSELGSPGKSGSFFYFSRDYRFIIKTIAHSEHKFLRSILKD
FT                   YHQHVKENPHTLLSRFYGLHRVKLPRGPKIHFVIMNNLFPPHRDIHETYDLKGSSFGRE
FT                   YPEERAAQNPRATLKDKNWVNRGRTLEFGPEKRALLTEQLRRDMEFLKRIKVMDYSLLV
FT                   GIHNMERGNRDNLRKNQLSVFHPEVTTTKRKPSTKQGPSEASNVRKVVRRSDPKSLDVT
FT                   SQLPSEDSADRRHFIFYQDEGGFRATNEANQPLDTIYYLGVIDICTPYSSLKKIEHFWK
FT                   SMTEDRHTISCVDPVFYGQRFYNFLRSVMRGGDKSLRPVGLEQVEPSEKPEVGQDMDNS
FT                   EMPIGGASDTQDTTVQDGPQPSIVGHLKTD"
FT   gene            1016373..1018527
FT                   /locus_tag="CNA03770"
FT   mRNA            join(1016373..1016895,1016963..1017106,1017146..1017772,
FT                   1017832..1018007,1018079..1018527)
FT                   /locus_tag="CNA03770"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        join(1016379..1016895,1016963..1017106,1017146..1017612)
FT                   /codon_start=1
FT                   /locus_tag="CNA03770"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40892"
FT                   /db_xref="GOA:P0CM52"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM52"
FT                   /protein_id="AAW40892.1"
FT                   /translation="MAAPRIAHLAHKSVLELSGPDAQKFLKGLSCKDVEYLAGGYSGFL
FT                   NASGRVLHTAFVFPRSKNSYLITHESPEDHPAPLTSLLPPFKLRSKVRIKDVTSQWDAW
FT                   SAWGSDLQGGPSPIRTWKMGSGGASESHWDWEGGVRDLGLRDDEVGCWDLRAGWPHMGR
FT                   QLLIPKGEKPSLATSHDLGNMDDYELHRMLLGVPEGPTEILPGHALPLESCMDIHGGVD
FT                   FRKGCFLGQELTVRTYHTGATRKRILPVRLIPLDQTSSSSISDLLSSSPQQSLDEVSTP
FT                   LDITYHPPSSSATRKPRSAGKILSLHNAVGLALVRLEMAERCWWSGDILRSSVSQWLDS
FT                   GAGRLTTQVNGKEWGVYVGQGEAYAAALEHMSSSS"
FT   gene            complement(1017581..1019117)
FT                   /locus_tag="CNA03780"
FT   mRNA            complement(join(1017581..1017878,1017937..1018062,
FT                   1018116..1018297,1018368..1018474,1018548..1018620,
FT                   1018662..1018715,1018773..1018978,1019030..1019117))
FT                   /locus_tag="CNA03780"
FT                   /product="protein monoubiquitination-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1017607..1017878,1017937..1018062,
FT                   1018116..1018297,1018368..1018474,1018548..1018620,
FT                   1018662..1018715,1018773..1018978,1019030..1019056))
FT                   /codon_start=1
FT                   /locus_tag="CNA03780"
FT                   /product="protein monoubiquitination-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40894"
FT                   /db_xref="GOA:P0CS40"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017422"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS40"
FT                   /protein_id="AAW40894.2"
FT                   /translation="MPDIKLKNQPFDVAFHPKEPVVFSSLLTGQVCAWSYDDATGETSS
FT                   SWSVRPSKRTARALSIEENGDEIWMGGKSGSLFQLSTRDGSMTRERDSAHECPINRVYC
FT                   VNRNLVATGDDDGVIKLWDPRQADSIRTYSQHFDYISDFTYFDDKRQLVATSGDGHLSV
FT                   IDIRSNKSTPLTVSEDQEDELLSIVPIKGGQKAIVGSGLGILSVWNRQMGWADSVDRIP
FT                   GHPASIDAIVALTPDIIATGSEDGMIRVIQVLPHKFLGVVATHEEFPVERIRLDRNNKW
FT                   LGSVSHDECLKLTDVEDLFEDSDEDDEMEEDEPDSDEEKSKKKKKDNGMKDMSRGQAEN
FT                   DGSFFADL"
FT   gene            1019261..1022157
FT                   /locus_tag="CNA03790"
FT   mRNA            join(1019261..1019659,1019697..1019977,1020017..1022157)
FT                   /locus_tag="CNA03790"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1019314..1019659,1019697..1019977,1020017..1021747)
FT                   /codon_start=1
FT                   /locus_tag="CNA03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40896"
FT                   /db_xref="GOA:Q5KP89"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP89"
FT                   /protein_id="AAW40896.1"
FT                   /translation="MDALRVARVDNVTIQYFLPPTAPDQKPTPCTQIGQLHLTPHHLIF
FT                   SHTPSTAYEPEIWIPYPLITRLTRLPQTINGLYPLQVETKTFESYVLHFTKDRDGGAEE
FT                   VWQSVKDCSVKSSVEQLYAFFYVPPSPGTGWTVFNHRTEFARQGLGTRTKAWRFTDINK
FT                   DYSFSPTYPSKLVVPSRISDSTLMYAGKYRSKARIPALTYLHWANNASITRSSQPMVGI
FT                   KNSRSSQDERLVECIFSSHLFLDNAYSSAPVFGATSTNLIIDARPTTNAMANVAMGAGT
FT                   ENMENYKLGKKAYLGIDNIHVMRNSLKMVVEAIREANLKPSVPLNRALLRKSNWLRHIS
FT                   TILDGALIIVRNIHLNASHVLIHCSDGWDRTGQLSAVAQICLDPYYRTFDGFKVLVEKD
FT                   WLAFGHKFLDRSGHLSSEKYFMVTENDDETEEEGVSAQRAAQAFFASVQKQFTSTSHLK
FT                   EISPVFHQFLDCVRQIQRQFPERFEFNEQYLLDIYRHLYTCQFGTFLFNNERERQGNTS
FT                   PSRKSFVEQTSSVWDYLDSPSEREKHINSLYDASLDSNQSRDAGADQGVLFYDPKDVRF
FT                   WFRLFGRGDEEMNGSALTLNQPQGVDIIGPIGGDQVEDMAAGEILRGASPVSAPSTHAA
FT                   PSQSRPWNWSQLSGNALNAVHSAAREIKSISQDALSQIRAEANELDKESWQQEGKGKNS
FT                   EPTPLTESVSLPEANPWSAEARPSPFTPPPRPNSQVSRTTQNPWAAMPDTVTSLSHLTL
FT                   DSKAPDSPANDAGAKERAEEKQQKAWDPLGAL"
FT   gene            complement(1021736..1022975)
FT                   /locus_tag="CNA03795"
FT   mRNA            complement(join(1021736..1022167,1022229..1022298,
FT                   1022348..1022553,1022592..1022661,1022718..1022975))
FT                   /locus_tag="CNA03795"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1021773..1022167,1022229..1022298,
FT                   1022348..1022553,1022592..1022661,1022718..1022924))
FT                   /codon_start=1
FT                   /locus_tag="CNA03795"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY4"
FT                   /protein_id="ALO60324.1"
FT                   /translation="MTSAANSSNYFAVARNDDQQAIHSQEAASSAPDEHEQLDTTSIRA
FT                   LRIAAAVERSKTEYKPEHAYTERLWLQPGSYKSQRPTTNSQLDRQRLEYMASSLYFADP
FT                   PDYHGALELVLLKFDASPKAKSLGGLSRELLDIGLKSAVKCGDKSSAKSLADSSKSIWK
FT                   GQFAGIAASAADAYMSAGLYQDAVKPLLISMSVFGIHYPIAYRLSKALKAIQEEREEHL
FT                   TATSYFQQLVDRAVEWRKPAFQRPIFSDDEGVTRGQGVRSDHDELAGQALDTRAVALEL
FT                   YLDAEGEKALEGSWKRLSKGLDVDVQPEVSVREL"
FT   gene            1023080..1025108
FT                   /locus_tag="CNA03800"
FT   mRNA            join(1023080..1023786,1023824..1024138,1024192..1024335,
FT                   1024416..1024591,1024661..1024801,1024904..1025108)
FT                   /locus_tag="CNA03800"
FT                   /product="conjugation with cellular fusion-related protein,
FT                   putative"
FT   CDS_pept        join(1023102..1023786,1023824..1024138,1024192..1024335,
FT                   1024416..1024591,1024661..1024738)
FT                   /codon_start=1
FT                   /locus_tag="CNA03800"
FT                   /product="conjugation with cellular fusion-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40898"
FT                   /db_xref="GOA:Q5KP88"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP88"
FT                   /protein_id="AAW40898.1"
FT                   /translation="MAHPGALSRNTPEASLPRSYPESSDNARKSAAVPSANADAATARR
FT                   LPALPNGPHSFRTDTSTPAGELDSAYEQTATRRRRAGTRSERPSTQPNTDSKGQRTSSR
FT                   TAHPRKPHEPRLPSAKDVRRAPASSMYFYPAPCYGSPPNQALRAHTGTLVGERIWVIGG
FT                   VDKQTCFRDVACFDTESFMWSTLETQGERFPPLRAHTTTLVGDKLFIFGGGDGPSYSND
FT                   VWILDTTTHRFSRPSFSPDLPLPPPRRAHSTVLYQHYLIVFGGGNGQTALNDVWALDVS
FT                   DPNALTWTEWKTKGDIPQKKGYHTANLIGDKMVVFGGSDGHASFADVHVLNLKTCVWTL
FT                   INTDIKHNRLSHTSTQVGSYLFVIGGHNGQAYAQDVLLFNLVTLQWEMKLPRGVFPPGR
FT                   GYHVALLHDARIFLSGGYNGETVFDDFWILDLSASAYLPQVTTFQVDENLYKRSITESS
FT                   SLWQTHL"
FT   gene            complement(1025168..1028244)
FT                   /locus_tag="CNA03810"
FT   mRNA            complement(join(1025168..1025477,1025525..1025600,
FT                   1025663..1025825,1025880..1025948,1026005..1026077,
FT                   1026140..1026452,1026506..1026567,1026632..1026858,
FT                   1026913..1027018,1027076..1027123,1027179..1027210,
FT                   1027263..1027362,1027415..1027723,1027798..1028000,
FT                   1028059..1028086,1028154..1028244))
FT                   /locus_tag="CNA03810"
FT                   /product="1,4-alpha-glucan branching enzyme, putative"
FT   CDS_pept        complement(join(1025263..1025477,1025525..1025600,
FT                   1025663..1025825,1025880..1025948,1026005..1026077,
FT                   1026140..1026452,1026506..1026567,1026632..1026858,
FT                   1026913..1027018,1027076..1027123,1027179..1027210,
FT                   1027263..1027362,1027415..1027723,1027798..1028000,
FT                   1028059..1028086,1028154..1028178))
FT                   /codon_start=1
FT                   /locus_tag="CNA03810"
FT                   /product="1,4-alpha-glucan branching enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40900"
FT                   /db_xref="GOA:P0CN82"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN82"
FT                   /protein_id="AAW40900.1"
FT                   /translation="MTAVSLSDGTAVLKTDPWLEPFSGALRERYAAYQKQRTIIEEHEG
FT                   GLAEFSKGYKSMGFQIDKNGGVRYREWASNATEARLIGEFNNWSHTANPMTKSPFGVWE
FT                   CYVPPVSPGVCAIPHDSMVKISMTLPGGESIDRIPTWITRVTQDLNISPIYDGRFWNPP
FT                   KEQQYQFKHGHSTRPVEGLKIYEAHVGISSPNMRVTTYKEFEVDVLPKIKQLGYNCIQM
FT                   MAIMEHAYYASFGYQVTNFFAASSRFGTPEELKSLVDKAHELGLTVLLDVVHSHASKNI
FT                   LDGINMYDGSDHLYFHEGGRGRHDQWDSRLFNYGQHEVLRFLLSNLRFWMDIYMFDGFR
FT                   FDGVTSMMYKHHGIGSGFSGGYHEYFGDSVDLEAMVYLMLANAMLHETYPHVVTIAEDV
FT                   SGMPTLCRPVAEGGVGFDYRLSMAIPDMWIKLLKEYTDDQWEMGQIVHNLTNRRHLEKS
FT                   VAYAESHDQALVGDKTLAFWLMDKEMYDFMSDLSPLTPIIDRGLALHKMIRFIVHTLGG
FT                   EAYLNFEGNEFGHPEWMDFPREGNGNSFAHARRQFNLVDDKLLRYKYLYEFDVAMNWLE
FT                   DKYKWLNSPQAYVSLKHEGDKMIVFERAGLLFIFNFHPTQSFTDYRVGVDTAGEYKVIL
FT                   TSDETRFGGHNRIDMGGRYFTTPMEWNGRKNWLQVYSPSRTVLVLGL"
FT   gene            1028573..1029490
FT                   /locus_tag="CNA03820"
FT   mRNA            join(1028573..1028604,1028670..1028915,1028970..1029490)
FT                   /locus_tag="CNA03820"
FT                   /product="conserved hypothetical protein"
FT   gene            complement(1028712..1031291)
FT                   /locus_tag="CNA03830"
FT   mRNA            complement(join(1028712..1029973,1030023..1030434,
FT                   1030485..1030606,1030667..1030694,1030762..1030784,
FT                   1030841..1030933,1031015..1031291))
FT                   /locus_tag="CNA03830"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1028733..1028915,1028970..1029248)
FT                   /codon_start=1
FT                   /locus_tag="CNA03820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40902"
FT                   /db_xref="GOA:P0CN22"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR036671"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN22"
FT                   /protein_id="AAW40902.1"
FT                   /translation="MPNYYDELEIEDFAWDPVARVFHYPCPCGDRFEISKGQLRDGEEI
FT                   AICPSCSLIVRVIYDYLDWEDYVTTDDEDDGGSVDTPLSNTSPDPAYPVVVGSAEVESQ
FT                   SKTASSAVSSQKEECTSLSDRLAGLQVESGKEDDPVQEHKREDSSDVLH"
FT   CDS_pept        complement(join(1029326..1029973,1030023..1030434,
FT                   1030485..1030606,1030667..1030694,1030762..1030784,
FT                   1030841..1030933,1031015..1031152))
FT                   /codon_start=1
FT                   /locus_tag="CNA03830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41340"
FT                   /db_xref="GOA:P0CN80"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN80"
FT                   /protein_id="AAW41340.1"
FT                   /translation="MSDDAEVTNNKKTTKSTLLDGNHIFPPFYACYLLRSKATANSNRT
FT                   YVGSTPDPPRRIRQHNGELKQGAWSTSRHRPWEMQMIVYGFPSKLAALQFEWAWQKPEL
FT                   SRHLRIRGEDQEYYHIFTKDARRNWVERKVCVAYALISLTPFNRLPLHVRFFNHETHGI
FT                   WQSIHEQAGVNTIQRGKSRAKPVNPLHLLSQSVAPAVTIILDLGGVSGTSGKRRECTKG
FT                   VMSHEGPIDVKDVEFRQGFGVRGKWLEIRKRILSGQDLCCHLCQERIAFNDHLTFSICP
FT                   LAESQDCFCITHLICLAKHFQDEAPVEDRRAPSQPKILPYQGLCPNCKRTVQWGQHIRA
FT                   CYARKEQVEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAGRKVRQREMKTKKGDQSN
FT                   GTVAQPESIYSATPVHTTFGLSNASATLIDPSMPARSMKSKDVGGEGIRHSTHTDDSDG
FT                   IISVYSETEDESESEPEWEIFEAEMMALS"
FT   gene            complement(1031572..1034255)
FT                   /locus_tag="CNA03840"
FT   mRNA            complement(join(1031572..1031851,1031917..1032146,
FT                   1032197..1032253,1032309..1032391,1032443..1032647,
FT                   1032698..1032962,1033009..1033220,1033261..1033501,
FT                   1033555..1034104,1034157..1034255))
FT                   /locus_tag="CNA03840"
FT                   /product="protein serine/threonine kinase, putative"
FT   CDS_pept        complement(join(1031767..1031851,1031917..1032146,
FT                   1032197..1032253,1032309..1032391,1032443..1032647,
FT                   1032698..1032962,1033009..1033220,1033261..1033501,
FT                   1033555..1033727))
FT                   /codon_start=1
FT                   /locus_tag="CNA03840"
FT                   /product="protein serine/threonine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41341"
FT                   /db_xref="GOA:Q5KP84"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP84"
FT                   /protein_id="AAW41341.2"
FT                   /translation="MFQKVSDKFHRKQQSTTLPGKTQQVPNPTSPVLAKANSQAQQAYS
FT                   LPQDHSPMEGIQRDSPPIQQPMATEKAPIVGSSASTSLPTLSVQDGTLPLTPGAQGMQT
FT                   GTIDGHRQLQSPVSRSSSAGEDKMREKARDAQEQAAQSQANLHHATQQARVAAINAAAT
FT                   QAALETAAQLPATARVPVSGGGVEQGQARRKTAGRYALSDFLIERTLGTGSFGRVHLVR
FT                   SRHNGRFYAVKVLNKEKVIKMKQVEHTNSEREMLVRVRHPFLVNLWGTFQDVNNLYMVM
FT                   DFVAGGELFSLLRKSQRFPNSVAKFYAAEVALALDYLHSLDIIYRDLKPENLLLGADGH
FT                   VKVTNFGFAKYVPDITWTLCGTPDYLAPEVVQSKGYNKSVDWYALGVLIFEMLAGYPPF
FT                   FTEDGNPMKLYEKIIAGKVRYPTYFDALAKELLKNLLIGDLTKRYGNLRAGSSDIFAHG
FT                   WFAEVDWDKLYRREIPAPYVPKIDGEGDASQFDRYQEADVSAYGKVGNGPYDHFFTEF"
FT   gene            1034445..1036463
FT                   /locus_tag="CNA03850"
FT   mRNA            join(1034445..1034891,1034952..1035067,1035118..1035212,
FT                   1035272..1035384,1035421..1035698,1035747..1035760,
FT                   1035819..1035929,1035982..1036267,1036321..1036463)
FT                   /locus_tag="CNA03850"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   putative"
FT   CDS_pept        join(1034649..1034891,1034952..1035067,1035118..1035212,
FT                   1035272..1035384,1035421..1035698,1035747..1035760,
FT                   1035819..1035929,1035982..1036267,1036321..1036408)
FT                   /codon_start=1
FT                   /locus_tag="CNA03850"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40904"
FT                   /db_xref="GOA:Q5KP83"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP83"
FT                   /protein_id="AAW40904.1"
FT                   /translation="MTLLTGSRITQSFLLTVKTRKPQCLCLLQSEQGKRMSTNHAAVHK
FT                   GKPPPSRSAPAIIDMQSTTEEPPLGESELFLRTRDEALNTPGMKFADGHGLKGPTGKGR
FT                   QTRKMNLYQAIRDALGTALAKNPKSFVFGEDVETGVFRCTTGLVDEFGKRRVFNTPLTE
FT                   QGIAGFGIGLASVGGCAIAEIQFGDYIFPAFDQLVNEAAKQRYASGGSYPPVGGSLTIR
FT                   APIGSVGHGGLYHSQSPEGFFLGAAGLKIVIPRSPIQAKGLLLAAIRDPSPTLFFEPKI
FT                   LYRAAVEEVPIDDYTIPLGQAEVIRKGADLTVVSYGTPLHICLRAINMLQQPPSSILGS
FT                   LPPGLRPPQPAPSIELIDLRTINPLPLEDLVSAVRKTGRLVIVHEAGRSGSVGNNIAGE
FT                   VGRRAFEYLEAPVGVVSGWDTPVPLSFERFYQPDVIRVFDKLVETLSY"
FT   gene            complement(1036458..1037846)
FT                   /locus_tag="CNA03860"
FT   mRNA            complement(join(1036458..1036667,1036725..1036947,
FT                   1037008..1037104,1037175..1037229,1037296..1037846))
FT                   /locus_tag="CNA03860"
FT                   /product="actin filament organization-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1036587..1036667,1036725..1036947,
FT                   1037008..1037104,1037175..1037229,1037296..1037670))
FT                   /codon_start=1
FT                   /locus_tag="CNA03860"
FT                   /product="actin filament organization-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40906"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP82"
FT                   /protein_id="AAW40906.1"
FT                   /translation="MATQQPAQAFASHLINQTLSSIALLESLSLINSADASLIRQKLPS
FT                   PTGPFPSLSPPSPSNSFANLTIAQSSPTSSWTVQHARDDNSSNSPSNSMQPSASAPALP
FT                   PRQRSEPAERRAKALWDFSGTEADDLQFRSGDTIIIDEEVNEQWSRGRVIPNGHSAPLP
FT                   RSGLFPSNYVEQLPPVQNNAPPPPQIPYYQPPPPGPQSMVPYQPPQQGYYGQKPPMHAM
FT                   PPQQQVQGGVMVQQDTQHKPRFGKLGSQLGTAAVTGVGFGAGSAVGSGIINSIF"
FT   gene            complement(1038490..1041468)
FT                   /locus_tag="CNA03870"
FT   mRNA            complement(join(1038490..1038698,1038789..1038887,
FT                   1038947..1039088,1039152..1039335,1039399..1039630,
FT                   1039937..1040130,1040239..1041157,1041234..1041468))
FT                   /locus_tag="CNA03870"
FT                   /product="transformer-2-beta isoform 3, putative"
FT   CDS_pept        complement(join(1038608..1038698,1038789..1038887,
FT                   1038947..1039088,1039152..1039335,1039399..1039630,
FT                   1039937..1040130,1040239..1040241))
FT                   /codon_start=1
FT                   /locus_tag="CNA03870"
FT                   /product="transformer-2-beta isoform 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40908"
FT                   /db_xref="GOA:Q5KP81"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP81"
FT                   /protein_id="AAW40908.2"
FT                   /translation="MAFSAAYVPSSPGPGEYNPPYPGYIIYSSTVRPPFSQGSPTTISW
FT                   ERNFEKFICENDAKSHKWDELMTFNSYAVRSPSPSDSRSSDAIPSKSPPRSSHVFSKVK
FT                   STNILGVFGLSVRTTERDLQDEFSRHGEIEKVVIVYDQRTGRSRGFGFITMRSIEDATQ
FT                   CINKLNGFTIHGRNIRVDYSATPKPHDPTPGQYLGPKTTTISDERLLSRCGRYDDFLEM
FT                   DGSLHGASHRHHFNRSKGRYDIRDDQMLDKNMIRRRRLEDAYYRGRHDRREAHEYRYRR
FT                   TSLSPRRNTYETSSSRRGRDAAYESGCSDSSRY"
FT   gene            1041717..1043345
FT                   /locus_tag="CNA03880"
FT   mRNA            join(1041717..1041954,1042044..1042077,1042133..1042231,
FT                   1042305..1042324,1042396..1042409,1042475..1042544,
FT                   1042609..1042782,1042829..1042950,1043040..1043345)
FT                   /locus_tag="CNA03880"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1041935..1041954,1042044..1042077,1042133..1042231,
FT                   1042305..1042324,1042396..1042409,1042475..1042544,
FT                   1042609..1042782,1042829..1042835)
FT                   /codon_start=1
FT                   /locus_tag="CNA03880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40910"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP80"
FT                   /protein_id="AAW40910.2"
FT                   /translation="MPWQKTFSLPPNRKGMHLVTNEVIQQCREGLKNVDIGIFTLHCLH
FT                   TSAGLTLNENCDRTVRTDMDMALDTIVPESLPWEHTDEGPDDSVSHLKTSLIGNSITVP
FT                   ISKGKLVLGTWQGIYLAEFRHNGAGWGGQGQGRKVVATILP"
FT   gene            complement(1042369..1044768)
FT                   /locus_tag="CNA03890"
FT   mRNA            complement(join(1042369..1042780,1042848..1043210,
FT                   1043264..1043432,1043496..1043595,1043649..1043880,
FT                   1043950..1044050,1044104..1044270,1044328..1044392,
FT                   1044446..1044768))
FT                   /locus_tag="CNA03890"
FT                   /product="cell division cycle protein 91, putative"
FT   CDS_pept        complement(join(1042894..1043210,1043264..1043432,
FT                   1043496..1043595,1043649..1043880,1043950..1044050,
FT                   1044104..1044270,1044328..1044392,1044446..1044605))
FT                   /codon_start=1
FT                   /locus_tag="CNA03890"
FT                   /product="cell division cycle protein 91, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40912"
FT                   /db_xref="GOA:Q5KP79"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP79"
FT                   /protein_id="AAW40912.1"
FT                   /translation="MSYLERLCSHKISHSEVYIVGAVLRMALFSLPEVVIALQRRPELS
FT                   TPLTSFRSIQEGVFIYEHGTSPYSGGTFYHSPIYLVLFSHVIPISSICLTAAFWTLADL
FT                   WGAWSLVKISQARNQKRCARDALVAAVYLLNPYSLLTCIARSTTTLDNAVLLGALSAAA
FT                   AGKTTFSLISLAVAVHTSFYPIILLPPIVILLGKINTEQPKKSLVLQSLLLFAALTIAI
FT                   GVFNFVILGDNWIWKSLGTSLEVTNLTPNVGMWWYFFTEMFDHFRTFFLGVFQLHTVIY
FT                   IAPICIRMVDRPLDAILLLLAIFVTWKSFPALGDMGLCAGLIGCFPDILANLRHPLFSL
FT                   TVHLYTSILLPLLHSLWLLTGTGNANFFYAATMVYGLNASLIIVDMLGASMRVEVKKRV
FT                   ALEGADDQSGTQDKKECTDDVCENWEARKWHVVQFTK"
FT   gene            complement(1045007..1050301)
FT                   /locus_tag="CNA03900"
FT   mRNA            complement(join(1045007..1045352,1045403..1046250,
FT                   1046303..1048066,1048122..1048817,1048871..1049559,
FT                   1049614..1049911,1050047..1050301))
FT                   /locus_tag="CNA03900"
FT                   /product="eukaryotic initiation factor 4F subunit P130,
FT                   putative"
FT   CDS_pept        complement(join(1045136..1045352,1045403..1046250,
FT                   1046303..1048066,1048122..1048817,1048871..1049559,
FT                   1049614..1049884))
FT                   /codon_start=1
FT                   /locus_tag="CNA03900"
FT                   /product="eukaryotic initiation factor 4F subunit P130,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40914"
FT                   /db_xref="GOA:Q5KP78"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="InterPro:IPR036211"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP78"
FT                   /protein_id="AAW40914.1"
FT                   /translation="MSQNTSPTVNGDNKTSAPGSIASVWARGPPSAVSSTSASKNQSGV
FT                   NTPSQEGAGLPNITSVSSSAAISIRNAHSRQNSLLVGPGGVDIKKGNIAFGTVDSPNTA
FT                   LSSSPAAPSTTGGHLADAVKSFGSIDADGNSDPDVVKTRRTSSLSNPIGPVQEKKLSVH
FT                   SLFTSKAPAQAPLGSSPSRPAMSPPQPHQQPIPHIRRQSMGQGGPGFQSQVPVGSPSFT
FT                   SGPPMRPPMVMPNQPRSPVANPNVPHGQYAPMPPLHVQQGFRPPQQGMGTQQPPVRPNG
FT                   MGTQGMARPMMGPGQYGMHPGPQGPQYPVMGYPPQGGFYPGYGPYDQQPHYGSPQWAQQ
FT                   QQNQSFNANFGPGPMSPRSGPSQISSAPSQSPLPPQGVPLGSGGPSPIPTPPNRPPNLM
FT                   AGHQHSASIPATPIPSTPSRPMQANVPPPFLSGAASVFTPRGASKAVKIAREDGTAVNM
FT                   KEVAEAASKAVSSGAHTPESAAQPSKDDAPRRKPGLPVIVRLESEEQKKKRVAEEEREA
FT                   KLKFMEEKEEQERRERLEKKIKEDEERQAKEAAEKAEAEKKAKEEEEKKKLDEAYAAEA
FT                   LAAKKLAEEKEATAKAAKEQTEAAEREKLAAHAATQEARDKAEEQRRELLSTPVTPAAV
FT                   SPVESPALGAGLPAKPVAAISGAMKTLPTAPELASTSVATINETPSASASALSSARPIN
FT                   DLSSITYPATLKSPDPRLNVDAEPGKFRYDREFLMQFMAVCREKPDTLPPLEDIGLEVD
FT                   GGSGFGGRSSRGGSRASMGPSSRSAPGGAGLGISGSNRSAFPGQGMGQFGSMGQFGSGA
FT                   GPIRSTSEQRYRASLSNRTPSSLSGLPSLGISGSRTGANRGSQRGSKRAPQSSQVPTSA
FT                   TAPIPISENAWTRTRLGGDAQGTPAYIERKVKALLNKLTEEKFDPISLQILEWANKSAN
FT                   ETDGLTLKLVIKLIFEKATDEAHWSAMYAKLCKLLHDEISPEVSDTIDGKPVAGRALFR
FT                   RYLLGRCQVDFEAGWKAREDTAVAAAAKKEEDGAKQEEAKDDKDKEAVLMSDEYYAAQK
FT                   AKRRGLGLVQLIGELFKREMISNRVIKECLLKLLSNTTDPDEEDIESACKLLTTIGAAY
FT                   DRVAPENLSKAFDMLSKMMQVESLSSRIKFMIMDVFDLRRNGWKSKKNQTSVMTIAQIH
FT                   EQNAKEKSAASTAVSKESISRGGSRSGRDRHEGSQPGEWQSVSAGPRSLNRPTDFSNMG
FT                   RNISSGGTAPSFGPTSIFNTRKGKAGTPTNVTPPMSRQPSSANMFSALNDTQENELVSA
FT                   ERRTSTDNGESAPQRKRLNLAPRTKPVEGEGENKDEGAEEEPHGDRVDEHDLSEEEARA
FT                   KIDLDMKELWGEKDQGGSRNPEDIADYFSALPVSRRPLLAERLLNDIFRISRLKDAEIV
FT                   AKGWKTALLQQSVSADVLRQSLEHRMPTLDDESIDFPSAYEAIALLVRNVSLSQEDINA
FT                   MVGRIEVEGTPRITPPQKMEKALRKVDEAGSLA"
FT   gene            1050488..1052378
FT                   /locus_tag="CNA03910"
FT   mRNA            join(1050488..1051581,1051636..1052378)
FT                   /locus_tag="CNA03910"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        join(1050542..1051581,1051636..1052323)
FT                   /codon_start=1
FT                   /locus_tag="CNA03910"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40916"
FT                   /db_xref="GOA:Q5KP77"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP77"
FT                   /protein_id="AAW40916.1"
FT                   /translation="MSLRLFLSRVPPSQQLPSKLLPQLSLRRAQSSSSDSRPPHPAVQQ
FT                   SFEALASDLLATPSTLSSSGLKRSAPEAPRTFIKSPSLPPVQLSRNPYAGQYAISEDDL
FT                   DDPFETEIAVEEPKGLAVPPRRRRLAGRQSSATARPQRIINLSPHDTVSVYPDFISLTS
FT                   HGRTGVITNARLLDACHCKKCRDPSTRQMNTTTGEAVRESKIARITRGNSVRKGGIRKD
FT                   GLVVSWGEGVKHMSFFPLHRLRSMLERDMGTVYRSPSFVHQTWDGESLSLTNLRFQYSD
FT                   LSESLLKVLEQLQVYGIVVIEGVPTDPTDDKECMLRKVTDMIGKIRNTFYGETWDVKSV
FT                   KQSKNIAYTNLNLGLHMDLLYFSSPPRFQALHCLRNKVEGGSSYFVDSFRTVSDLPRDQ
FT                   FEFLQKINITYQYDNDNHYFRYRHPIISSDFVRGRNNRHAAVNWSPPFRAAAEALDFPQ
FT                   HDFVAAAKHEQKVLQAIADFEERLSDPRYRYEFTMQEGDLVLFDNRRVLHARTAFRDKK
FT                   DMEVEEEERVEQKSEMESDKEPTRWLKGCYLDGEAVWDKLATLRKQSLERRAASVGVQ"
FT   gene            1052585..1052656
FT                   /locus_tag="CNA03920"
FT   tRNA            1052585..1052656
FT                   /locus_tag="CNA03920"
FT                   /product="tRNA-Gly"
FT   gene            complement(1052936..1055335)
FT                   /locus_tag="CNA03930"
FT   mRNA            complement(join(1052936..1053375,1053449..1053514,
FT                   1053610..1055335))
FT                   /locus_tag="CNA03930"
FT                   /product="RING zinc finger protein, putative"
FT   CDS_pept        complement(join(1053244..1053375,1053449..1053514,
FT                   1053610..1055325))
FT                   /codon_start=1
FT                   /locus_tag="CNA03930"
FT                   /product="RING zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40918"
FT                   /db_xref="GOA:Q5KP76"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP76"
FT                   /protein_id="AAW40918.1"
FT                   /translation="MQAASPAPGPRATPPVLSPPPAALPLPLSIPHTLCQLPSPGSPLG
FT                   PAPAPPADAFTPSSASSPGRRSVYDDLQHYNPVPPFVDHTEDEMLREDYNRLRARRTSS
FT                   NLSSSPAATNSPSSLSMQRRSLGDSGQRLPPDFVPSPVPPHLNPVPPYLDYIEDEMLRD
FT                   DHVRVRSSARGSSIGPFPSEHVPPAFPTNNIGPSHASSPSPSSASIISPSSRHQLAGSE
FT                   EPNDRWSRDRLADLRRAMLASQSHDNRPSPWVQAWGRAPDEPLNAEVNDRYWDAEYPAE
FT                   YIERPSQRSSSSSLRPSPATTHMGGRGRQALNRDINETVGRRLGSLRPIQMANPSFPLE
FT                   TSTNTLRRREVPHGPQEGRAAAPPPAEGNLWGELERDSRSSSSFSESAPPSADGDSGTT
FT                   TPTQESVFRAYGSSNHGEDEDGDFDENDEDDDEDYDDENENGDSEMLNPDIMREVYNLL
FT                   TARPVPPMAMFSGPGMAEPIELIHAHVHSHVSSFGRVFRQRPPRQSLEELRLSPQMDDN
FT                   TVQKTLMSAVKGLKYLSDGKKRRMAMGMLENITWAEFGEREGMVRDEYCSVCHDEYEDT
FT                   TEISITPCKHMYHKDCLSTWLNTPKISSCPMCRRDLALLAAFANMTSSKTVNEAIPYWY
FT                   RV"
FT   gene            1055480..1058780
FT                   /locus_tag="CNA03940"
FT   mRNA            join(1055480..1055562,1055600..1055881,1055931..1056039,
FT                   1056098..1056669,1056721..1056775,1056834..1058071,
FT                   1058185..1058780)
FT                   /locus_tag="CNA03940"
FT                   /product="kinase, putative"
FT   CDS_pept        join(1055485..1055562,1055600..1055881,1055931..1056039,
FT                   1056098..1056669,1056721..1056775,1056834..1058071,
FT                   1058185..1058658)
FT                   /codon_start=1
FT                   /locus_tag="CNA03940"
FT                   /product="kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40920"
FT                   /db_xref="GOA:Q5KP75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR035062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP75"
FT                   /protein_id="AAW40920.2"
FT                   /translation="MPPSEGRYLAALPAQHKDAAPDTLYQKLEIVGKGAYGAVYRGKHI
FT                   ATGHIVALKIINLDTEDDDVADIQKEISLLQQLMLGGSNSGGPPPNVIKYYGSLMQGPR
FT                   VWIIMEYAEGGSIRTLSRAQPLKELHICLVIREVLLALAFLHKNGVIHRDIKAANILLT
FT                   TQPHRILLCDFGVAALLQSSTSKRSTFVGTPYWMAPEVVTEGRMYDAKADIWSLGITLL
FT                   EMAYGEPPMSGQPAARAVMLLGDKRMRAPRLEGDHWSKEMRDFVVGCLNEEPADRLSAE
FT                   ELSKSKWIKQQSKTPLTAMNDLIARYQAWKESGGQRQSLAAGVGANVDDDDDDFDRHPA
FT                   DGDWAFDTVRSRASILLGKQQSEDNASSNLSPPTTHPAPAPQSLRRLFHDESSTDPDPF
FT                   KSFAHQQPPTPQTTEGSDTIKQTGRFPSPEQEDLPPLVDTDSPPATPGKNELDGQTIRQ
FT                   ARLGRDGRSPTPLMITTGYSPSPSSNTLSAASTATYYPIETPQEHTPIARTDAGVPSPR
FT                   RIRNKISLDNLSLTPTSKTQPAAEERSKSSGGMRRPSASDAREGLRGFQFPLMTKSGPG
FT                   PTPITTASMSTSTNTPTSTQPPAAGKLFPPPLNRNHSAAPAYPFADPTTTSTTTTTSPT
FT                   GTSSPGFGGLAFGPRPPMMRQASVAVMEGRAASQSQSQAQAQALALALAHTQTHQQQQQ
FT                   QQQQQQQQQGSTSPPTPKKAVALGAPNSIGLGRPGVSAAAAAAAAAAASATAAGGGGGQ
FT                   GMMIRSRSGSKAEDGHPVGLRDLLKLSPAVPDMPDLLPPSPSVANTPHKFFPSPSPLAQ
FT                   TTHAHAEPSAASAASASATASAAFSFPTLASAPMSAAPSQRSLLPAGTIPASAPPGLAT
FT                   QPNAFAPVHATMGPPIRPLDLSMLESDDVFDELGRMVDDMQSWFGCVESGLEELLATGV
FT                   DVQNA"
FT   gene            complement(1058751..1061683)
FT                   /locus_tag="CNA03950"
FT   mRNA            complement(join(1058751..1060216,1060263..1061513,
FT                   1061563..1061683))
FT                   /locus_tag="CNA03950"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1058812..1060216,1060263..1061513,
FT                   1061563..1061603))
FT                   /codon_start=1
FT                   /locus_tag="CNA03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP74"
FT                   /protein_id="AAW40922.1"
FT                   /translation="MSPSTTYQKARLSLAMLGLNGLPLDEYLSQLPRLPDTPKDSKRID
FT                   DIPEGIVSHSISQYSTPDLPTSESQVEVDKGSRDSLRVPGSRVKVDSPLEKHPIILNSS
FT                   IEEVGDSSISPDALHVGPHYEKVTCDQSTSQSPFASTLIEQSVNPQAAPAPRLSASFRL
FT                   PNMGDISLIGECSLFGGASSVGDDSLEYELSDIRPKRDTINRSTSDPFMMKRQRDINPA
FT                   SQHLGQSTLLPTSPAKQAHLLASTNSLHRVEPPWCGNDSTMTTSSNGSNDTVTESRSAS
FT                   PTRSSTVKAQSLPRSNALRGFPTSKTRRTFPASSSGNSLAAVGEEESELLINLDKSTLL
FT                   PISPQKTAYLLRDEEMIARETLDEGPSYMLTIPPATISRAAAGCIGHDGDRTMDVRDLM
FT                   AKVGKPKRASGTEESFVDLLHAEDDMFAKMDMTMLGADETMVMPATLRPRQASPSKIVA
FT                   QAQATTKATLPTSRTSHTLSILDDNQAQEQKPITLSRSKSLSKVAEIIQRVKADKLAAA
FT                   SASRLGSPPKTASVARTYKTSSTSTATPAAPRVRGKVAPHTTGSRRISLSAGGVPISCS
FT                   ASQKSIDLPRPRPTHARPISTHSTLSSANQNVSARQTITAAPTETCAARIVNRNPQATL
FT                   TARVPRASIVPSSRTEVKNRSGSVSSSVSTAATVSRAPNSRPSIAAPRTITRSHTTEGL
FT                   SAAGARVPRASVAASSRPAGLPLPGTGPTARSATANTPASTATRARLSRAFGSDATSAT
FT                   NRLSRPATSTLASATSKTLKLSSGPSVISARSSATSTDRLKSRALSTPASAGTRQSTLP
FT                   ISRALPTPRSATDAARNSSKPPATTIDLPKARVGSTLRRPSTSRVPAGGPGKNSAPPGS
FT                   GSNLAALRSRLDELQAKQKERSAARCL"
FT   gene            complement(1062299..1065145)
FT                   /locus_tag="CNA03960"
FT   mRNA            complement(join(1062299..1062815,1062868..1063384,
FT                   1063434..1063526,1063583..1063958,1064010..1064146,
FT                   1064192..1064600,1064653..1064682,1064743..1065145))
FT                   /locus_tag="CNA03960"
FT                   /product="glyoxal oxidase precursor, putative"
FT   CDS_pept        complement(join(1062558..1062815,1062868..1063384,
FT                   1063434..1063526,1063583..1063958,1064010..1064146,
FT                   1064192..1064600,1064653..1064682,1064743..1064917))
FT                   /codon_start=1
FT                   /locus_tag="CNA03960"
FT                   /product="glyoxal oxidase precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41343"
FT                   /db_xref="InterPro:IPR009880"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015202"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP73"
FT                   /protein_id="AAW41343.1"
FT                   /translation="MYSAILLSLLPLLAAAHGGPSRNLPNRAFSQQQVRDGVTPGGYQI
FT                   VGDSGVSAQMLFLGTETTAYILDKAENNSLQVTNDDGLTHPAWGTSYDLTTNKATAMQV
FT                   SSNTFCAAGLSMATGEWAVFGGNQPVTYGGVATKDNPSIPNDFMDTDGGAAIRLLTPCD
FT                   DGSCKWQEGGDELTMTSKRWYPTVELLGDGSLIVLGGDGNGGYVSTFAQNNPTYEFYPK
FT                   TDNQSHYMDFLNYTVPVNLFPLTWLMPGGKLFMQAAYKTILYDLDAQQETPLPDMPYAV
FT                   RVYPASAATALLPLTPANNYSATVLFCGGSAANFNLSSDGGAQFNVTAVPADNTCVRIS
FT                   PEDEKPTYEDDDYMLEGRSMGQFIFMPDGKMWMGNGVAMGTAGYGDEGYSIGQSYGQEP
FT                   LYQPAIYDPSAPAGSRWSREGLGMSTQERMYHSSAILLADSSILVSGSNPNKDATSEKW
FT                   PTSYSVEQWYPLWYNEQRPEPSSSWPSSLSYGGEYFNVSYTPSNSSSNSDNTKVVVIRT
FT                   GFSTHAMNMGQRYLELNSTYTKDEASGEVTLYVSQMPPNANIFQPGPAMIFLVVDGIPS
FT                   QGKIIMVGSGKIETQPISEVAVLPATSVIPAQTNSSSSDNAAGTSTTSSGSSQGTSASQ
FT                   NVDSGATAGLRARFATVFGSAVVGLALLL"
FT   gene            complement(1065436..1067839)
FT                   /locus_tag="CNA03970"
FT   mRNA            complement(join(1065436..1066334,1066385..1066440,
FT                   1066487..1066555,1066604..1066671,1066729..1066804,
FT                   1066854..1067140,1067188..1067278,1067327..1067450,
FT                   1067612..1067839))
FT                   /locus_tag="CNA03970"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1066202..1066334,1066385..1066440,
FT                   1066487..1066555,1066604..1066671,1066729..1066804,
FT                   1066854..1067140,1067188..1067278,1067327..1067450,
FT                   1067612..1067637))
FT                   /codon_start=1
FT                   /locus_tag="CNA03970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41342"
FT                   /db_xref="GOA:Q5KP72"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP72"
FT                   /protein_id="AAW41342.1"
FT                   /translation="MSLSSDLDKQIEQLKRCETIPESAVKELCTKAKEILMEEGNVQYV
FT                   DSPVTICGDIHGQFFDLMELFKIGGFCPETNYIFMGDFVDRGFYSVETFLLLLLLKVRY
FT                   PDRITLIRGNHESRQITQVYGFYDECQRKYGSSNVWRYCCDVFDYLSLGCVVDGRVFCV
FT                   HGGLSPAVHRLDQIRVIDRRQEVPHEGPMCDLLWSDPDEEIQGWGMSPRGAGFLFGRDV
FT                   VEQFNHANDIELVARAHQLVMEGYKLMFDRRIVTVWSAPNYCYRCGNTASVLELDENLR
FT                   QEYKTFDAAPPDARSIPQKRPMTHEYFL"
FT   gene            1068046..1069848
FT                   /locus_tag="CNA03990"
FT   mRNA            join(1068046..1068526,1068580..1069002,1069061..1069429,
FT                   1069478..1069848)
FT                   /locus_tag="CNA03990"
FT                   /product="expressed protein"
FT   CDS_pept        join(1068284..1068526,1068580..1069002,1069061..1069429,
FT                   1069478..1069537)
FT                   /codon_start=1
FT                   /locus_tag="CNA03990"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA03990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40925"
FT                   /db_xref="GOA:Q5KP70"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP70"
FT                   /protein_id="AAW40925.1"
FT                   /translation="MLLRSSHRHLLRTAFTISRSKPLHKPILPSSTMSQGVGYSSLTEQ
FT                   VTSAAAAASRTVSDLVNKYTVHDIAKTGFGEGTNDFYNAARPSYPAGALQVIHSSLPSH
FT                   PLKIVEPGSGTGIFSRLLLAPPNPTYPSFSIDTLVAVEPSEGMRNSWWKALEKAGLGKR
FT                   EENEGGKGEKKVGTVDGGFDSFGGAREYGVTEVQNGQGGVDGVVIAQAWHWCPDYDKAL
FT                   REIAAYLRPNAPLILIWNLEANNPQWQADLREAYQGYDLGSPQYYKGLWRKMFETPAYK
FT                   ELFDSSEEHTIPWSVGITEDGMLDRLFSKSYLTEQHLNGERREEFIRKIRDIVRQAPHE
FT                   WIDKEKGTFKYDYNTDIVICRRKA"
FT   gene            complement(1069598..1072776)
FT                   /locus_tag="CNA04000"
FT   mRNA            complement(join(1069598..1070028,1070082..1070147,
FT                   1070197..1071044,1071094..1071164,1071210..1071311,
FT                   1071364..1071499,1071549..1071669,1071726..1071814,
FT                   1071860..1071868,1071918..1072279,1072364..1072469,
FT                   1072530..1072776))
FT                   /locus_tag="CNA04000"
FT                   /product="conserved hypothetical protein"
FT   mRNA            complement(join(1069598..1070028,1070082..1070147,
FT                   1070197..1071044,1071094..1071164,1071210..1071311,
FT                   1071364..1071499,1071549..1071669,1071726..1071868,
FT                   1071918..1072279,1072364..1072469,1072530..1072776))
FT                   /locus_tag="CNA04000"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1069816..1070028,1070082..1070147,
FT                   1070197..1071044,1071094..1071164,1071210..1071311,
FT                   1071364..1071499,1071549..1071669,1071726..1071814,
FT                   1071860..1071868,1071918..1072279,1072364..1072469,
FT                   1072530..1072686))
FT                   /codon_start=1
FT                   /locus_tag="CNA04000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40927"
FT                   /db_xref="GOA:Q5KP69"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018829"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP69"
FT                   /protein_id="AAW40927.2"
FT                   /translation="MSTPAMATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRILC
FT                   VADIRGDYHELNRLIREHDATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPPAA
FT                   RTQLLAIPLSAGRSALINQLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDVNVI
FT                   EKFRTGEYGVQNLAILDEATSRLVEVGGVKLRLLGLGGTVADHKLFDYGEGHGSIAGAQ
FT                   GTMWTTALQIGELIDTAQRTFNPDETRLFVSTTPTSRNGLMTLVSNAIKADLTISCGLH
FT                   FRYPVSYNEYSIHPDFESYRRKMQRAKDDFKGLFDQVRDRVFGSLDDKQTALLHKTLSA
FT                   IENVPIADDGMWANTWHWSLSDAGFGNMLLSITDSRVSAETKSSGVNFAHRTGKGPAPP
FT                   TGSTISSAPSGLNSVKSLSSRPGPGPIGARPLPAQGVPSASGPHGAHGAPGAFLSQGRA
FT                   PVRPGMGPGFSARPPPGPRNTRQFGSNPASSMGGLSQSQMFAQAQAQAAVSGKTAAAAS
FT                   LTNGKKDEKNEKPEGEKGMNVEEKKEKLAANGNAAPDKIKDTDEKEEKDAKPIEKNEDK
FT                   EKSQDENPWGEDKEEKKGSNPWADDISDEGEKKDEDKTEFTEDAKPKRYSLYIKGLPTP
FT                   TTEEELKAVVGESGQKAIQVKIIFDQFTKQQKDFGYLDFDSEEVMNEALKASTGTIRDT
FT                   PVNVSISKPTVPRYNNRQFGGPGGRGRGGFRGRGRGFGSAGPRRERGEREGSGSGNATA
FT                   GGEKKA"
FT   CDS_pept        complement(join(1069816..1070028,1070082..1070147,
FT                   1070197..1071044,1071094..1071164,1071210..1071311,
FT                   1071364..1071499,1071549..1071669,1071726..1071868,
FT                   1071918..1072279,1072364..1072469,1072530..1072686))
FT                   /codon_start=1
FT                   /locus_tag="CNA04000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40926"
FT                   /db_xref="GOA:Q5KP68"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018829"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP68"
FT                   /protein_id="AAW40926.2"
FT                   /translation="MSTPAMATHAPQTNPTPAIVSEKVPLNTQALPKIVFAGRTGRILC
FT                   VADIRGDYHELNRLIREHDATAVIHTGDFGFMTAESVDRMNDKILRHLIQYSPLLPPAA
FT                   RTQLLAIPLSAGRSALINQLNNSSVHFPLSQFPHLLSGAINFPVPVFTTWGLVEDVNVI
FT                   EKFRTGEYGVQNLAILDEATSRLVEVGGVKLRLLGLGGTVADHKLFDYGAFYSKISKTT
FT                   EQLPGEGHGSIAGAQGTMWTTALQIGELIDTAQRTFNPDETRLFVSTTPTSRNGLMTLV
FT                   SNAIKADLTISCGLHFRYPVSYNEYSIHPDFESYRRKMQRAKDDFKGLFDQVRDRVFGS
FT                   LDDKQTALLHKTLSAIENVPIADDGMWANTWHWSLSDAGFGNMLLSITDSRVSAETKSS
FT                   GVNFAHRTGKGPAPPTGSTISSAPSGLNSVKSLSSRPGPGPIGARPLPAQGVPSASGPH
FT                   GAHGAPGAFLSQGRAPVRPGMGPGFSARPPPGPRNTRQFGSNPASSMGGLSQSQMFAQA
FT                   QAQAAVSGKTAAAASLTNGKKDEKNEKPEGEKGMNVEEKKEKLAANGNAAPDKIKDTDE
FT                   KEEKDAKPIEKNEDKEKSQDENPWGEDKEEKKGSNPWADDISDEGEKKDEDKTEFTEDA
FT                   KPKRYSLYIKGLPTPTTEEELKAVVGESGQKAIQVKIIFDQFTKQQKDFGYLDFDSEEV
FT                   MNEALKASTGTIRDTPVNVSISKPTVPRYNNRQFGGPGGRGRGGFRGRGRGFGSAGPRR
FT                   ERGEREGSGSGNATAGGEKKA"
FT   gene            1072876..1074700
FT                   /locus_tag="CNA04010"
FT   mRNA            join(1072876..1072937,1072998..1073828,1073876..1073978,
FT                   1074032..1074213,1074260..1074323,1074378..1074538,
FT                   1074586..1074700)
FT                   /locus_tag="CNA04010"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1072924..1072937,1072998..1073828,1073876..1073978,
FT                   1074032..1074213,1074260..1074323,1074378..1074538,
FT                   1074586..1074664)
FT                   /codon_start=1
FT                   /locus_tag="CNA04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40928"
FT                   /db_xref="GOA:Q5KP67"
FT                   /db_xref="InterPro:IPR024882"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP67"
FT                   /protein_id="AAW40928.1"
FT                   /translation="MSFGGFKFGNSSTTAPATGSAPTTSSPFSFGNTSTSNAQPAAGAS
FT                   NTGGGMFGGFGQNQQQQPQQPAGGGSSLFGSFGAKPAAPAAGTTGTGGGLFGGASGQQQ
FT                   QPPSGGGGLFGSTTQPQQQAQQSGSGLFGSTTQPQQQQQQTGGLFGSTMQPAQQSSGLF
FT                   GSTVQKPAGSGLFGSTTQPTQQSTGIGLFGSTAQTAQQPASTGLFGSTTQQQQPSTSLF
FT                   GQSTAQLGGSSLFGQTTQPPQNQQQELKTSANPGANTGADKTTKFSDLPEAAQKYIEQL
FT                   DTAIKNQKSIASTLQTEPLGRAIWQTSLDVKSATEEYSSISHTLKSLKNSISQLRDKMI
FT                   DQSRDVERIKEIWDIYTSGEGRMGQIRLGAYKEFPHEFFSKVANSMEERVTRYKKTITQ
FT                   LNRVVASLSSDSQTSSPQVIAQTINNHQQAILALAAQLDQLQVRMNGLKAEFTADWRDK
FT                   TGSVRDPFEMAREERNVKV"
FT   gene            complement(1074046..1075787)
FT                   /locus_tag="CNA04015"
FT   mRNA            complement(join(1074046..1074138,1074197..1074635,
FT                   1074724..1074745,1074804..1075787))
FT                   /locus_tag="CNA04015"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1074860..1075696)
FT                   /codon_start=1
FT                   /locus_tag="CNA04015"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHX2"
FT                   /protein_id="ALO60325.1"
FT                   /translation="MPTEVTPSPHQLAVNAAFYHGWSSMPSSGPAQASDLLPIRHIPGS
FT                   VMPNGLRNPWAHYHGETYAPSAHVAAVQGEHRFAGSDSYVGGGGSMIEGRAMSFAGGGG
FT                   GSVIAPSSVSLGGYREDDGWNGSMGRVHAGHAPDMSSTAGAISYVTPVGGAGGWLNQPA
FT                   SWGNHARMTPTVVAALAGSEVVHPVYGQSPSYSPIGGHHRSSSVPSSRRRNSVVEDCSP
FT                   CHSYVKSGHTRRTSTPVPIHAGSPMRRMKELPCDQGLKRSGSRRRIRRYSGTNYPE"
FT   gene            complement(1076587..1079033)
FT                   /locus_tag="CNA04020"
FT   mRNA            complement(join(1076587..1077780,1077831..1077998,
FT                   1078047..1078314,1078372..1078670,1078738..1079033))
FT                   /locus_tag="CNA04020"
FT                   /product="nucleus protein, putative"
FT   CDS_pept        complement(join(1076680..1077780,1077831..1077998,
FT                   1078047..1078314,1078372..1078670,1078738..1078938))
FT                   /codon_start=1
FT                   /locus_tag="CNA04020"
FT                   /product="nucleus protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40929"
FT                   /db_xref="GOA:Q5KP66"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR019601"
FT                   /db_xref="InterPro:IPR039558"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP66"
FT                   /protein_id="AAW40929.1"
FT                   /translation="MPAAVRERSPSSPSGRAAKKSRNNTEHAVLSSINHPSAEQVAAYR
FT                   EKYVNAAPFKHAVLSDLLSDDLLEGVVEESKKFGMRGEEGSLPGWGWEQKETDIYKIHQ
FT                   TPDLSSLSPEHLPDETLEALPLLTRLKDALYSQEFRNLVRQVTGCGPLSGTKTDLSAAL
FT                   YTKGSHLLLHDDSISTRLISYILYLPYSIEEAPESQNVALQRSTNGKFLKGWDPAWGGS
FT                   LELFSVETGEEVGPPSVKRFAKVSATWGQIVFFEVQPGRSYHSVEEVVIDEGRRRFSVS
FT                   GWFHRPVEGEEGYAPIDKEKEQKQLSSLAQITAAPSMPFTPYNTTPPPGLKPSDIAFLS
FT                   NYLSPSYLTVATLERLSGQFVEASEIVLHNFLQPELAAKLKAETEGVDKKDQASYEGLL
FT                   PPQELGEGDGWIIQGPSSKHRYLNLTSLTTSTPIVQSIHNVLFPSEAFRAWLSVVSSLA
FT                   PTGHRNEARRFRNGLDYTLANGEGKDGDARLDVSLGMTWWADVPAGSDEEDALVENGGW
FT                   EAYLAAPDEDEDPTVYQSSVAKKAVKEHSQEPKEPNGKKVEEKSKPQANGSSEKKDGPS
FT                   ISIGGQELEFDPDQFSPSDFDSDSEAGDEDDGPLLTQPVAFNKLLLVLRDPGVMKFVKY
FT                   LGANAPGSRWDVSGEFEVGVLEEEPAEDGAPEAEGSGEGKADA"
FT   gene            1079204..1080733
FT                   /locus_tag="CNA04025"
FT   mRNA            join(1079204..1079313,1079386..1079456,1079502..1079523,
FT                   1079564..1079747,1079797..1080031,1080086..1080467,
FT                   1080525..1080733)
FT                   /locus_tag="CNA04025"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1079250..1079313,1079386..1079456,1079502..1079523,
FT                   1079564..1079747,1079797..1080031,1080086..1080467,
FT                   1080525..1080694)
FT                   /codon_start=1
FT                   /locus_tag="CNA04025"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHZ5"
FT                   /protein_id="ALO60326.1"
FT                   /translation="MQAFQQPSQQSLAGRGRVATLGMFIIDHFEVHDEDGNPVPADEEA
FT                   IGGGGIFAMIGARQFLPPTHCSLLVDKGEDFPDKFVHDLESLGKEMVWFRHREGKTTRA
FT                   LNIYSGRRIGEGHQSFKYLSPQLQITPRDLVLPPSPFATPVPPEWIHVVCGVPRMLDIV
FT                   DELEFLEKQRHSSTGLSLIKSRLVWEPLPFSCVPEELNNMVSLSSRIAVFSPNLLELQS
FT                   ILSIPHSSPPAHSHVELAAQQFQTLLLNRSSGSQIPSIFVRAGELGAYTLSSNWTGWIP
FT                   AFWTEADQDKIVDVTGGGNSFLGGLVAGLLISDGDIRTASIYASTAASFAIQQRGPPCL
FT                   QQLNGEERWNGEVVWDRLNEMARRVSQQEGVDRRS"
FT   gene            1080985..1083082
FT                   /locus_tag="CNA04030"
FT   mRNA            join(1080985..1081118,1081185..1081830,1081889..1082030,
FT                   1082082..1082218,1082274..1082409,1082465..1082556,
FT                   1082621..1082749,1082805..1083082)
FT                   /locus_tag="CNA04030"
FT                   /product="cell division cycle 2, putative"
FT   CDS_pept        join(1081058..1081118,1081185..1081830,1081889..1082030,
FT                   1082082..1082218,1082274..1082409,1082465..1082556,
FT                   1082621..1082749,1082805..1082961)
FT                   /codon_start=1
FT                   /locus_tag="CNA04030"
FT                   /product="cell division cycle 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40930"
FT                   /db_xref="GOA:Q5KP65"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP65"
FT                   /protein_id="AAW40930.2"
FT                   /translation="MDSEGRNTAPLQPSPASPSRHQSPLAENQGSSSSISKGKKKSLLD
FT                   GEAHNGESPSSPGPISIKRRLVRPKKIRQSHGDVSPPTSVDPQMRQETLAFAEPEPLKP
FT                   ARSPSLRQSSKSPSRHPSPAASTPSFADAPLPPPPRSRFAPPRSSHPPLVSCRSVYNYT
FT                   RLNHIEEGTYGVVFRARCNDTGEIYALKKLKLDEEKQGFPITSLREVMALMISGGHENV
FT                   VGIREIVVGDTLNQVFIVMPFIEHDLKTLLADMPHPFLQSEVKTIMLQLLSAVAHCHAN
FT                   WILHRDLKTSNLLMNNRGQIKVADFGLARKFGDPLGEMTQLVVTLWYRSPELLLGGKEY
FT                   TTAVDIWSIGCIFAELMQGEPLFPGRGEIDQINRIFQLLGRPNDESWPGYSTLPLVQKI
FT                   NPIGPMFSTLRQKFKHLTYEGHNLLSSLLCYDPERRITAEEALKHPYFSEHPLPKHPDL
FT                   FSSFPSQAAGERKHKSLISPSAPVREDRMAKDSLADLDSFV"
FT   gene            complement(1082974..1085813)
FT                   /locus_tag="CNA04040"
FT   mRNA            complement(join(1082974..1083213,1083264..1083789,
FT                   1083847..1083967,1084014..1085201,1085252..1085360,
FT                   1085414..1085469,1085533..1085571,1085661..1085813))
FT                   /locus_tag="CNA04040"
FT                   /product="f-box/wd-repeat protein lin-23, putative"
FT   CDS_pept        complement(join(1083046..1083213,1083264..1083789,
FT                   1083847..1083967,1084014..1085201,1085252..1085360,
FT                   1085414..1085469,1085533..1085571,1085661..1085751))
FT                   /codon_start=1
FT                   /locus_tag="CNA04040"
FT                   /product="f-box/wd-repeat protein lin-23, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40931"
FT                   /db_xref="GOA:Q5KP64"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP64"
FT                   /protein_id="AAW40931.2"
FT                   /translation="MPGSPPLQRHVSTKAELLQKALTLPLELRRELATSLLWSMPRNEV
FT                   LALNERLNMMLQKDIVGLLPPELAFLILSRLDLGDILKCSSVSRTWRNLCNKQALWALL
FT                   CATNSPPIRPLPISWAELTTQYSLPPPTDDIEDPTFDISLSDDRLSNHYDVIDGQGGMG
FT                   GGGGIDPLGMSGGLRWNVWERGGAGSGEGLPVHLQRSAVNVQEFKKKEEPPITSHLAVP
FT                   SANPQANFKHLYIVHHILEQRMKTPRPIGMANYMPSPPEEVKVNMPSLPPVPRPRTIDA
FT                   ISSIKYGGLPGHSEAVYSLSLISHSMRINMLQACPDCHVQLAPPSNLSGITEGQFRLSV
FT                   METLSGAGTSPRRKLPNLSQAGGTRDLVTGRDWLLSGSRDKTLRLWQLSPAPRVVKIFH
FT                   GGHTGSVLTHAIVKVPCLPFISSPQSRFSKLEIGSSAKEAKERVKVMAVSGGSDGKICL
FT                   WDVEGGNGEPEKCVKAHEDSVLCVRADDERIVSCSKDKTIRLFSIHTLEPLLVIGGTAD
FT                   LYLHRGAVNAVGLSKDYIISASGDKTLRVWSIKTGALLACIEGHHRGIASIDFSPLPPS
FT                   PINLPDGQIFRGLIVTGSSDASIRTFHLIEDRIPDLQNLKMGHSMVTSATDGSEDGYSQ
FT                   ANTYGIPTELTGEGHKVILVPQGSFFSPCICPPGLSRMEGGVCRRCFNRGHLDLVRTVH
FT                   FGKGVILSGSYDATVKVWSPTGEIIADLHGAHTGRVFSVVGDRMRIVSSGLDCRINIWD
FT                   FSEGLDTSFVAP"
FT   gene            complement(1086022..1087860)
FT                   /locus_tag="CNA04050"
FT   mRNA            complement(join(1086022..1086366,1086423..1086825,
FT                   1086880..1087234,1087520..1087714,1087800..1087860))
FT                   /locus_tag="CNA04050"
FT                   /product="elongation factor 1-gamma (ef-1-gamma), putative"
FT   CDS_pept        complement(join(1086088..1086366,1086423..1086825,
FT                   1086880..1087234,1087520..1087714,1087800..1087827))
FT                   /codon_start=1
FT                   /locus_tag="CNA04050"
FT                   /product="elongation factor 1-gamma (ef-1-gamma), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40932"
FT                   /db_xref="GOA:Q5KP63"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR036433"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP63"
FT                   /protein_id="AAW40932.1"
FT                   /translation="MAPKLTGFPGNSRVRRVLSVAALAGVELEHDKSFTFASEWKTPEF
FT                   LEKNPFGFLPVLELEDGTTLRECAAIAEYIAEIGSNKNLIPSDPKLKAIVHSYQATADQ
FT                   EIFIPGGLANAMLYGKAPYHKAVFQTLVERVTGRLNVIDSILAKRTFLVGERVTLADIF
FT                   VVTAVTNIFTTWFDAPARAKVPNLLRFVETIINHPKLKEIFTPIEFSEKAPAPQPPVNK
FT                   DQKKKEEPKPKAEKAPKAPKAKEEDEEEEPAVPAEPKAKNPLDDLPKSAFNLEEWKRQY
FT                   SNLDTRGANGSLAWFYEKFDKEGFSIWRVDFKYNEELTQVFMSSNQVGGFFNRLEASRK
FT                   YLFGSVGVLGKANDSVITGVLVLRGQDAEPVVNVAPDWESYSFKKLNLDNADDKAFFEG
FT                   AMAWDLVENGREWADGKNFK"
FT   gene            complement(1088160..1090149)
FT                   /locus_tag="CNA04060"
FT   mRNA            complement(join(1088160..1088657,1088712..1089382,
FT                   1089436..1089686,1089747..1089855,1090030..1090149))
FT                   /locus_tag="CNA04060"
FT                   /product="methionine adenosyltransferase, putative"
FT   CDS_pept        complement(join(1088551..1088657,1088712..1089382,
FT                   1089436..1089686,1089747..1089855,1090030..1090085))
FT                   /codon_start=1
FT                   /locus_tag="CNA04060"
FT                   /product="methionine adenosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40933"
FT                   /db_xref="GOA:Q5KP62"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP62"
FT                   /protein_id="AAW40933.1"
FT                   /translation="MTAVNVNGNAPATELAPGHFLFTSESVGEGHPDKICDQVSDAILD
FT                   ACLAEDPFSKVACETAAKTGMIMVFGEITTRAQIDYQKVIRDTIKKIGYDSSEKGFDYK
FT                   TCNVLVAIEQQSPDIAQGLDHGALEKIGAGDQGIMFGYATDETPEMMPLTIMLAHKLNA
FT                   AMAIARRDGSMGWLRPDSKTQVTVEYKKGEDGAMVPLRVDTVVISTQHAEEITTEQLRE
FT                   EILEKIIKKVIPKNLLDDRVIYHIQPSGRFVIGGPQGDAGLTGRKIIVDTYGGWGAHGG
FT                   GAFSGKDWSKVDRSAAYTARWIAKSLVAAGLARRALVQLSYAIGVAEPLSIFVDTYGTG
FT                   KKSDAELVEVIRQNFDLRPGLIVQALNLQQPQYLKTAAYGHFGNPAYSWEQPKQLNF"
FT   gene            complement(1090249..1092590)
FT                   /locus_tag="CNA04063"
FT   mRNA            complement(join(1090249..1090479,1090540..1090560,
FT                   1090677..1091192,1091241..1091316,1091364..1091469,
FT                   1091523..1091601,1091657..1091799,1091854..1091966,
FT                   1092019..1092108,1092166..1092590))
FT                   /locus_tag="CNA04063"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1090820..1091192,1091241..1091316,
FT                   1091364..1091469,1091523..1091601,1091657..1091799,
FT                   1091854..1091966,1092019..1092108,1092166..1092451))
FT                   /codon_start=1
FT                   /locus_tag="CNA04063"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHY9"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="InterPro:IPR028207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY9"
FT                   /protein_id="ALO60327.1"
FT                   /translation="MTDDGLKQLLIYKSYRGPQYIRTTVTRHYSITMLISRLIPRPTLG
FT                   TIPMAIRSLPKTTFGPAWKFSQPIRMQSNRGPRIADVLENLNDLKKQHGPRYDELVVST
FT                   RALLNGLRDSQSLDQLIQDRPVNVDYRDVLRAVYSLAPNGESSEPCLKLNDLEKVIPPY
FT                   SNAVVWFMIYDLVTKKFVPRLEALDDKWKAMVKFNRIHGFGKIRARAFAEEGIETLNDL
FT                   MIAEGGRFSISGAQKLAIQYHEEMDVMIPRAEVEEFDGIIKDALRREDPKLNFAIMGSY
FT                   RRGENLSSDIDVVVWHESYVKKEKEKKRARKADPNSLMSKIVAALVSANIISPANIFSQ
FT                   GERKVLALTQLPKANSLHRQIDLRLCPIESLPYMLLGNTGDGKLMKIMRWRAIQRGWVL
FT                   NEYAMGERDGVSISHSKCRIYK"
FT   gene            1092825..1093461
FT                   /locus_tag="CNA04065"
FT   mRNA            join(1092825..1092930,1092981..1093108,1093184..1093461)
FT                   /locus_tag="CNA04065"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1092983..1093108,1093184..1093345)
FT                   /codon_start=1
FT                   /locus_tag="CNA04065"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIC1"
FT                   /db_xref="InterPro:IPR013174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIC1"
FT                   /protein_id="ALO60328.1"
FT                   /translation="MSKGTRFLTLAVPLLLLYILALYHIVPTPLLPTELADDILPVLPW
FT                   WLLVSFGAYSLTSLGLGLVRFHDCPEAYESLLSEISQARNELRNAGVAVD"
FT   gene            complement(1093401..1094496)
FT                   /locus_tag="CNA04070"
FT   mRNA            complement(join(1093401..1093609,1093668..1093820,
FT                   1093886..1094007,1094062..1094239,1094322..1094496))
FT                   /locus_tag="CNA04070"
FT                   /product="late endosome to vacuole transport-related
FT                   protein, putative"
FT   CDS_pept        complement(join(1093535..1093609,1093668..1093820,
FT                   1093886..1094007,1094062..1094239,1094322..1094432))
FT                   /codon_start=1
FT                   /locus_tag="CNA04070"
FT                   /product="late endosome to vacuole transport-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40934"
FT                   /db_xref="GOA:Q5KP61"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP61"
FT                   /protein_id="AAW40934.2"
FT                   /translation="MKSVNRWLYGPTPEEKVRSWQTKLRQQERQLDKEIRNLETATQRS
FT                   RIELKQLAKKNDVKSAKILAREVVRANKQRDRLESSKARIKSVNMQLQHQLSMVKVTGA
FT                   FQKSTEIMKTTNALVKLPQLSATMREMSMEMMKSGIMEEMMEETLDSVDDEEIEEEADA
FT                   EVDKVLYELTDGKLGQAGAVGAALPAEEEEENEEEMQRMRKEMQELLSS"
FT   gene            1094668..1098725
FT                   /locus_tag="CNA04080"
FT   mRNA            join(1094668..1094764,1094812..1094948,1095004..1095221,
FT                   1095276..1095358,1095406..1095746,1095792..1096012,
FT                   1096064..1096176,1096227..1096606,1096663..1097796,
FT                   1097849..1097930,1097989..1098542,1098596..1098725)
FT                   /locus_tag="CNA04080"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1094722..1094764,1094812..1094948,1095004..1095221,
FT                   1095276..1095358,1095406..1095746,1095792..1096012,
FT                   1096064..1096176,1096227..1096606,1096663..1097796,
FT                   1097849..1097930,1097989..1098542,1098596..1098631)
FT                   /codon_start=1
FT                   /locus_tag="CNA04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP60"
FT                   /protein_id="AAW40944.2"
FT                   /translation="MWLLTVVGEILGQKHYTFALQQQKSYTFGRNKDCDIAFPNNLRVK
FT                   PEEGTLEILEWDYTNRHSRPDIKWRPKPKKNGDYGTIVAVGKRPETPNGSLNKGDYDIL
FT                   PINNEKGSGVFVDELNVTGISFADDIWFFLEWRDLCLLYGKMMDEPDPIRNTLKSYCIS
FT                   WTTTFDTSDPPQYVLLDTYRNNWEARYAVCCGIPILLPSFLALLQSRLTINWRKTADAF
FT                   CSFKFPLPGEDEAEYRPKNHQSIRFSSSIWLPDRRRRTLYRGWHVLLLREQIQPREAFM
FT                   YKALGADLQEVIVEGNPPKTSSDVEEYLADWLSYVDTHGGRKKGLVAYSGKVKDMTDAK
FT                   IIEDTCERLKVNCASVASAFGAVLNGGVHQFLEGVDNKHNRHAARGSITAITPAASSSV
FT                   PSPAADPFRRLTETPTPALTPTPPSEPTVTSVVAESSNAPGVPSTFSDETTPPVPFEPP
FT                   RLSRRRTAYTKPIIADATPVPVASSEPQHVAVNADGTEEAVDEWRPPPVAVLRRPQRRT
FT                   VGKGARNTPTSAPAPAQPLATPQFNGTDTHVTSLDPHPSFAPNSMPSQEEDSPGVAPGP
FT                   SRAGLSDFPSSTQQNTMPPIQTLPRPSRRYGTTSSIARPQAAPSRVAFEETVEEEEDDR
FT                   LKKLYEKTRKQGFGPASLAKKVRTADRGGDVEMEDTQISSAASMTDRERYKAPSEILHI
FT                   DEEPEEEEEEQDLFAQTMRRSKRPASAAGLSATQGTAPEVRSKDIGGRDSQDLMPPPAQ
FT                   RRRIQSPSPSPEPGPSEDQAPRRAAPSQNRFDFQDAIPQPMTRDEQFLRVVAERKKAKA
FT                   AIDNLDKSFDSMLRIPKAQTESEADKPDYSVLDEVPPPKAGNYIAVMRTNSLFRKDLGQ
FT                   TKERENVEDGRPNFKKFKRKNVPRRAPLKMVLTTSVVDPSKYEEPEPYWPTQKKTQKKS
FT                   QAQSGSLSDPEEDDRPLLPRHKPRLLVEDDNEGDGDVKFMATGQAAAGRRGTQRNQIRD
FT                   NRVTLGTSAQRTKGGESVASDTYDDQAARSDVSKTTHSKAATKATAARGRNKLLVEDND
FT                   TTIDWASSPSTAKGGKSSFESSGTATLDENPSSTARKGTQKRKALAVDVDDDEGGFGNF
FT                   GKRRRR"
FT   gene            complement(1098699..1100482)
FT                   /locus_tag="CNA04090"
FT   mRNA            complement(join(1098699..1099032,1099085..1099646,
FT                   1099699..1099781,1099833..1100076,1100129..1100265,
FT                   1100315..1100482))
FT                   /locus_tag="CNA04090"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1099549..1099646,1099699..1099781,
FT                   1099833..1100076,1100129..1100265,1100315..1100424))
FT                   /codon_start=1
FT                   /locus_tag="CNA04090"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40946"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP59"
FT                   /protein_id="AAW40946.1"
FT                   /translation="MEQQQPNHDMREDQQDYSFSEQNVSQEMSEEGWRALAKIVRDVNP
FT                   NLSPDEELGDLAAAEAAVNAKDAERTEIVDKLRDELRQLSRQHSQAAAAAQRPPSHPSP
FT                   AEHEANVRSLEQQQFSIAKQLNEEQAAVAKKEVELGKWKTAKEDIEKVEIGEGDWADGK
FT                   VIRLKLFSEAGFSLVSAKDGSNVTKVLIRNDAKEDVHSVVVDNSRPKVYTANLIWSLAS
FT                   D"
FT   gene            1100700..1102643
FT                   /locus_tag="CNA04100"
FT   mRNA            join(1100700..1100856,1101017..1101257,1101389..1101898,
FT                   1101955..1102247,1102318..1102643)
FT                   /locus_tag="CNA04100"
FT                   /product="choline-phosphate cytidylyltransferase, putative"
FT   CDS_pept        join(1100754..1100856,1101017..1101257,1101389..1101898,
FT                   1101955..1102247,1102318..1102532)
FT                   /codon_start=1
FT                   /locus_tag="CNA04100"
FT                   /product="choline-phosphate cytidylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40948"
FT                   /db_xref="GOA:Q5KP58"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR041723"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP58"
FT                   /protein_id="AAW40948.1"
FT                   /translation="MSANPPAQKRHNRNRLGERRVNRDPSSSRDASEEDNDNVENSFSD
FT                   VGSMNSYHAEALSTTSTIDSPTRMPPPALPPHSSSGSPSTTQAGRRSYQQRRVEELNGE
FT                   GSQSEGLDSPTYDGDVESSSTIGGAPAHHQHTHFRRPSFPAPVPTSETPHPAAHIVQRQ
FT                   PTPKASQIGFSAADYPAVPTPKATYVRPSDVPVAPSVALEECARSPPTTSWIQSPNSAG
FT                   GPPKMYARAVERTEEDIKGFVERAIHGRGQEDGVERWWKTNPPPEGKVVRVYADGVYDL
FT                   FHFGHALQLRQAKLSFPQVHLMVGVCSDVLCAQHKSAPAMTHAERCEAVRHCRWADEVI
FT                   PDAPWVVDQAFLDKHQIDYIAHDEEVYPSKDHEDVYAFAKKEGRFVPTRRTPAISTSDL
FT                   LERIVRGYRDGFFDSKLEKNGHPELLAADVDWDSSASMEKREKRKAAHHHKVKK"
FT   gene            complement(1104158..1106876)
FT                   /locus_tag="CNA04110"
FT   mRNA            complement(join(1104158..1104338,1104412..1104482,
FT                   1104539..1106236,1106298..1106876))
FT                   /locus_tag="CNA04110"
FT                   /product="ER organization and biogenesis-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1104317..1104338,1104412..1104482,
FT                   1104539..1106236,1106298..1106771))
FT                   /codon_start=1
FT                   /locus_tag="CNA04110"
FT                   /product="ER organization and biogenesis-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40950"
FT                   /db_xref="GOA:Q5KP57"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP57"
FT                   /protein_id="AAW40950.2"
FT                   /translation="MTMAQKQAAIAEERRRRDEAQRKQFEADGAFWENLGSRSSAATSA
FT                   SSRSNHGTFWDQYGDDGDLLSAGSNPVSQPRSHAHSPAPLPPAHTDPFDFDAFENTLNG
FT                   SAKAALASEASNSGETSAIRTPVSNVDLWDGDGNDDDLLGELGRPAASKPAQTKSTLPR
FT                   TPQEPPPASPPPHIVGQIVEMGFAPTQARQALAKTSTGTDVQEALELLLGSGQGQGHAP
FT                   GNAGPSGSWDDHLPEADDDRIEYERRKRQEAEKERRRRRRAGPSRDSVKARTTEEQERD
FT                   AAAAAANAQEQAERILAQASEIGQSMFNKATSFWNTSKERAIKVYEEQRKALEAAERGE
FT                   DQKKKDTRPKWMQENEGWKDERSRQVRGGFKDSDDEQEIGPSIPAPRREQRPARQEGIA
FT                   DLLSGNDHHPAHRPTSRPTSRPASRAAPSPKPAAPPLPRRPLISATPLQLESSAAHKTK
FT                   GNDHFKLGRFTEAESCYSSAIAALPKDNLFLIPLLNNRATTRLKLGDAVNAATDCTAVI
FT                   DLVGISYHPGKEAPLPAEYADIKLGDGLSKALVKRAQAWEMGEKWKAALEDWERVMGLD
FT                   PVLLGGTNAAASTRNMAAQGARRAKKMMQSGGNVAAAAPAVVSSPAPSTPAADVNRSAA
FT                   VADLRKAAQALEAEEEARLFHKDNVDAKIANWKSGKETNLRALIASLDTVLWDDIVKEG
FT                   GLKVGMHELVTDKQVKIKYMKVIARLHPDKLNTQNTTVEQRMLANGAFGVLSDAWQAFN
FT                   Q"
FT   gene            complement(1107116..1109185)
FT                   /locus_tag="CNA04120"
FT   mRNA            complement(join(1107116..1107218,1107275..1107605,
FT                   1107655..1107815,1107871..1107999,1108058..1108351,
FT                   1108415..1109185))
FT                   /locus_tag="CNA04120"
FT                   /product="Type 2C Protein Phosphatase, putative"
FT   CDS_pept        complement(join(1107194..1107218,1107275..1107605,
FT                   1107655..1107815,1107871..1107999,1108058..1108351,
FT                   1108415..1109169))
FT                   /codon_start=1
FT                   /locus_tag="CNA04120"
FT                   /product="Type 2C Protein Phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40952"
FT                   /db_xref="GOA:Q5KP56"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP56"
FT                   /protein_id="AAW40952.1"
FT                   /translation="MLSPHHARPYSTPSARPPSVKTTAFVSIALLTSAYLLYRHESESA
FT                   PGKHAVSPSSLLSGGKPTFQLSIRSGRGGVQTYEFERKPDDQVERELRAHEVSRRIDRK
FT                   GNPVVRWDNNWLGSNEPCEDRWATDLVRRDGAAGGAVGKAVNFWTRWYRGDSIPSESAP
FT                   AEEDEAARGKHDLMLFSIMDGHAGDATSRLLQKSLHPTISMALAGLQRGNVPPRHNVWE
FT                   RWAGYLNPWYWLGTDTVWTPENVSKTIQNAFVQLDDNICQTPLKLLPTLSSPSTSSPTP
FT                   RETLVALAQPAAAGACAISTLVDSENDDLYVAVTGDCRAVAGWEGEDGKWRCDVLSEDQ
FT                   MGDNPKEIERMRSEHPASERDTVIRNGRVQGGLQPTRAFGDAVYKWTNAQAAQIADAFR
FT                   AQGERPRPGRPWNYTPPYVTARPEVTYRKLNAHTGEKLRFIVLATDGLWDRITSEESTL
FT                   LLASYLSHPSHAPLPKSALPRRFPLAPPPPREKRPYPAQDLPAPTGEAASDTWVYEGDA
FT                   NAATHLIRNSLAGGDVKTRAELVSLGGKVSRWMRDDITVTVVFFGDS"
FT   gene            1108955..1110670
FT                   /locus_tag="CNA04130"
FT   mRNA            join(1108955..1110263,1110333..1110405,1110468..1110670)
FT                   /locus_tag="CNA04130"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1109247..1110263,1110333..1110405,1110468..1110601)
FT                   /codon_start=1
FT                   /locus_tag="CNA04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40954"
FT                   /db_xref="GOA:Q5KP55"
FT                   /db_xref="InterPro:IPR013635"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP55"
FT                   /protein_id="AAW40954.1"
FT                   /translation="MGLLAVLAFTQGLATFSQVLLGLPAALALLGPASFLLLSLLYTAH
FT                   HLLYATLRLALKNTPLAPLVSVAAVLSPAISAALALLTLYFYLAPPAPGATLAHCLVNI
FT                   LPFAYAQLLRWVSPLFTLLEGISTLLVIQVAGRVGKGWADEEDRDEGLEWRTVVALVAA
FT                   ALVYCAGLAGVVKTFPSLPFPAFLLGAALTAVLFLSLIGFSLKRTNVLETSLVFVYVVY
FT                   SAWLSGVEAEMPSGTFGSSSSSFPPPSPLRQSHPLPSTVGPSVNSLLSYALHAAVPSFI
FT                   TVSETLPPHLVLSLIYRVTVLHLAAKIVPVLRRASMGWDDRDEREGFWDGRTLGDEPAN
FT                   MRITTVFLSYRRAILIAVYTHLLLLDGGSQTWWRWVNIALLLSVWSLELLLDAEGDDTD
FT                   SVTRWKVD"
FT   gene            complement(1110644..1112882)
FT                   /locus_tag="CNA04140"
FT   mRNA            complement(join(1110644..1111913,1111967..1112046,
FT                   1112106..1112455,1112523..1112882))
FT                   /locus_tag="CNA04140"
FT                   /product="tRNA dihydrouridine synthase, putative"
FT   CDS_pept        complement(join(1110706..1111913,1111967..1112046,
FT                   1112106..1112455,1112523..1112717))
FT                   /codon_start=1
FT                   /locus_tag="CNA04140"
FT                   /product="tRNA dihydrouridine synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40956"
FT                   /db_xref="GOA:Q5KP54"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP54"
FT                   /protein_id="AAW40956.1"
FT                   /translation="MSVAAQVVSSEGPQSVGDELQTKKQFPTFPAPGKPTHEKLGGYDF
FT                   YRSIGSPKFVVAPMVDQSELAWRLLSRSPLPPALAGPSETVTTPQGKAYIRHPGGAHVC
FT                   YTPMIHAKVFVDAKGEGGRNGDGQFCLSLDEEGGEGTIGGVEGGDRPLIVQFCANDPDI
FT                   LLAAAKKVEHRCDAVDINFGCPQGIAKRGHYGSFLQDEWELIHKLISTLHENLSVPVTA
FT                   KFRIFPDLDKTIAYARMMEAAGAQILTCHGRTREMKGQNTGLADWEYIREVKKAVKVPV
FT                   FANGNILYREDVDRCMEVTGCDGVMTAEGNLSNPAIFMPPEHPHAHPPITVLAHRYLDI
FT                   VEALDTPTAGSAIKAHLFRLLKPVLDTDEELRVQIATCRWSDGMDGFREIIRDIERRCA
FT                   PVREALGADWRPPTVDPKTGYRSLPMFAAQPQIRAKPVSTEIGGHEDMVSRPVSPGKEG
FT                   EGRMFDTPNITTAPASSVPGTVLFSRSHRHTSLGQTERCVHSDCTGVAATRCPTRACIT
FT                   HCRILRAVEAGYTREEAEAEGAKGGLVGMGCDAHEEKVRARKEREARKRKGREMAKEKA
FT                   KERKKEEKAKEEREKSKEKVGMTEEEVSFAAGLA"
FT   gene            1112989..1113890
FT                   /locus_tag="CNA04145"
FT   mRNA            1112989..1113890
FT                   /locus_tag="CNA04145"
FT                   /product="hypothetical protein"
FT   CDS_pept        1113013..1113750
FT                   /codon_start=1
FT                   /locus_tag="CNA04145"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LI68"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LI68"
FT                   /protein_id="ALO60329.1"
FT                   /translation="MASCLAASSSFGSRLHRTVCVLCPGVARGFSSSSIGCWRQDSPSD
FT                   RFSGTARGARGGVIGEKAPKEKVDAPEALPNPPKSKKARHRPLLRPPSHPVQTLPSSSA
FT                   PTPQHTPHTPSLPEAVAHKPHGPWQPTKKLTFSAMAGLRALHTLDPERFSRAFLSRKFG
FT                   ISHEAVTRILKSKFRGQKIDGIEGLDGVMGLLNEEASEEAPPGGLGQPDLRGTKWDKAP
FT                   ETSERVSPVPAIMRAYRQSRRSR"
FT   gene            complement(1113762..1117895)
FT                   /locus_tag="CNA04150"
FT   mRNA            complement(join(1113762..1113925,1113976..1114041,
FT                   1114090..1114815,1114862..1115350,1115402..1115725,
FT                   1115728..1116665,1116711..1116788,1116838..1116847,
FT                   1116901..1117895))
FT                   /locus_tag="CNA04150"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        complement(join(1113899..1113925,1113976..1114041,
FT                   1114090..1114815,1114862..1115350,1115402..1115725,
FT                   1115728..1116665,1116711..1116788,1116838..1116847,
FT                   1116901..1117818))
FT                   /codon_start=1
FT                   /locus_tag="CNA04150"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41348"
FT                   /db_xref="GOA:Q5KP53"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP53"
FT                   /protein_id="AAW41348.2"
FT                   /translation="MILIRHKSCSLASLVGLTLPRATCRAPQQYRSSSSAAIPPADQEE
FT                   HQSKPLTGSARLFADAEAEEKVTSNASNRDHLRMTQGPVWTGDESPADAVLRMLVDAHK
FT                   PLRNEGGVKHNAADEKIKGWMKGLQLEPILGPGPSLPPEEAQEIALESVEKENAHRTKI
FT                   PPHLHRPWHSTYTGEYQTAETPKVKYGAFTNKRTDGDSLTNLLELQLPPNADSKTRAKV
FT                   KAARKSTMFMGRLDKAREGALDYKLGLGVDDAHVVETGEEGEVSEEGQTFKGNRQIKGS
FT                   SVLGAQRGSASGMKAWAGLVEDRILRAREAGFFNNASGKGKPIVADPEARNPHIERGEL
FT                   FMNRIIKRQGALPPWIELQNLLDSNLRSFRATLLTTYKTQLVRNIISTNALHPLPPLHA
FT                   IPDRDEAWEAREFKFHQENVKQINDLVRRMNAQAPSPARRHLITLEGELNRIRGNMLKN
FT                   EVWEEIKRRAEESINMPYQRERSGLAAFIFEGENWTKLKNATNRSFGTVAVSGTAPLAN
FT                   ANVSGLEGSSKGYSGDPTGDHSSGPSSYSGRDPRPLRLVVMAGVGVGVIIYLRRRPVKN
FT                   DSAHLNPFHHHLQPTPTPQPDIVASSPSEPPLTFIRIIEIYILEPIGTFFRFLHLACLF
FT                   VPVILLSPMLLVGPGKRRRSRSGRPISEEEQSWGAIWWYGFLVKQMERAGPSFIKLGQW
FT                   AASRADLFPAELCEKMSKLHSNGRPHSLGYTKKVMEAAFGMGFDDIFEEFDEEPIGCGA
FT                   IAQVYKAKLQSKILTDTKLDGLPRSTESDTASVAIKVIHPRVRKIIRRDIAVMSIFAKF
FT                   VNAFPGMQWFSLPEEVQVFGEMMNSQLDLRVEASNLDKFLHNFGKRGRRVTFPTPIKLG
FT                   DGKEELEEEMKDILVEEFEDALPLKFFLQNGGGPYDHKIANIGLDAFLEMLLIDNWTHG
FT                   DLHPGNIMVRFYKPTTTDYLSPLLHAFGKNPTPSTDASVASHDNLVHTLAAVSRDREKW
FT                   LNKLDELHQDGYEPQLIFIDAGLVTSLDSKNRANFLDLFQAVAEFDGYKAGKLMIERCR
FT                   TPDFAIDEETFALKMQHIVLSVKSKTFSLAKIKISDILTDVLKAVRQHHVKMEGDFVNT
FT                   VISILLLEGIGRQLDPDMDLFKSALPILRQLGKQMGTREAIQATPTGNILAMIKLWVWV
FT                   EARQVAGEVSTLDEWMKYDRLTPSI"
FT                   /artificial_location="low-quality sequence region"
FT   gene            complement(1119099..1122225)
FT                   /locus_tag="CNA04160"
FT   mRNA            complement(join(1119099..1119375,1119436..1119584,
FT                   1119641..1119907,1119960..1120031,1120104..1120283,
FT                   1120334..1120521,1120575..1120664,1120713..1120769,
FT                   1120830..1120901,1120952..1120982,1121035..1122225))
FT                   /locus_tag="CNA04160"
FT                   /product="transporter, putative"
FT   CDS_pept        complement(join(1119335..1119375,1119436..1119584,
FT                   1119641..1119907,1119960..1120031,1120104..1120283,
FT                   1120334..1120521,1120575..1120664,1120713..1120769,
FT                   1120830..1120901,1120952..1120982,1121035..1121852))
FT                   /codon_start=1
FT                   /locus_tag="CNA04160"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40958"
FT                   /db_xref="GOA:Q5KP52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP52"
FT                   /protein_id="AAW40958.2"
FT                   /translation="MSSEQANTAIQPVFEARPVNRRTESSTSIEAVTSNRMTMASSSAT
FT                   LCQLGEHDDKPSMPDAEHPPAIPEQASGYSKSEKSQVPTRQSSTKHAHPHSHSHQHQGA
FT                   TPPPVPAPDVVSVFDPASIGGGGPLKRIETQRSERYAEEMREREAREADKSEKKSGILR
FT                   RWSTVSRRRPVMIMPPHTHRHSEDEVSPVDDDRDPRHERSSSNISNQTLAITPTPGERE
FT                   KCDFSDDKEEGRCEAEKHMQEEEVEEHVYPDGGYGWVVLGACCCLAGCTMGWGMNWGVF
FT                   QEYYLDSVYPNVNTSVLSLAGTLCAFMMNATAFISGRYGDRYGFKRVLYCSAVITWLGL
FT                   FLAGWSTKLWQTILTQGILTGFGQGLSLPLFMSLPSQWFYRRRGLASGLAIGGAGLGGG
FT                   TTTLICRELLTRVGYRKTLWILACINLFCMSLSTFLIRTRPSSPEGKATGKGPWIDWAV
FT                   VKTSSFWSLVIGLVVSTTGYAMPFNFTAQWTRLHFPNLNPILLALPVTLLGYTVCVGRA
FT                   LIGLIADLLGPMNTFILCFFLSGVVQLCLWLTASSFASVLVFAIMFGLVAPGYMGIIPQ
FT                   IIVQLFGPTNLATNVGILLLFNGPGNLMGGPIGGALYDASGRTSFKYMIITGGCLQIAG
FT                   GLIICWARFKTSRKWLKKI"
FT   gene            complement(1122817..1124403)
FT                   /locus_tag="CNA04170"
FT   mRNA            complement(join(1122817..1123036,1123094..1123180,
FT                   1123234..1123480,1123530..1123627,1123681..1123709,
FT                   1123759..1123933,1123989..1124403))
FT                   /locus_tag="CNA04170"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1122849..1123036,1123094..1123180,
FT                   1123234..1123480,1123530..1123627,1123681..1123709,
FT                   1123759..1123933,1123989..1124313))
FT                   /codon_start=1
FT                   /locus_tag="CNA04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40960"
FT                   /db_xref="GOA:P0CQ68"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017408"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR026480"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ68"
FT                   /protein_id="AAW40960.2"
FT                   /translation="MDMDSAHLDSSLLTLAFRLIKAAQTAAPSVLADLLAEGAPAWFQD
FT                   DDLGWSCLHYAAERKEPECLEVLLQGGAVWNAVDKWGRTAGEICLSLGDEEGWSIIRNE
FT                   GIRSEMLHHALSGTSSPDATNNIVLRAEDKTSAGDNLVFLKSKLTWDVGKDGKERVLDA
FT                   DGNGVMMGWEEPLMVEHVKRLTEEHPKAELGAEGMSILNVGFGLGIVDRLFQECDPKPS
FT                   HHTIIEAHPQVLEYIHKKGVHLLPNVRILQGRWQDWLLDGEKVGDVLSGTPDGMGFDAI
FT                   FVDTFAEGYEDLKAFFEVIPDILNADNGRFSFWNGLGATNPTIYAVSSSLAELHLEDVG
FT                   LQVEWHDVLIPESMREEVWKGVRRRYWDLPGYRLPIAKMSLI"
FT   gene            1124451..1125642
FT                   /locus_tag="CNA04180"
FT   mRNA            join(1124451..1124901,1124949..1125281,1125348..1125642)
FT                   /locus_tag="CNA04180"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1124547..1124901,1124949..1125281,1125348..1125496)
FT                   /codon_start=1
FT                   /locus_tag="CNA04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40962"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP50"
FT                   /protein_id="AAW40962.2"
FT                   /translation="MEDRQQPYRRPTKRRRLPQSGPLSSSASTSASPPALSPTLDKGKG
FT                   RAIHDLGLEEDPYDKDCTVEVSTNDSEDEVEEGNLIEDDQGGSSSRGKQAWAMRKARRV
FT                   ERLREAEKYIHIPPMPPPSNPTSDLLQAIHHHASHFYTSTSLLIPPKKRQRAAPWASKK
FT                   RVEVLKDSLLSKGHAQGIESLVNERGEFVSVAREEKVDGGDIRGPRGKYKVRDMYRAIE
FT                   GEGLMAIGIILQEYVIRTLREIGYQPGEGSQAGIESKGDNEAQGGNEEEENGGPER"
FT   gene            complement(1125609..1128715)
FT                   /locus_tag="CNA04190"
FT   mRNA            complement(join(1125610..1125812,1125867..1126477,
FT                   1126531..1126617,1126669..1126694,1126742..1126806,
FT                   1126859..1126921,1126973..1127236,1127287..1127415,
FT                   1127463..1127816,1127872..1128001,1128054..1128283,
FT                   1128363..1128715))
FT                   /locus_tag="CNA04190"
FT                   /product="palmitoyltransferase, putative"
FT   CDS_pept        complement(join(1125651..1125812,1125867..1126477,
FT                   1126531..1126617,1126669..1126694,1126742..1126806,
FT                   1126859..1126921,1126973..1127236,1127287..1127415,
FT                   1127463..1127816,1127872..1128001,1128054..1128283,
FT                   1128363..1128572))
FT                   /codon_start=1
FT                   /locus_tag="CNA04190"
FT                   /product="palmitoyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40964"
FT                   /db_xref="GOA:P0CS66"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS66"
FT                   /protein_id="AAW40964.1"
FT                   /translation="MDQEMTTVASPDIRVKATSPDSNRAVLEQSIVLSDSGRLDEGSSI
FT                   RGGELERDSQEVGRETVREPLMCHDLDIHALAQRGDTAAIAAMLQENPSLNLSARDAQD
FT                   VTPLHWAAINAHMGTCRLLIDSGADIDAIGGELKATPLQWAARNGHLYVVHLLISRGAD
FT                   PNIHDSQGFNTLHLITHSSAVMPLLYMLHQPVAIDEKDTDGHTALMWAAYQGDALSVDL
FT                   LIRHGASVNSTDNAGMTPLHWAAVKGNKVSIMHLVEAGASLDAKEEAGKTPRDMAEELR
FT                   GLVPFQKGLEEAGWSIDGVKMEGKLGPRNTILAIFLLPIAVLWLIFSTFKWLPVYVGVP
FT                   FAIAEFMGMQYTVVLVLLGHIKAQDKVSTSNYFASIITASLIWVGYCWISRFAVNTPGY
FT                   AFSNLGFIIMFVGCCWTFWTAIVTDPGFVPKGQQDAEIKEVLEDLVDAGRLNGTNFCIV
FT                   CMARKPLRSKHCRTCNRCVARFDHHCPWIWNCVGAKNHRSFLLFVLFLIGGIILFIRLT
FT                   IAYIQQNAPEYIPTPNPGLTTCDISTTLCQAGDFDPFLLCMALWSTLQLTWTSVLAISH
FT                   LWQVSRQMTTFEVSNLGRYGFMGGRGGQSLRDQSGAMLKQAAAVGAGIGMSGAGEEAAG
FT                   PPGAEAGPEGNALLPPPGGHVHGPQCRHGDHARGHSHGVLHICGALWKTLTGPLMTILG
FT                   LDRFTKGKALGGMKRAGRDQNPFDMGMVKNCIDFWLPDNDVDYMTVYEIPPGGWRAYRR
FT                   KLAMDKRVPGGKGRYEVVSEQEV"
FT   gene            complement(1128911..1129704)
FT                   /locus_tag="CNA04200"
FT   mRNA            complement(join(1128911..1129227,1129276..1129383,
FT                   1129438..1129704))
FT                   /locus_tag="CNA04200"
FT                   /product="ubiquitin-protein ligase, putative"
FT   CDS_pept        complement(join(1129046..1129227,1129276..1129383,
FT                   1129438..1129642))
FT                   /codon_start=1
FT                   /locus_tag="CNA04200"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41350"
FT                   /db_xref="GOA:Q5KP48"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP48"
FT                   /protein_id="AAW41350.2"
FT                   /translation="MKVEINSYRAVAYWIWDVSDEPHKLYHYAPPDEVGLDDDDDQDVC
FT                   GICQAAFESTCPDCKIPGDDCPLIWGECTHVFHMHCLLKWIGQKEDESQQQCPMDRRPW
FT                   VTADRKPDKQPAASPGQVVQYDHLEHGHASQLDERLTGARGATTRGAHAQVESSMEVDE
FT                   Q"
FT   gene            1129873..1131045
FT                   /locus_tag="CNA04210"
FT   mRNA            join(1129873..1129913,1129973..1130060,1130118..1130549,
FT                   1130614..1131045)
FT                   /locus_tag="CNA04210"
FT                   /product="expressed protein"
FT   CDS_pept        join(1129900..1129913,1129973..1130060,1130118..1130549,
FT                   1130614..1130997)
FT                   /codon_start=1
FT                   /locus_tag="CNA04210"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41344"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP47"
FT                   /protein_id="AAW41344.1"
FT                   /translation="MGFTLLLQWSCTPPAGRAVSLADVVCARVLESYGHNPPSRLGLQV
FT                   RTYRAQFPLSPTTDDNNQDNNNQVSRYLTIISNLMPPAQPGEAKTNAPIIKDDTAYLFL
FT                   DDRSSTATGGESEHVNRATETSTAAHSSDPIPLQMDEEGKRFRCVAVRPSTAVIPMLQS
FT                   LLSPFVMGLTKAARTTASQTSSTPVPTSLPGSTLLMTVLTFNALLSPQPPVILRLYILP
FT                   NQSASSIFLEGEYAGSVDGKSEEEIEGEVKKYLESCLITDLLGERRWIDCSRGQENWRA
FT                   WDDAERNKCAMLTLAKTLRQGNFI"
FT   gene            complement(1131019..1135301)
FT                   /locus_tag="CNA04220"
FT   mRNA            complement(join(1131019..1131226,1131279..1131343,
FT                   1131400..1131621,1131675..1131803,1131845..1131886,
FT                   1131938..1132255,1132310..1132603,1132656..1132739,
FT                   1132794..1132999,1133047..1133218,1133269..1133350,
FT                   1133399..1133655,1133714..1133886,1133948..1134135,
FT                   1134186..1134350,1134404..1134609,1134667..1134802,
FT                   1134857..1134915,1134975..1135106,1135172..1135301))
FT                   /locus_tag="CNA04220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1131127..1131226,1131279..1131343,
FT                   1131400..1131621,1131675..1131803,1131845..1131886,
FT                   1131938..1132255,1132310..1132603,1132656..1132739,
FT                   1132794..1132999,1133047..1133218,1133269..1133350,
FT                   1133399..1133655,1133714..1133886,1133948..1134135,
FT                   1134186..1134350,1134404..1134609,1134667..1134802,
FT                   1134857..1134915,1134975..1135106,1135172..1135264))
FT                   /codon_start=1
FT                   /locus_tag="CNA04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40945"
FT                   /db_xref="GOA:Q5KP46"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP46"
FT                   /protein_id="AAW40945.2"
FT                   /translation="MESLTMDEESPTPSLVSFPVLPQSDLTQVAQTILQLFDPATSSNP
FT                   AQAKYLQSELQKIQGTPEAWGLIAGLANHEDTNVRFFGAHTAQVKISRDWDTLPQELHQ
FT                   GLLALLLETLSGAINPKNPHSYQPGNAVVVRKIFGSLASLLLRLEFTIFSHPIHTVIQS
FT                   MQYAFSQADTQSIGVNLALRLRLLELEWCAICVEEMGRAGLAEQRRAAIRRHVESDLKV
FT                   VVRTVIRSMNGDNASSTDERLREAEAACKCVESWIDWGLGADELNEVLPVLYNLLPLPA
FT                   ACSAVVEVLSESIFKYGKGTKILTEPLISWATGPSGQSILGLTEEDPSEEAVAFAKLVA
FT                   ALVEHSSEWLVAHIQESQVQTFLGMVLRITGWKGIAGVEENISELTLPIYSLLQEALMD
FT                   SDLFQAPHQTHPAWLIAKQFFAELVSVTRRKVRWPGEGEVPHGDTLGGLEKDDREAFSR
FT                   WRRDAGEVVVGAYYVLREEMMQNLTQTAAQQIQDGASWQDVEATLHCIRYSSEAVPLGE
FT                   DQSLPVLFGEQALGLLTQRPIGGLGEDRLRLTVVCLIQSYEEWFKFHPTHLAPCLSYLV
FT                   PSLTSRNHSISRSAADALKALCDMCRKKLVEHIGAFSELHGKIGDMGSEEQSKVIQGIS
FT                   SVIQALPPKEAIGPVEAIVNPIIDRMQAAVSTSRTNALEAQPLLIQTINSLTACLKGLS
FT                   PSDDEIFDAVDGEDQKEEEVKRVRGDERMARLREKTFVAIEGVVGVWNGDSEIADAISS
FT                   LLKHVSPNPPTLISLPPLPLLSLVTLACSRAPSALWFTLASTVILSISAPPSFLIKKKD
FT                   LAAREDEAMRAREEQEKWETVGQCGGRLVEIAQGLFQGEGMKENPDIVEGWFKFCHSFA
FT                   ERYPGVLLRLQPHQVESYIQLGLAGLRLHERFSLKSASDFFVALLSKTRFPSPLEAIFD
FT                   PLLVAFGPSLLHALILSAGSEGPRSVIPNLAELLAGLVTRVSGDVMSAWLEGVLSIDGF
FT                   PDPRATLESKKKLKTAVLKSRTARRMREALHEFALVSRGLEGTTYGNATAI"
FT   gene            1135517..1137029
FT                   /locus_tag="CNA04230"
FT   mRNA            join(1135517..1135910,1135974..1136370,1136423..1137029)
FT                   /locus_tag="CNA04230"
FT                   /product="general RNA polymerase II transcription factor,
FT                   putative"
FT   CDS_pept        join(1135562..1135910,1135974..1136370,1136423..1136996)
FT                   /codon_start=1
FT                   /locus_tag="CNA04230"
FT                   /product="general RNA polymerase II transcription factor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40947"
FT                   /db_xref="GOA:Q5KP45"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR028367"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP45"
FT                   /protein_id="AAW40947.1"
FT                   /translation="MSSNFYTSSHNRYWLLTRPSLLESRQTDLKYCTSRQLYCLFIFFS
FT                   QLIQKLGKRLLLRQIPIATACVFFKRFYFKNSLCETNPYLVLAACIYVAAKVEETPVHI
FT                   KSVVSEAKLVFHEHNIKMFPAETNKLGEMEFYLLEDLDFHLVVFHPYRALLHLTGRESA
FT                   DMGKFEKSRVQEDMEIRKKEGDAKKMREEEAKKASSKGQQPTVGQALEKEGERLEEAEE
FT                   TRIRRLMSRGTGEGMMEVDEGVLQISWFILNDSYRTDAPLLYPPYIIALSAIYIAFCLT
FT                   SMSNSSARTRASSTQRPELLQSASINEGLNLLPPPKNAAEFLAGFQVSLPMLFGCVQEI
FT                   IGLYPVWEAFEPTVMRNSQAQAKTGNAAAPVPAATGTKTGQNNDLVQDKKDKFGLEEAE
FT                   SLVRKMIEERMIDLGHPDNAGVEKASGTGPSNVAGKKRAR"
FT   gene            complement(1137059..1139199)
FT                   /locus_tag="CNA04240"
FT   mRNA            complement(join(1137059..1137324,1137382..1137783,
FT                   1137836..1138504,1138555..1138710,1138760..1138828,
FT                   1138888..1139199))
FT                   /locus_tag="CNA04240"
FT                   /product="IMP dehydrogenase, putative"
FT   CDS_pept        complement(join(1137201..1137324,1137382..1137783,
FT                   1137836..1138504,1138555..1138710,1138760..1138828,
FT                   1138888..1139102))
FT                   /codon_start=1
FT                   /locus_tag="CNA04240"
FT                   /product="IMP dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40949"
FT                   /db_xref="GOA:Q5KP44"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KP44"
FT                   /protein_id="AAW40949.1"
FT                   /translation="MADTNPNAPPRSDSLLNPADALKYLEEYPRGDGLSLQELMDSRKN
FT                   GGLTYNDFLVLPGHISFPASDVSLQSRATKNIVLNTPFLSSPMDTVTEDRMAIALALHG
FT                   GLGIIHHNCSAEEQAAMVRRVKKYENGFITDPLCLGPDATVGDVLEIKAKFGFCGVPIT
FT                   ETGAPNSKLLGIVTGRDVQFQDAETPIKSVMTTEVVTGSSPITLEKANSLLRETKKGKL
FT                   PIVDSNGHLVSLVARSDLLKNQNYPYASKVPESKQLYCGAAIGTRPGDKDRLKLLAEAG
FT                   LDVVVLDSSQGDSVYQIEFIKWIKQTYPKIEIIAGNVVTREQAAQLIAAGADGLRIGMG
FT                   SGSICITQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVM
FT                   MGGLLAGTTESPGEYFYHEGKRVKVYRGMGSIEAMEHTQRGSASGKRSILNLDNAATAR
FT                   YFSEADAVKVAQGVSGDVADKGSINKFVPYLFTGLQHSFQDAGVKSVSELHSCARSGSL
FT                   RFELRTASAQLEGGVHGLNSYTKRLFA"
FT   gene            1140333..1142306
FT                   /locus_tag="CNA04250"
FT   mRNA            join(1140333..1140828,1140882..1141187,1141238..1142306)
FT                   /locus_tag="CNA04250"
FT                   /product="cyclin, putative"
FT   CDS_pept        join(1140723..1140828,1140882..1141187,1141238..1142106)
FT                   /codon_start=1
FT                   /locus_tag="CNA04250"
FT                   /product="cyclin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40951"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP43"
FT                   /protein_id="AAW40951.1"
FT                   /translation="MPSRNPIHPASLCRLSTHNKPLVECLRTRVRSEFLAHVAEQTCSV
FT                   IRISPSAPSTPSTSYLPTPPASPSGEHYDEDGKPSEWWQAPNGTEDDLDVDLPELQEFI
FT                   RGLVVQSNVQMPTLSVTLVYLERLREKLPAVATGMKCTRHRVFLAVLICAAKYLNDSSP
FT                   KNMHWQKYGKFFSLAEVNLMEKQLLYLLDYNLRVEEDELVRHLEGFGPSVLAPATSSAP
FT                   SSVSVQAAPDQLRVPAVIPRTKTSPSASSRLRTGPNKSRSTNFERPFNPTADIASHHSR
FT                   PVDLQRSHTNEHIGSSCQPRSYRPAPIHIPRAITCSSSPGSASSSASSVLYGDIPTPGL
FT                   GRDSSDAGDSPQAARTPDEGRWGRYGYGGVPVPVSVPGRLYKMSCEPTIVGLSSASPVA
FT                   CVKSPIGTEKQREGLLKRAGRTFKRII"
FT   gene            complement(1142280..1145024)
FT                   /locus_tag="CNA04260"
FT   mRNA            complement(join(1142280..1142358,1142413..1142824,
FT                   1142879..1143711,1143784..1143908,1143966..1144058,
FT                   1144121..1144770,1144844..1145024))
FT                   /locus_tag="CNA04260"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1142577..1142824,1142879..1143711,
FT                   1143784..1143908,1143966..1144058,1144121..1144770,
FT                   1144844..1144853))
FT                   /codon_start=1
FT                   /locus_tag="CNA04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40953"
FT                   /db_xref="GOA:Q5KP42"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP42"
FT                   /protein_id="AAW40953.2"
FT                   /translation="MINVLARYLTLSFIFRDGRAALPPPLPRRPPVVNRRRRNAFRPPV
FT                   PEKALQISWLSSRTLKKRCFRYDDHIVLLLLAWSRDIKHGACDSPLQRHHHDSTSISIY
FT                   IYWFSTPTLHSSSFLVPSLLSFFIDHTLTSHHHFSIMPIKAVNREREYLLQAQEDPSVK
FT                   LEQSHTTPLPKLQLLIACFVRVTEPIAFMACFPYINQMLLDTGVVDDPRKTGFYAGLIE
FT                   SMFAVAELLTVFQWGTASDRWGRKPVLLIGCAGAALSSILFGFATTFPMMVLTRVINGL
FT                   ANGNVAVLKSVIGELCDETNQSVAFSFFPLSMAIGTILASAIGGYFPRITDRYPKLGQT
FT                   IPILDRYPYLLPCLVAAIFPLISGLVAWIWMEETLPPKTKGMQVEDQSQSRSQVHHAHS
FT                   HTTVHYSSTDEGDTRVEGATDHHNTWAPPGHIDDHEDDAPVSFRDLLTPDINALMTSFG
FT                   LLQLQGISFLGLLPLFCFTPVPSGGLSFPSGKIGLAMSIRGVSTIAVQLFAFPWLSKRI
FT                   GTVKLYKMLVILFIPAFVLLPFCNVMARSGRDAWVWIGLSGSMVLYAIGNMAFACNLIM
FT                   VNDAAPNRRSLGAINGWSQAVSSLMRAIGPGTSSALFALSVDKHVMEGQLIWVVLSVLS
FT                   VVSAMAALMLKNHHRKV"
FT   gene            1145091..1145803
FT                   /locus_tag="CNA04265"
FT   mRNA            join(1145091..1145308,1145364..1145379,1145451..1145467,
FT                   1145516..1145534,1145592..1145803)
FT                   /locus_tag="CNA04265"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(1145301..1145308,1145364..1145379,1145451..1145467,
FT                   1145516..1145534,1145592..1145684)
FT                   /codon_start=1
FT                   /locus_tag="CNA04265"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHX3"
FT                   /protein_id="ALO60330.1"
FT                   /translation="MNRIPVVLNIDEIEYLLDQLPPPDKEEDPVITKLREKLKLSLQEV
FT                   RKNAE"
FT   gene            1146887..1151215
FT                   /locus_tag="CNA04270"
FT   mRNA            join(1146887..1147367,1147563..1147757,1147853..1147933,
FT                   1148081..1148301,1148358..1149969,1150022..1150972,
FT                   1151020..1151215)
FT                   /locus_tag="CNA04270"
FT                   /product="HMG1, putative"
FT   CDS_pept        join(1147883..1147933,1148081..1148301,1148358..1149969,
FT                   1150022..1150918)
FT                   /codon_start=1
FT                   /locus_tag="CNA04270"
FT                   /product="HMG1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40955"
FT                   /db_xref="GOA:Q5KP41"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP41"
FT                   /protein_id="AAW40955.2"
FT                   /translation="MQSTNAPVNGGVSQQWQSAMQGMYSGAQQRPTSNSKPYNAPDANG
FT                   MPAKKDDANQSMYSVNTENGYPAYQQQGYGTLGGLGQYGYNSAGLGGLSAAYGGATSST
FT                   AGATNGRRTSGQRMMTPPPHPSSVATNTSPSARYYTGQEGEAGRHASPYQPASAPPQIL
FT                   SHQFNAMTNSPQTAQGYPQYQYNQQSHQQNPTQWAGYPTYGQSQAQARNNMSGRLSTTP
FT                   AIPQNSALGDSSARQQPTSMYDYTTHALQQWPASDLSKVPSAHQNSWQNAQSLSRLTQA
FT                   QSPALGQTQPSSASQPTSSTSSTQNASPAVPQSGWQGYPSIPSIPPHTLGGGHLMSGQP
FT                   YGWGHTQQWGGYYGAQQPSQAPQGTPAHRPPLNNFPTGSTSSAPAESLPTGRKRMSKDK
FT                   GKTAKEKEENRSHFEDYHGLGKRSAEAVVEEIPGEDKKESKKKKGKEEKEKPVPKAKSH
FT                   LHPPKQAPSSWQLFFADELAKAKAAEPESRSPGGTSHPQKLNVAQIAKEAGVAYANLSE
FT                   ERKKYYAERVKEHREIYAKELAAWQATLTPEDIRAENAFRAQQRKEGKSRKGNIKDPNA
FT                   PKKPLSAYFLFLKAIRENSDIRAQVWGTEAETTKQSVMAAEKWRSLTDDEKRPYLEQAE
FT                   HDKQTYETARKQYEEDSAARARGEDVPIRAVEAPASPPKPPASILRSIHGGQAPVTKSS
FT                   PSVTDSAPHPAPHSDLEPGITSLGKSPSPNPPSEPSLAQFHTSPRSVPHYDPSLEVDDF
FT                   QGFSDPLNMDLSGLDGIDVGSMEVGAGGDSEQPWDELQKLIGTEDVYSSAKLQPAAHIV
FT                   PDASTAARVAPASGFESTDISVAPSYAEAKNETQQETSLNGTPEGNGNESKVRHIAEAA
FT                   EGELAVLPALGENTAQKNQGGLEVMVGAGEARRHNKNLSTESGQAAADAPVVDGV"
FT   gene            complement(1151680..1153626)
FT                   /locus_tag="CNA04280"
FT   mRNA            complement(join(1151680..1151800,1151856..1152586,
FT                   1152644..1152732,1152780..1153349,1153398..1153509,
FT                   1153564..1153626))
FT                   /locus_tag="CNA04280"
FT                   /product="t-complex protein 1, beta subunit (tcp-1-beta),
FT                   putative"
FT   CDS_pept        complement(join(1151752..1151800,1151856..1152586,
FT                   1152644..1152732,1152780..1153349,1153398..1153509,
FT                   1153564..1153584))
FT                   /codon_start=1
FT                   /locus_tag="CNA04280"
FT                   /product="t-complex protein 1, beta subunit (tcp-1-beta),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40957"
FT                   /db_xref="GOA:Q5KP40"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012716"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP40"
FT                   /protein_id="AAW40957.1"
FT                   /translation="MNVFADEATEERGENARLSSFVGAMALGDLVKSTLGPKGMNKILQ
FT                   SASNSTITVTNDGATILKSIHLDNPAAKILVNISKVQDDEVGDGTTSVCVLASELLREA
FT                   EKLVTVQKIHPQTVAEGYRIASRAALQALEASAVDNKNDNAKFREDLFNIARTTLSSKV
FT                   LAQDKDYFANLAVDAVLRLKGSTDLEHIQIIKKVGGKLTDSYLDEGFILDKTIATNSPK
FT                   RIENAKILIANTSMDTDKIKIFGARVRVDGTGKLAELERAEKEKMKAKVQAIASHGITC
FT                   FVNRQLIYNYPESLLAEAGIMSIEHADFEGVERLALVTGGDIASTFDAPEKVKIGRCDV
FT                   IEEIMIGEDKLIKFSGVAAGEACTVVLRGATSQMVEEAERSLHDALSVLSQTVKETRVT
FT                   LGGGCAEMLMSCQVEEAARTVKGKKALAVEGFARALRQMPTIIADNGGYDSSDLVTKLR
FT                   AAHYEGQSDAGLDMDKGEIGSMRQLGITESFKLKKQVVVSASEAAEMILRVDNILRSAP
FT                   RRREAH"
FT   gene            1153779..1155229
FT                   /locus_tag="CNA04290"
FT   mRNA            join(1153779..1153986,1154041..1154140,1154187..1154537,
FT                   1154587..1155229)
FT                   /locus_tag="CNA04290"
FT                   /product="vacuolar ATP synthase subunit d, putative"
FT   CDS_pept        join(1153966..1153986,1154041..1154140,1154187..1154537,
FT                   1154587..1155185)
FT                   /codon_start=1
FT                   /locus_tag="CNA04290"
FT                   /product="vacuolar ATP synthase subunit d, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40959"
FT                   /db_xref="GOA:Q5KP39"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR016727"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP39"
FT                   /protein_id="AAW40959.1"
FT                   /translation="MEALGFNMSSGYLEGVVRGYKGALLTQSNYHNLTQCENLEDFRLQ
FT                   LSSTDYGSFLANEPLPLSTSTIADKATEKLVAEFHYLRTNAVEPLATFMDYITYAYMID
FT                   NVILLTLGTLHERDTHELLERCHPLGVFDTMPALCVATNVEELYHSVLVETPLAPYFQD
FT                   CLSAQDLDDLNIEIIRNSLYKSYLEDFHKFCQTLPAPTSEIMSRILAFEADRRTLNITI
FT                   NSFGTELSKEQRARLFPSIGRLFPEGNNALARADDIDAVVAAVDHIAEYKAFFDKAGVT
FT                   SGGGAGTDEASSSLEDEFFKHDVDLNKQSFLQQFQYAVFYSFVKLKEQEVRNLTWIAEC
FT                   IAQDAKDRVNDYIPVF"
FT   gene            complement(1155915..1158710)
FT                   /locus_tag="CNA04300"
FT   mRNA            complement(join(1155915..1156906,1156958..1157136,
FT                   1157189..1157513,1157563..1158193,1158246..1158710))
FT                   /locus_tag="CNA04300"
FT                   /product="art-4 protein, putative"
FT   CDS_pept        complement(join(1157020..1157136,1157189..1157513,
FT                   1157563..1158193,1158246..1158657))
FT                   /codon_start=1
FT                   /locus_tag="CNA04300"
FT                   /product="art-4 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40961"
FT                   /db_xref="GOA:Q5KP38"
FT                   /db_xref="InterPro:IPR014881"
FT                   /db_xref="InterPro:IPR017117"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR036283"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP38"
FT                   /protein_id="AAW40961.1"
FT                   /translation="MVLSYSAIAKPTADTPKVISMTASKQVFPEAFEALPAPAAEESQE
FT                   LESQPEALAQASSSTIEAPISSEDRKVIQHLILDAGPLLSLTPLRHLATSFHTTPMVLA
FT                   ELRDPKAREHWERLALTGVNVKVESPTAEAMAQVTAFAKKTGDFAVLSQTDLSVAALTY
FT                   QYEVMVNGVKRIRTEPPQAKKPSAKGKEKEKDTKQAEKKDEEVQENKNEKEGKPEEEDV
FT                   EVEEAIQSLSQIIIEPSTKSELSVNDVSTTNRSHTQTSVPASAHAEDPESEGEWINPTN
FT                   LSTHRSRDLGLITPSGSTAKPPAVACMTGDYAVQNILLGMRLGLVGEGGKKIGKVKSWV
FT                   LRCHACFKVCKDPSKRFCPSCGNATLLRTSVSTSAKTGEQRVHLKQNFQYRTRGTIYSI
FT                   PDPKMGRAKGQQKGGSGLILREDQREWQDAMRGDRIKKEKEERKAAKGALEGWNDPDWL
FT                   PEMITVGMSGKGRSGGHNMPSIGHGRKNPNQAKRRR"
FT   gene            1158924..1160461
FT                   /locus_tag="CNA04310"
FT   mRNA            join(1158924..1158985,1159033..1159067,1159127..1159300,
FT                   1159352..1159555,1159611..1159935,1159983..1160090,
FT                   1160140..1160461)
FT                   /locus_tag="CNA04310"
FT                   /product="3-isopropylmalate dehydrogenase, putative"
FT   CDS_pept        join(1158972..1158985,1159033..1159067,1159127..1159300,
FT                   1159352..1159555,1159611..1159935,1159983..1160090,
FT                   1160140..1160401)
FT                   /codon_start=1
FT                   /locus_tag="CNA04310"
FT                   /product="3-isopropylmalate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40963"
FT                   /db_xref="GOA:Q5KP37"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP37"
FT                   /protein_id="AAW40963.1"
FT                   /translation="MADKTFKITVLPGDGIGPEVVAEAVRVLETIVNHSDLKLDLKSYD
FT                   FGGAAIDNHGVPLPDETLKACKEADAVLMGSVGGPKWGVGPVRPEQGILKLRKELGLYA
FT                   NIRPANFASESLLKRSPLKEDTARGTDIIVLRELIGGIYFGERQETNDEGVAWDQCIYS
FT                   KPEIERITRVAAQIALAAEPPLPITSVDKANVLATSRLWRKTVSELMAKEYPQLKLEHQ
FT                   LVDSAAMIMIANPRKLNGVLLTENMFGDILSDESSVIPGSLGLLPSASLAGAPDAKSTT
FT                   MGLYEPIHGSAPDIAGQGIANPIGTILSAAMMLRYSLGKGREAALIEQAVQKVLDSAES
FT                   GGFDYRTKDLGGQRSTKEVGDKVVEVLKGLLGA"
FT   gene            1160633..1162755
FT                   /locus_tag="CNA04320"
FT   mRNA            join(1160633..1160842,1160902..1161102,1161161..1161363,
FT                   1161422..1161724,1161787..1162755)
FT                   /locus_tag="CNA04320"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(1160722..1160842,1160902..1161102,1161161..1161363,
FT                   1161422..1161724,1161787..1162530)
FT                   /codon_start=1
FT                   /locus_tag="CNA04320"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40965"
FT                   /db_xref="GOA:Q5KP36"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP36"
FT                   /protein_id="AAW40965.1"
FT                   /translation="MTCTIHPSLPETDTHKDYARFYFDTTNVPDKRIVGLLACQRDPLL
FT                   RILRTKVHAAREADITSPPPPKGKAKQKKGAAFTSEQNVALKEESKGKLWEVELLDTII
FT                   FPEGGGQPSDTGVMRLLDPNGGVSHTFPIEMCLRRKLDSVHLIRIPSGIEIDLREGREV
FT                   EVEADWDRRIDQMSIHTSQHLLSAILETHLSLPTLSWSMQPYPSIEPAYVELPRALTPE
FT                   EAMGIERLCGEAIKQCKKIWVDFTIQGDDVGKENIGAGSVGTREMRGLPKDYDGGVIRH
FT                   INIQDTDRNACCGTQSPNTSLLSLLHVIPPTLSNSSKPSPTKLYFLSGPRAILALQQAS
FT                   RTLSAAAKAVGYGRADLVERLERAEVARKDTADSLKGLRTELAKLVGEQAVKAGKEGKS
FT                   VTLVEREEKGTHDFDWLGLVGATYLESFSASGQNTDGKTPPSPLIILTSSITPASTTSQ
FT                   TLLLIQSPDNDLAKYVNEKIKTALAGRVKGGGARGRYMSKIDGKWGKIEKDALAKVIDD
FT                   LRADRV"
FT   gene            1162770..1165557
FT                   /locus_tag="CNA04330"
FT   mRNA            join(1162770..1162866,1162928..1162993,1163062..1163145,
FT                   1163193..1163298,1163351..1163391,1163444..1163486,
FT                   1163540..1163705,1163769..1163913,1163965..1164019,
FT                   1164068..1164158,1164217..1164320,1164379..1164461,
FT                   1164766..1164837,1164917..1164938,1165138..1165557)
FT                   /locus_tag="CNA04330"
FT                   /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
FT                   precursor, putative"
FT   CDS_pept        join(1162789..1162866,1162928..1162993,1163062..1163145,
FT                   1163193..1163298,1163351..1163391,1163444..1163486,
FT                   1163540..1163705,1163769..1163913,1163965..1164019,
FT                   1164068..1164158,1164217..1164320,1164379..1164461,
FT                   1164766..1164837,1164917..1164938,1165138..1165256)
FT                   /codon_start=1
FT                   /locus_tag="CNA04330"
FT                   /product="Isovaleryl-CoA dehydrogenase 2, mitochondrial
FT                   precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41345"
FT                   /db_xref="GOA:Q5KP35"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP35"
FT                   /protein_id="AAW41345.2"
FT                   /translation="MYITRARMMLPKAHACSRLLCSSSRLGTRRRYSSYNTAVAGLTEA
FT                   QEEFRSVVQHFAQKEIAPRAAEIDRTNKLPQDIFPKLGEMGLLGVTVPERWGGLGLGYL
FT                   EHTIAMEEISRASASVALSYGAHSNLLVNQLVRWGTEKQLSKYLPPLLTGKHIGSLAMS
FT                   EPNAGSDVVSMRTSATRSDEGEGWIMNGSKCWITNAPVSSTFLIYAKSDTNVAPSKGMT
FT                   AFLVEKGWKGFEVGEGLDKFGMRGSPTAELFFDNVKIPEENVLGKVGNGALVLMSGLDL
FT                   ERLVLSGGPLGIMQAALDMALEYTHERKQFGKQIGTFQLMQGKLADMYTKLSASRAYVY
FT                   AVARACDAGMISRRDCAGAILYSSDRAVEVAIEAQQCLGGNGYINDYPAGRLVRDSRLY
FT                   TVGAGTQEIRRMLIGREFNEALSGL"
FT   gene            1165683..1167642
FT                   /locus_tag="CNA04340"
FT   mRNA            join(1165683..1165800,1165868..1166232,1166287..1166384,
FT                   1166441..1166548,1166611..1166811,1167124..1167642)
FT                   /locus_tag="CNA04340"
FT                   /product="mitochondrion protein, putative"
FT   mRNA            join(1165683..1165800,1165868..1166232,1166287..1166384,
FT                   1166441..1166548,1166611..1166868)
FT                   /locus_tag="CNA04340"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        join(1165795..1165800,1165868..1166232,1166287..1166384,
FT                   1166441..1166548,1166611..1166732)
FT                   /codon_start=1
FT                   /locus_tag="CNA04340"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41346"
FT                   /db_xref="GOA:Q5KP34"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="InterPro:IPR040153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP34"
FT                   /protein_id="AAW41346.1"
FT                   /translation="MKIVSQDDVRGYNDATIVGGIKGAFLAAAICIPGHMFLMKRSPYI
FT                   RALPLPLKALGHVTITVPCISIAAEKGGEAYNRAQYSGVGQREIDWELQIRNEKWEKMS
FT                   KLEKAGDWAARHKYGIIGGGWAASMALAFGIVARNPYQSTSQKVVQARMWAQGLTVALL
FT                   VGSAMATGLGASNSSTPVESADHSWRRMLEHDEHLTPEERAQLRDTRDPTTAKEIQKAV
FT                   SQRKAAAAQA"
FT   CDS_pept        join(1165795..1165800,1165868..1166232,1166287..1166384,
FT                   1166441..1166548,1166611..1166732)
FT                   /codon_start=1
FT                   /locus_tag="CNA04340"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="GOA:Q5KP34"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="InterPro:IPR040153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP34"
FT                   /protein_id="ALO60331.1"
FT                   /translation="MKIVSQDDVRGYNDATIVGGIKGAFLAAAICIPGHMFLMKRSPYI
FT                   RALPLPLKALGHVTITVPCISIAAEKGGEAYNRAQYSGVGQREIDWELQIRNEKWEKMS
FT                   KLEKAGDWAARHKYGIIGGGWAASMALAFGIVARNPYQSTSQKVVQARMWAQGLTVALL
FT                   VGSAMATGLGASNSSTPVESADHSWRRMLEHDEHLTPEERAQLRDTRDPTTAKEIQKAV
FT                   SQRKAAAAQA"
FT   gene            complement(1167581..1170005)
FT                   /locus_tag="CNA04350"
FT   mRNA            complement(join(1167581..1168705,1168755..1168985,
FT                   1169034..1169136,1169186..1169302,1169358..1170005))
FT                   /locus_tag="CNA04350"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1167772..1168705,1168755..1168985,
FT                   1169034..1169136,1169186..1169302,1169358..1169904))
FT                   /codon_start=1
FT                   /locus_tag="CNA04350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40970"
FT                   /db_xref="GOA:Q5KP33"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP33"
FT                   /protein_id="AAW40970.2"
FT                   /translation="MTTASPFLFQSSLHDTGLIHEMLSNPLKFGAPVNKKSLGFEAGMK
FT                   EVVSEPESPNLVKRQLKNVNDEVKYDTEGELAAKDKSQKQFNGNAKNPQRVNPEFINQS
FT                   VTPLSPAKSQIPDTNEGDNTQGLFPSTFDLSWPEAIATAKRAAGLHNPSMACYANATLQ
FT                   VLLHTPPVLRIALTHDEGSCSQIKKKNFCMLCSLKHMAEGSHWSGRKAYAPGIHRSLSQ
FT                   IKKGFSKNRQEDTHEFFRFVTDALQNTALAKLPKDTPEKIKHTSWVYRIWGGRVRSRVV
FT                   CSRCNNPSDTFDSFLDLSLDVNKQGKKSVLGMLAGFTKEDRLEGDNKYHCERCKRKANA
FT                   TKSFKIDQAPPILTLHLKRFSVNYNPYSGRARAEKFNQPIKFEQTLDIAPYMVDPASPG
FT                   TKYRLFGVTCHRGTELRFGHYTSYVRGPSGQWFHADDDEVSPVQLEQVLNDKTAYLLSY
FT                   IRVDNGNEGLCESPAVRDRVKGLVNGSAKGMRDDESESQSEAESSSHKSSSPIKRKSTY
FT                   DPEDPPRMKIGAFVNNKAYAPSTNKSESPFSDGENKMPPELPKFGYKPKPTIRAPAPVE
FT                   ASSFYTSPVARPSNSLAGMSKKEKKKFKHKEKGKPRHSATPMPFAQGRVGNGRNRQPGV
FT                   LSRMKGRA"
FT   gene            1171606..1174363
FT                   /locus_tag="CNA04360"
FT   mRNA            join(1171606..1172196,1172259..1172537,1172588..1172859,
FT                   1172911..1173826,1173875..1173919,1173986..1174070,
FT                   1174123..1174363)
FT                   /locus_tag="CNA04360"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1171777..1172196,1172259..1172537,1172588..1172859,
FT                   1172911..1173760)
FT                   /codon_start=1
FT                   /locus_tag="CNA04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP32"
FT                   /protein_id="AAW40972.1"
FT                   /translation="MSTLPIYHPVPTDEKHPISATLVDGEFDPRYIHPAAIGSQYLYIG
FT                   GPRSAYQAAKDKYAGLSKVKKGLLALAVVWFGLVVGHQAARLAGGKCHQDAHHAPAEFG
FT                   VKQWRDHSSHRFGGPIFLEDGPLDCHGGRKDRAPEELSSVATVYESINVVGSNDATDIL
FT                   SANASFPLKLGRGKHFDLTFQGEGNVIISRAEEESEDSTVNVFVESTWSGEEAEGVKML
FT                   SGKHSHALSVASSQSSSHIVHLVLPANKKRLPSISIFSTKDLTLDIHPSVQDIHVGKLS
FT                   LKSESGDIKLPTLAVNKLVAETVTGDVGGNFNVSNSFVVKTVTGNINAIVNVVPHSPPK
FT                   DKLNLHNVDAKHEHKKFDSRHGEHNHEKKHFGGRFHSEEERPSKWSLNIFKSKKEDEPE
FT                   HPPPPPVFIGAFSTSGNILLKVFGSPNVSTDTNVFSHTGDVDVTHDKSFHGLYEVGSLK
FT                   GTYDVVVRDGKVHRVLEEYVTEEGGKQKGLAFVPKNRKTEGSHEKRHFRNAESVDGELP
FT                   PPPPGKGHGPDGPDGPDGPGGPSGPGGPGGPDGPGGPGGPGGPGGPGGPGGPGGPGPDH
FT                   PRGPPPWVVFPPGHSEVFVHTEVGNAKIVL"
FT   gene            1175342..1177454
FT                   /locus_tag="CNA04370"
FT   mRNA            join(1175342..1175452,1175782..1175893,1176075..1176220,
FT                   1176297..1176599,1176650..1176814,1176864..1177205,
FT                   1177259..1177454)
FT                   /locus_tag="CNA04370"
FT                   /product="hypothetical protein"
FT   mRNA            join(1175594..1175893,1176075..1176220,1176297..1176599,
FT                   1176650..1176814,1176864..1177205,1177259..1177454)
FT                   /locus_tag="CNA04370"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1175809..1175893,1176075..1176220,1176297..1176599,
FT                   1176650..1176814,1176864..1177205,1177259..1177294)
FT                   /codon_start=1
FT                   /locus_tag="CNA04370"
FT                   /product="glutamate-ammonia ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40974"
FT                   /db_xref="GOA:P0CN84"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN84"
FT                   /protein_id="AAW40974.1"
FT                   /translation="MSQLIATKRVDLLAPYLALDQGSRVQAEYIWIDAEGGIRSKTMTL
FT                   DKAPSSVADLKEWNFDGSSTNQAPADNSDVFLRPVAIFKDPFRGGANILVLCECYDNDG
FT                   TPNKSNYRAHCKKVMDAAKDTEPWFGLEQEYTLFDADGQVFGWPKNGFPGPQGPYYCGV
FT                   GAGKVFARDFIEAHYRACLYAGIKISGINAEVMPSQWEFQVGPCTGIEMGDHLWMARFL
FT                   LLRIGEEWGITPSLHPKPLKGDWNGAGCHSNYSTKDMRTPGKGMAAIEDAIKKLEKKHL
FT                   EHIAVYGEDNDLRLTGKHETASMTTFSAGVANRGASIRIPRHVGAQGYGYLEDRRPASN
FT                   VDPYRVTAILVETTVLNN"
FT   CDS_pept        join(1175809..1175893,1176075..1176220,1176297..1176599,
FT                   1176650..1176814,1176864..1177205,1177259..1177294)
FT                   /codon_start=1
FT                   /locus_tag="CNA04370"
FT                   /product="glutamate-ammonia ligase, putative"
FT                   /db_xref="GOA:A0A0S2LIP1"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIP1"
FT                   /protein_id="ALO60332.1"
FT                   /translation="MSQLIATKRVDLLAPYLALDQGSRVQAEYIWIDAEGGIRSKTMTL
FT                   DKAPSSVADLKEWNFDGSSTNQAPADNSDVFLRPVAIFKDPFRGGANILVLCECYDNDG
FT                   TPNKSNYRAHCKKVMDAAKDTEPWFGLEQEYTLFDADGQVFGWPKNGFPGPQGPYYCGV
FT                   GAGKVFARDFIEAHYRACLYAGIKISGINAEVMPSQWEFQVGPCTGIEMGDHLWMARFL
FT                   LLRIGEEWGITPSLHPKPLKGDWNGAGCHSNYSTKDMRTPGKGMAAIEDAIKKLEKKHL
FT                   EHIAVYGEDNDLRLTGKHETASMTTFSAGVANRGASIRIPRHVGAQGYGYLEDRRPASN
FT                   VDPYRVTAILVETTVLNN"
FT   gene            1177880..1179868
FT                   /locus_tag="CNA04380"
FT   mRNA            join(1177880..1178087,1178140..1178252,1178454..1178566,
FT                   1178623..1179868)
FT                   /locus_tag="CNA04380"
FT                   /product="expressed protein"
FT   mRNA            join(1177880..1177955,1178213..1178252,1178454..1178566,
FT                   1178623..1179868)
FT                   /locus_tag="CNA04380"
FT                   /product="expressed protein"
FT   CDS_pept        join(1178463..1178566,1178623..1179805)
FT                   /codon_start=1
FT                   /locus_tag="CNA04380"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40977"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP30"
FT                   /protein_id="AAW40977.1"
FT                   /translation="MPPQPSHHGTARYGSLATHSGGLRGGKQPTKLEIESLASMDKPSY
FT                   YDPPSSPSSSRSASPPPPSMMSNSGNKLVSGAQFMRRGKIYPWGPSFEVAKTNQHARKR
FT                   LKLCLEQFMPPAAAEVNADIPANISGAEERRREKKRKREEEKEYILPHLRSPSPPMSTA
FT                   KLASLLALPQTYTDLLLNPAMRHSLGNDNMEQGLQRTAGELLEGEKPLLQALGRLRDVV
FT                   RVLERDVPVAKPRAQADRDAVPSSTANGNDNLSQSYPHLIPPLPHISDTDNLWRVTQEL
FT                   LSQPGQAQSVPVPTLTYSATPPGAAAPSLDSIAEPEPIPTPLQRLFTCPSGITLHAVPS
FT                   ASHPGYAYPQGHSLHPQTVKYNLDLKNQCRAVDDAWERISELLADCNEYRERLEEARDR
FT                   VADVARVRKRVWRTIKERAGWELERESKP"
FT   CDS_pept        join(1178463..1178566,1178623..1179805)
FT                   /codon_start=1
FT                   /locus_tag="CNA04380"
FT                   /product="expressed protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP30"
FT                   /protein_id="ALO60333.1"
FT                   /translation="MPPQPSHHGTARYGSLATHSGGLRGGKQPTKLEIESLASMDKPSY
FT                   YDPPSSPSSSRSASPPPPSMMSNSGNKLVSGAQFMRRGKIYPWGPSFEVAKTNQHARKR
FT                   LKLCLEQFMPPAAAEVNADIPANISGAEERRREKKRKREEEKEYILPHLRSPSPPMSTA
FT                   KLASLLALPQTYTDLLLNPAMRHSLGNDNMEQGLQRTAGELLEGEKPLLQALGRLRDVV
FT                   RVLERDVPVAKPRAQADRDAVPSSTANGNDNLSQSYPHLIPPLPHISDTDNLWRVTQEL
FT                   LSQPGQAQSVPVPTLTYSATPPGAAAPSLDSIAEPEPIPTPLQRLFTCPSGITLHAVPS
FT                   ASHPGYAYPQGHSLHPQTVKYNLDLKNQCRAVDDAWERISELLADCNEYRERLEEARDR
FT                   VADVARVRKRVWRTIKERAGWELERESKP"
FT   gene            complement(1179859..1181236)
FT                   /locus_tag="CNA04390"
FT   mRNA            complement(join(1179859..1179918,1179973..1180114,
FT                   1180169..1180566,1180619..1181236))
FT                   /locus_tag="CNA04390"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1179911..1179918,1179973..1180114,
FT                   1180169..1180566,1180619..1181147))
FT                   /codon_start=1
FT                   /locus_tag="CNA04390"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40979"
FT                   /db_xref="InterPro:IPR018800"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP29"
FT                   /protein_id="AAW40979.1"
FT                   /translation="MLLANYGSDSGSDSESEAPVAPPPKPAPISAASSSSKVPQPKKKK
FT                   PVKITLDLPKASDGSEDEKNVGNNVEMGEDERETKRAKLPKGGKGTSSLLGMLPPPKRK
FT                   LPQSSTLATKGTGLTVNKAMARPQLPAPPRVIDEDSDDEDSVPKVRDMLPASLARKQQK
FT                   MESKEEVIDVFGLKTASAPLAKPTIATPSLKPPSISSAPVAPDFVPPEPTANDPYPGYY
FT                   QLPSGEWRAYDPDYYHSFFHSSAPVSDKQDADDGRVGRHWDAFEKGQFQGQVLDIDANK
FT                   DLAEARAEEERRALMKKPKLPGEEFVYQPKGQVKGLASQRHQLTSLLNTAYSQREELEE
FT                   RIAANKKGMRAAGTKYGF"
FT   gene            complement(1181695..1183484)
FT                   /locus_tag="CNA04400"
FT   mRNA            complement(join(1181695..1182568,1182623..1183484))
FT                   /locus_tag="CNA04400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1182084..1182568,1182623..1183442))
FT                   /codon_start=1
FT                   /locus_tag="CNA04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41349"
FT                   /db_xref="GOA:Q5KP28"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP28"
FT                   /protein_id="AAW41349.1"
FT                   /translation="MSPLHTSTLTHPSSPSSNSGTEVVLTPTTMAEERHTNSDVHIEQA
FT                   AEESAQVVAERAPKKAKTSDSGSFGQENDIDFAGITNQRLTVFPMFTGAWNEATESNST
FT                   SPIPTHPANAMQSPNHQQSQQQNGLDPLLALRSPSATHSTPQVNVDVGLTPELRFPDET
FT                   LASATADVSQETSQGDHAPIQVDESSQQQSASGMLTVPSSHTGPSSTSESGQASKKENN
FT                   AAFSRSPELRVSHKLAERKRRKEMKDLFDELRDELPADRGMKASKWEILTKAIEHIKHT
FT                   KSQQVEMHREIEHLRRELEIARAGNAHYHPHAYPTYSIPYPPGPFAAHPHHAQAQPPTS
FT                   GTTSQAQTPQPQTQTVAQPQLQSQMTQQPQQVQQQPQSQPQQQIQPAAHVQTVSQVQQQ
FT                   QSQPSQQQSQTSGLQTPTQEVQQQPLSAQGTPAPV"
FT   gene            complement(1183678..1186033)
FT                   /locus_tag="CNA04410"
FT   mRNA            complement(join(1183678..1183696,1183753..1184069,
FT                   1184118..1184192,1184243..1184411,1184460..1184597,
FT                   1184642..1185019,1185071..1185130,1185188..1185311,
FT                   1185363..1185481,1185536..1185754,1185818..1186033))
FT                   /locus_tag="CNA04410"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        complement(join(1183805..1184069,1184118..1184192,
FT                   1184243..1184411,1184460..1184597,1184642..1185019,
FT                   1185071..1185130,1185188..1185311,1185363..1185481,
FT                   1185536..1185754,1185818..1185944))
FT                   /codon_start=1
FT                   /locus_tag="CNA04410"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40981"
FT                   /db_xref="GOA:Q5KP27"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="InterPro:IPR026874"
FT                   /db_xref="InterPro:IPR028146"
FT                   /db_xref="InterPro:IPR036055"
FT                   /db_xref="InterPro:IPR036607"
FT                   /db_xref="InterPro:IPR039794"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP27"
FT                   /protein_id="AAW40981.1"
FT                   /translation="MKDSAILISLLFSLLLFTPVTFAAQEEQKVVVPSQIQGLNPSLYD
FT                   KYEPTKSGLFHCLDSSKSIPFSAINDDYCDCPDGSDEPGTAACSNGLFWCKNEGHIPGS
FT                   VRKSRVNDGLCEPECCDGSDEWATGACPNNCEAIGKEWRAAKEASEKIRKTGAKVRGTY
FT                   IKWAQGEKKRLEEDLARKRQELVTKEQEVAKAKAILDKTEARSQEDLERKKQSPVYISL
FT                   LSHRLALARLRSKTSSLEAEIESLHSLLREMAKGYNPNYQDMAVKAAVVGYEELTGIKY
FT                   REGESEGEMEVKKEQNEEDDKEEEITEEELEELEKEDLEALLLSDTTDENEEDEEDDGT
FT                   SLLWKLDEYIPDSLYGSWEHVRDVAIDWMIRFGLAGRSKAKTSSGDGPQAAAAREKHRL
FT                   LNNELVKLNGAIRNTEDTLKNMEFHYGPEGEWKKLDGTCVDKVVGDYTYELCFFGKATQ
FT                   KSNKDKSSNNLGSFNQWNTAAEQGSFGYYSQQLYKNGAKCWNGPNRSVTVDLSCGTSNA
FT                   LISVSEPEKCEYRFKITSPALCWPDVPDSPADDVKVKEEL"
FT   gene            1186783..1189269
FT                   /locus_tag="CNA04420"
FT   mRNA            join(1186783..1187176,1187262..1187947,1188001..1188165,
FT                   1188215..1188537,1188597..1188763,1188818..1188939,
FT                   1188990..1189068,1189125..1189269)
FT                   /locus_tag="CNA04420"
FT                   /product="oxidoreductase, putative"
FT   CDS_pept        join(1186882..1187176,1187262..1187947,1188001..1188165,
FT                   1188215..1188537,1188597..1188763,1188818..1188939,
FT                   1188990..1189068,1189125..1189135)
FT                   /codon_start=1
FT                   /locus_tag="CNA04420"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40983"
FT                   /db_xref="GOA:Q5KP26"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP26"
FT                   /protein_id="AAW40983.1"
FT                   /translation="MAIITPISRLATSRTLTAASRSSSGALLRRPTALRIRTFASEAKF
FT                   DPESVERAQDEVDVCIVGGGPAGLSAAIRLKQLEQERGGDELRVVVLEKGGEVGAHILS
FT                   GAVIEPRALNELIPDWKELGAPLNQPALSDSMRFLTSNSSFPLPHPPQMNNKGNYIVSL
FT                   SRFTAWLGEQAEALGVEVYPGFAGAKVLYTEDGKGIKGVITGDVGLDKDGNPKDNYEPG
FT                   MEFHAKVTLIAEGAHGSLSKELQKKFNLREGKDPQTYGLGIKEVWKVKDEVYEPGKIVH
FT                   TLGWPLDYKTYGGSWMYHMEDNMVSIGLVVGLDYQNPYLSPYKEFQRMKHHPFFANILK
FT                   DGQCIAYGARALNEGGFQSIPKLHFPGGALIGCSAGFLNVPKIKGTHNAMKSGMLAAES
FT                   AFAAITSTESSEEVSLDTNPADLSNYATAIENSWIWSELKEVRNLRPSFHNPLGLWGGM
FT                   AYSGLDSLILKGRVPWTFRNSVEDYEATKKASEEKPIDYPQPDGKLSFDILTSVSLTGT
FT                   NHAENQPVHLRLPKVEGARASHTKINVEDYAGLLGRVCPAAVYEYADAEGSEVDADGKK
FT                   FVINSQNCIHCKTCSIKTPTQDISWDVPEGGGGPKYSIT"
FT   gene            1190553..1191439
FT                   /locus_tag="CNA04425"
FT   mRNA            join(1190553..1190786,1190866..1190956,1191023..1191119,
FT                   1191190..1191439)
FT                   /locus_tag="CNA04425"
FT                   /product="hexose transport-related protein, putative"
FT   CDS_pept        join(1190638..1190786,1190866..1190956,1191023..1191119,
FT                   1191190..1191314)
FT                   /codon_start=1
FT                   /locus_tag="CNA04425"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIH8"
FT                   /protein_id="ALO60334.1"
FT                   /translation="MMFSSPQPLGHFSVSQVKMATMSLATARMELSKLKRVPVSAEAYL
FT                   DVLNSTRVDGVENVVERSTIFHGVNEAAFILGQNIVIERTTGHPVVFYEMERASRRPMR
FT                   YGPTRGTDSIDCSRRALHVLKAFTPLISNALGSPPQRLPVSLINRPAVA"
FT   gene            1192448..1197322
FT                   /locus_tag="CNA04430"
FT   mRNA            join(1192448..1192659,1192706..1192728,1192789..1192843,
FT                   1192909..1193023,1193143..1193205,1193259..1193267,
FT                   1193328..1193442,1193494..1193586,1193638..1193731,
FT                   1193784..1193986,1194041..1194219,1194264..1194622,
FT                   1194671..1195161,1195213..1195589,1195641..1195929,
FT                   1195978..1196184,1196242..1196367,1196415..1196773,
FT                   1196823..1196952,1197007..1197322)
FT                   /locus_tag="CNA04430"
FT                   /product="U2 snRNA binding protein, putative"
FT   CDS_pept        join(1192509..1192659,1192706..1192728,1192789..1192843,
FT                   1192909..1193023,1193143..1193205,1193259..1193267,
FT                   1193328..1193442,1193494..1193586,1193638..1193731,
FT                   1193784..1193986,1194041..1194219,1194264..1194622,
FT                   1194671..1195161,1195213..1195589,1195641..1195929,
FT                   1195978..1196184,1196242..1196367,1196415..1196773,
FT                   1196823..1196952,1197007..1197222)
FT                   /codon_start=1
FT                   /locus_tag="CNA04430"
FT                   /product="U2 snRNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40985"
FT                   /db_xref="GOA:P0CR22"
FT                   /db_xref="InterPro:IPR004871"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR22"
FT                   /protein_id="AAW40985.1"
FT                   /translation="MHLLNLTLSSPTNVSTAVVGSFSGSKSQEILCVRGGTKLEIFKLN
FT                   ATTGQLDTIVSTEAFGTIRNIAGFRLAGMTKDYILATSDSGRLSILEFVISPTPHFESL
FT                   YQEVFGKSGSRRIVPGQFLAVDPKGRSCLVGSLEKTKLVYVLNRNTEGKLYPSSPLEAH
FT                   KNHTLVTHIVGVDQGYDNPLYAALETDYSESDQDSTGEAYENTQKHLTFYELDLGLNHV
FT                   VRKWSEPTDRRANLLVQVPGGQNANSDRFEGPSGVLVCTEDHIIWKHMDVEAHRIPIPR
FT                   RRNPLVQRGDKSRGLIIVSAVMHKIKGAFFFLLQSEDGDLYKVWIEHNGEDVVALKIKY
FT                   FDTVPVANSLCILKRGYIYVASEFSDQNLYQFQSLAEDDGEQEWSSTDYPENGNIDGPL
FT                   PFAFFDPQPLRNLLLVDTVPSLDPITDAHVVNLLGASSDTPQIYAACGRGARSTFRTLK
FT                   HGLDVAEMVSSPLPGVPTNVWTLKLTEDDEYDSYIVLSFPNGTLVLSIGETIEEVNDTG
FT                   FLSSGPTLAVQQLGNAGLLQVHPYGLRHIRAADRVDEWPAPPGQTIVAATTNRRQVVIA
FT                   LSTAELVYFELDPEGSLSEYQEKKALPGNATCVTIAEVPEGRRRTSFLAVGCDNQTVSI
FT                   ISLEPDSTLDTLSLQALTAPPTSICLAEIFDTSIDKNRATMFLNIGLMNGVLLRTVVDP
FT                   VDGSLSDTRLRFLGAKPPKLVRANVQGQPSVMAFSSRTWLLYTYQDMLQTQPLIYDTLE
FT                   YAWSLSAAMCPDGLIGISGNTLRIFNIPKLGEKLKQDSTALTYTPRKFISHPFNSVFYM
FT                   IEADHRTYSKSAIERIVKQKESEGRRVDTLLLDLPANEFGRPRAPAGHWASCVRVLDPL
FT                   ANETIMTLDLDEDEAAFSIAIAYFERGGGEPFLVVGTGVKTTLQPKGCKEGYLRVYAIK
FT                   EQGRILEFLHKTKTDDIPLCLAGFQGFLLAGIGKSLRLYEMGKKALLRKCENNGFPTAV
FT                   VTINVQGARIIVGDMQESTFYCVYRSIPTRQLLIFADDSQPRWITCVTSVDYETVACGD
FT                   KFGNIFINRLDPSISEKVDDDPTGATILHEKSFLMGAAHKTEMIGHYNIGSVVTSITKI
FT                   PLVAGGRDVLVYTTISGAVGALVPFVSSDDIEFMSTLEMHMRTQDISLVGRDHIAYRGY
FT                   YVPIKGVVDGDLCESFSLLPYPKQQAIALDLDRSVGDVLKKLEQMRTSSAF"
FT   gene            complement(1197601..1197701)
FT                   /locus_tag="CNA04440"
FT   tRNA            complement(1197601..1197701)
FT                   /locus_tag="CNA04440"
FT                   /product="tRNA-Leu"
FT   gene            complement(1199420..1199520)
FT                   /locus_tag="CNA04450"
FT   tRNA            complement(1199420..1199520)
FT                   /locus_tag="CNA04450"
FT                   /product="tRNA-Leu"
FT   gene            complement(1199990..1200640)
FT                   /locus_tag="CNA04460"
FT   mRNA            complement(join(1199990..1200129,1200192..1200367,
FT                   1200503..1200640))
FT                   /locus_tag="CNA04460"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1200097..1200129,1200192..1200367,
FT                   1200503..1200533))
FT                   /codon_start=1
FT                   /locus_tag="CNA04460"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP24"
FT                   /protein_id="AAW40987.1"
FT                   /translation="MSGNNDNSEKTFNILPHPAKTNNPADLTGEPAEHGGLQSASANAY
FT                   NAKPPYIPSKEIAEGLEKPKTREELRAEAQQLNS"
FT   gene            1200828..1201785
FT                   /locus_tag="CNA04470"
FT   mRNA            join(1200828..1200949,1201005..1201132,1201190..1201363,
FT                   1201408..1201785)
FT                   /locus_tag="CNA04470"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1200892..1200949,1201005..1201132,1201190..1201363,
FT                   1201408..1201650)
FT                   /codon_start=1
FT                   /locus_tag="CNA04470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40991"
FT                   /db_xref="GOA:Q5KP23"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP23"
FT                   /protein_id="AAW40991.1"
FT                   /translation="MDSLTDEIEAVLFVAREVMVYQIPPRTTTAGYKAAEWNVESFLWK
FT                   GRMRVLDVGSRSEIRLEDPNTGELFAQVNYVSPWNQVEPVLDSSRYFVLRVEGEGGKRA
FT                   YIGMGFAERGESFDFQVALQSVTKRSQNISSASNPSEPPQPTAPPKDYSLKDGQTFTIK
FT                   IPGREGKKPSPSQTPSSGGGGGGGLFSLPPPPPGRRG"
FT   gene            complement(1201403..1202798)
FT                   /locus_tag="CNA04480"
FT   mRNA            complement(join(1201403..1201922,1201969..1202062,
FT                   1202112..1202537,1202599..1202662,1202710..1202798))
FT                   /locus_tag="CNA04480"
FT                   /product="sterol metabolism-related protein, putative"
FT   CDS_pept        complement(join(1201716..1201922,1201969..1202062,
FT                   1202112..1202537,1202599..1202662,1202710..1202779))
FT                   /codon_start=1
FT                   /locus_tag="CNA04480"
FT                   /product="sterol metabolism-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40993"
FT                   /db_xref="GOA:Q5KP22"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP22"
FT                   /protein_id="AAW40993.2"
FT                   /translation="MSTTPTMPSTEDVYSNDQDWYPGIRQRSKPGKAPHEAIYDKTQDI
FT                   NGTLVTDKPANRAMLANQRRQKEHDAKVQAKRERRAAQMGQQSKSSLWTFLPILLFLPL
FT                   LSSFLTQSYTFNLSPYVLPHLRNFWAETPLNIWRREMKEFTPLQLAMFDGSPDRPVYLA
FT                   IDGIVYDVSANRRIYGKGGSYNMMAGRDASRAFITGCFETHLTHDIRGLSKEELASLEH
FT                   WKSFFAKSDKYFKVGTVLNPPIDTESPIPPSCREDESASGADIHAPGEAAAKKGKIKPG
FT                   PVHGQ"
FT   gene            1202912..1205241
FT                   /locus_tag="CNA04490"
FT   mRNA            join(1202912..1203251,1203301..1203417,1203462..1203921,
FT                   1203963..1204048,1204112..1204256,1204307..1204991,
FT                   1205047..1205241)
FT                   /locus_tag="CNA04490"
FT                   /product="expressed protein"
FT   CDS_pept        join(1203051..1203251,1203301..1203417,1203462..1203921,
FT                   1203963..1204048,1204112..1204256,1204307..1204991,
FT                   1205047..1205119)
FT                   /codon_start=1
FT                   /locus_tag="CNA04490"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40995"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP21"
FT                   /protein_id="AAW40995.1"
FT                   /translation="MPDLGIDNLTVVLLALLAALAIYHRFFAAPSPLVHPLLLSKQSEV
FT                   SAVRKSGETGIYRSWATGQGTPLTVRPANTVKTVQDVARPPKADPKEKATRPDQRCILD
FT                   VQLTDEALAEIVRLVPLGIEILFPRSSPMIASSIVTLIPPSPNSALPLLLLSLSATPHR
FT                   PLAILPNPRLLTAALTGHGAHPTAGIVVVFADLLAEVVEQVWEDEGDKVGVLIIGDENK
FT                   LQRSVVEEARRKGLTIHWWEEIWEMAESEMAEKIQLQNAHFSDVHSYYYSESEDPEKPV
FT                   IVKVTHMNVTAGIASLLSIFPADKRPSSKLHDVVASAVRLDTPLGMTIALASIWNGAGY
FT                   RMIGNQEPVFDVEDIECVEHLTALADPTKDLPKPTILFITPKYHRALLDSLQFSYEAHP
FT                   WASLAALHKARDLSHGHVDRDGIWDKILWSGMRENVVGGVAGRKLRAVILVGDAPSPTA
FT                   LGASHLLLSLPLTRLHPSLYSSGPVFVSHFYDLQSPGVNHVLKQVDMWESTEKSHSGPP
FT                   ASNVEVMLKGEDVDEAHDRGDKWIEGRVFIRGPSILERVDGGGRVQDGWVDTGEHAKVQ
FT                   TNGTFIVNGLAK"
FT   gene            complement(1205199..1206640)
FT                   /locus_tag="CNA04500"
FT   mRNA            complement(join(1205199..1205802,1205864..1206251,
FT                   1206305..1206384,1206423..1206640))
FT                   /locus_tag="CNA04500"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        complement(join(1205282..1205802,1205864..1206251,
FT                   1206305..1206384,1206423..1206492))
FT                   /codon_start=1
FT                   /locus_tag="CNA04500"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40997"
FT                   /db_xref="GOA:Q5KP20"
FT                   /db_xref="InterPro:IPR007277"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP20"
FT                   /protein_id="AAW40997.1"
FT                   /translation="MGLLHLLAVAGGIAAFLFVTLSLASGLLWLAELIEEHSKYAKTVG
FT                   MRAIYAIIGLHIVLYFTDNLPITPILFSITCHFVYLSNFSSSWPLISLTSPRFILSCIL
FT                   VVGDHFVWFFHFAAVAQEAKDYRVPKYRYGGQQAKAAGNNPSFGDVAAFFAVCVWFVPL
FT                   YLFLSLSANDNALPSFDSSAPPSPSSSHVNLGSPRLHAHADRKHATSLIKSALLPLLSL
FT                   LPSIRSRSRVRNPEGLIAPRSPSKSSPLPSPALQAPNYYPWGTEEKPMSSPGFITPHRS
FT                   MTPLGGPKTPPPPRRTQSELQISTRGNSHSGPRAEEGMRKVSVGRPAGLASSTNLAPAT
FT                   GGETELSKRKAD"
FT   gene            1206699..1207701
FT                   /locus_tag="CNA04510"
FT   mRNA            join(1206699..1206784,1206834..1206853,1206902..1206979,
FT                   1207027..1207242,1207292..1207558,1207612..1207701)
FT                   /locus_tag="CNA04510"
FT                   /product="protein-vacuolar targeting-related protein,
FT                   putative"
FT   CDS_pept        join(1206769..1206784,1206834..1206853,1206902..1206979,
FT                   1207027..1207242,1207292..1207558,1207612..1207623)
FT                   /codon_start=1
FT                   /locus_tag="CNA04510"
FT                   /product="protein-vacuolar targeting-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW40999"
FT                   /db_xref="GOA:Q5KP19"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP19"
FT                   /protein_id="AAW40999.2"
FT                   /translation="MSNLEKSLFQLKFTAKSLQRQAKKATKDEAAEKNKLKQALAKGNT
FT                   DGARIYAQNAIRKKNEGLNLLRLSSRIDAVASRVETAVTMRSVTNSMGSVVKGMDKAME
FT                   SMNLERISLVMDKFESQFADMDVQTSYMESTMSDTTAMATPQDQVDSLMLQVADEAGLE
FT                   IQHGLGEAKVPAKEPTLGEASKEEDSNLAERLRALRPAT"
FT   gene            complement(1207624..1208418)
FT                   /locus_tag="CNA04520"
FT   mRNA            complement(join(1207624..1208068,1208122..1208253,
FT                   1208306..1208418))
FT                   /locus_tag="CNA04520"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        complement(join(1207697..1208068,1208122..1208253,
FT                   1208306..1208362))
FT                   /codon_start=1
FT                   /locus_tag="CNA04520"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41001"
FT                   /db_xref="GOA:Q5KP18"
FT                   /db_xref="InterPro:IPR041752"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP18"
FT                   /protein_id="AAW41001.1"
FT                   /translation="MSHHPTAKEVDRTYHPKGYGMSPSLARARKPFILTNVLIGGTIVA
FT                   FALGVYAYSISAVQQDDFSDVEDLLPPIEERKKIRSIEDEAREQKAFQSVASVLPTNRN
FT                   LPLATSTPASPSKAIPEAPLAETAAAAPKTSSSWVPIKRLGDVEWIKKRGWVDGKGNVL
FT                   VWGAPDVDRIGRVGDAVSSKKLV"
FT   gene            1208523..1208623
FT                   /locus_tag="CNA04530"
FT   tRNA            1208523..1208623
FT                   /locus_tag="CNA04530"
FT                   /product="tRNA-Leu"
FT   gene            1208847..1210456
FT                   /locus_tag="CNA04540"
FT   mRNA            join(1208847..1209116,1209198..1209943,1209993..1210199,
FT                   1210252..1210456)
FT                   /locus_tag="CNA04540"
FT                   /product="expressed protein"
FT   CDS_pept        join(1208955..1209116,1209198..1209943,1209993..1210199,
FT                   1210252..1210375)
FT                   /codon_start=1
FT                   /locus_tag="CNA04540"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41003"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP17"
FT                   /protein_id="AAW41003.1"
FT                   /translation="MPIHTIASAFGDISTSQLIAGAATFAVIFWIKLWSGGKKCSWERE
FT                   WAGKMILVVAPPTPTIITLIDQLLHLPSPPQILFLPPIQSPLPQDLLTILHTIRLSASR
FT                   NPVAQLHCESLPRTPDAVRDFTKKWAAAPTGTTGADGRRIDAVVLGEGWEVRPMEPKIE
FT                   GKWSVHEHQYHLLTALLPYLLRAPKERSIRIVSLVSPAWTSAIPSMAGVKPRDDIVYNT
FT                   GRRSISTILLMKHFQLILDTLAAAALGAVKPVPVAGDEDEVVKKRDMSVKSNVMSVSVI
FT                   MPWARTEVLKAAMVETPLSKILWILLYPFVLILTPSSQKTIQSVLFALSAPVRYEALDD
FT                   TLKVKDQGKEIIDPRRSTVGGGDVVRDCAVIDVPPVLCDPALAKATYDDLEKRVEAGVK
FT                   RMESKDKTKSEGK"
FT   gene            complement(1210420..1211108)
FT                   /locus_tag="CNA04550"
FT   mRNA            complement(join(1210420..1210628,1210682..1210780,
FT                   1210834..1211108))
FT                   /locus_tag="CNA04550"
FT                   /product="defender against cell death 1 (dad-1), putative"
FT   CDS_pept        complement(join(1210562..1210628,1210682..1210780,
FT                   1210834..1211039))
FT                   /codon_start=1
FT                   /locus_tag="CNA04550"
FT                   /product="defender against cell death 1 (dad-1), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41005"
FT                   /db_xref="GOA:Q5KP16"
FT                   /db_xref="InterPro:IPR003038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP16"
FT                   /protein_id="AAW41005.2"
FT                   /translation="MASKSPQPTVNSKNLQSSFDTLIDNYTSTTPARVKLIDAFLLFIL
FT                   LSGILQFAYRVLITVYPFHAFAGGFGSTVGQFVLLAGLRAQVAPGRDGEFKEVSQERAF
FT                   ADFCAASVVLHLFAFNFLG"
FT   gene            1211372..1212651
FT                   /locus_tag="CNA04560"
FT   mRNA            join(1211372..1211826,1211879..1212346,1212407..1212469,
FT                   1212529..1212651)
FT                   /locus_tag="CNA04560"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1211503..1211826,1211879..1212346,1212407..1212469,
FT                   1212529..1212576)
FT                   /codon_start=1
FT                   /locus_tag="CNA04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41007"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP15"
FT                   /protein_id="AAW41007.1"
FT                   /translation="MNPTQPNSWHRRWFAHPDFHYSISHRFRWPAYPVEGPAVASSAAA
FT                   GATNAASAGAAGAAEGAAANAALGAGGGLPPRGPYGGYHHYYDGRYPYGRRFGRRPFLR
FT                   RFFWFGLGIGAATIWHRHHDQKRQDLERFITDPKCWSSMHHRRPLPATPVDSTAAAATT
FT                   MAPLDSNDINPSYEASPRDDHRRRGWKACRERKMEERRLSEEALKYRAQPQSNTPTSAS
FT                   RDAAPVEQKETADFQSAREAVEKLWAAKRAEANEAQQRANDKAREYASERIEKLSAALE
FT                   RLRVSLQEDNKRGEDKKLV"
FT   gene            complement(1213058..1216097)
FT                   /locus_tag="CNA04570"
FT   mRNA            complement(join(1213058..1213387,1213442..1213533,
FT                   1213589..1213883,1213937..1213962,1214024..1215043,
FT                   1215091..1215204,1215250..1215379,1215472..1215775,
FT                   1215871..1216097))
FT                   /locus_tag="CNA04570"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1213215..1213387,1213442..1213533,
FT                   1213589..1213883,1213937..1213962,1214024..1215043,
FT                   1215091..1215204,1215250..1215353))
FT                   /codon_start=1
FT                   /locus_tag="CNA04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41009"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP14"
FT                   /protein_id="AAW41009.1"
FT                   /translation="MQFQQIYWLLGALTVPANAYFILSHPILETTRLDPIVSPGEISSH
FT                   VHAIVGGNNFDKTMTYQSTQEGICTTASITVDKSNYWTPQLYYYNLADESYEMIPVSYV
FT                   NTYYLPRYSSGEDTVQAFPDGLRMISGDPFRREYVDGDPDSTAITYVCLDYDNDHSGDA
FT                   DWAERNSFFDHNCPNGMRAQIFFRSCWDGVNLDSDDHKSHMAWPGGGVDGGDCPSTHPV
FT                   RLVSLFYEFIYNVQDFPFNGAGNVTWVFATGDTTGYSMHGDFVNGWPSLANGTNVLQEA
FT                   LDQCNEDNGVGGELNNCPPFVPYIDSASASACKPLNLLVDEDVGDGHSISKLPGDNPLW
FT                   IGDGTKPTYANYTDDGIGFTDFKSVIPDGYTEVGCIAESTTGRALTGSHFTASNMTRGV
FT                   CVSFCEANGYPLAGIEYADECYCDFEMRNGASNTTLLASEKCNLACPANSNENCGGSST
FT                   LTLFNNPSLYSTFTYPTGWTSYGCMTEATNARALAKYSFTSSSMTPQLCMSTCQAEGYI
FT                   YSGTEYSTQCYCGNTFSAGSVPADESSCSMACGGDKLQTCGGSDRLTTFKFDNNAASNS
FT                   SSITASATASVTANESTSSSYVTTAPSSSLG"
FT   gene            1216997..1219538
FT                   /locus_tag="CNA04580"
FT   mRNA            join(1216997..1217446,1217497..1217605,1217684..1218989,
FT                   1219050..1219167,1219215..1219538)
FT                   /locus_tag="CNA04580"
FT                   /product="ER to Golgi transport-related protein, putative"
FT   CDS_pept        join(1217823..1218989,1219050..1219167,1219215..1219507)
FT                   /codon_start=1
FT                   /locus_tag="CNA04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41012"
FT                   /db_xref="GOA:Q5KP13"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP13"
FT                   /protein_id="AAW41012.1"
FT                   /translation="MTMLRIKIALIVPFLLLVAAAFTKRVHATVQEDDTKALQRVRKLV
FT                   HRQGTEDTRSVTDSSIASATTDESIAASFGQTSQAATSVTSSDPSSANSPTSRVASSSV
FT                   TGSMPFASSFASLAEPSTNCTDPGGGCVIFLSSISSCSNDSCACDLSYPAQVCAQCLAS
FT                   EEAIDSFNSFLKTCDDAGYVAPMSTVLVEIKYCEGQEESVFASETYSGLTAVSLTDTAK
FT                   ITATEDVTLLTATMASSSAFATETSDREVVAVEINDSNDSSTILSPFTSSSNAMANTSD
FT                   ALNNLVALATDSISELSASGAASVVVITSYSTVLHTASISPTSLFSLSESAQVSDMGAL
FT                   TTGASTLSGTISTQNESGIGALNSAREFFSGDELSNCSNDCENWQQMAQTCTDDNCICT
FT                   SDALSAASKCSSCIGSQSSNSTAQMRAYAAFTSNCTSASPLSDTSGSRTSAAGLTFGGE
FT                   ATSSAGANPFATASSSGTSVNAEEAQGAATTIVVAGAGLRNVDWQPVMAIVVVVTTMAC
FT                   LVAGLYVV"
FT   gene            complement(1219554..1220863)
FT                   /locus_tag="CNA04590"
FT   mRNA            complement(join(1219554..1219574,1219626..1219767,
FT                   1219817..1219926,1219979..1220053,1220110..1220215,
FT                   1220268..1220584,1220637..1220863))
FT                   /locus_tag="CNA04590"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1219650..1219767,1219817..1219926,
FT                   1219979..1220053,1220110..1220215,1220268..1220584,
FT                   1220637..1220786))
FT                   /codon_start=1
FT                   /locus_tag="CNA04590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41014"
FT                   /db_xref="GOA:Q5KP12"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP12"
FT                   /protein_id="AAW41014.1"
FT                   /translation="MALRCRFSCIRNYRAATSNRAFKRSIMSHIRAVHSKPTLAVTDDD
FT                   AARLQEIYAKFQDPSSHYYIAPGSFGPEHEEDHRTSHVPDPAYSLDAITNAEASSPFQG
FT                   SQEQREQMDDRPWLNEDSGRKEQALEYFKQQNHDTTGVLTWPVAWGDQDSFQHVNNVQI
FT                   LRWVESARIRYCESWAGKLGKKTVYDMLRAKGTGIILKEVSIKYKAPITYPDTLMISNC
FT                   IHSVNVERASYGHRHIIWSLKDQHVKAVSDSSIVIYDYDNLRKGVMSDQLRELLLSVAG
FT                   DSKWSEEDTK"
FT   gene            complement(1221085..1222967)
FT                   /locus_tag="CNA04600"
FT   mRNA            complement(join(1221085..1221316,1221370..1222141,
FT                   1222194..1222299,1222351..1222449,1222501..1222674,
FT                   1222730..1222967))
FT                   /locus_tag="CNA04600"
FT                   /product="single-stranded DNA binding protein, putative"
FT   CDS_pept        complement(join(1221259..1221316,1221370..1222141,
FT                   1222194..1222299,1222351..1222449,1222501..1222674,
FT                   1222730..1222846))
FT                   /codon_start=1
FT                   /locus_tag="CNA04600"
FT                   /product="single-stranded DNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41016"
FT                   /db_xref="GOA:Q5KP11"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP11"
FT                   /protein_id="AAW41016.1"
FT                   /translation="MAKSAKSAPAATVKVDKKDKKSKKDEKPVPAPAPAKAAKKDVKEK
FT                   KEKKSKKAKTPTPPPESSTSESEDSEEDSSDSESSSSEDEKPAAKTAAPAAKAKEEEPS
FT                   TEESSDSDSESEEEFKTETKKEVNEESESDSDSDSGSDSNSSEDEDEKVEETKEEAKPQ
FT                   ANGNKRKAEEESIAPAKKARADGGDEEATTNVFVGQLSWNVDNDWLKSEFESCGEVVSA
FT                   RVVFDRDSQKSRGFGYVEFADLESSAKAIEKDGSEIDGRAIRVNYATQRKPNEAAEKRA
FT                   RVFNDKQSPPAETLWIGSLSFSVTEDQVYEAFGQHGDVQSVRLPTDRDTGAPKGFGYVQ
FT                   FSSVDDASAALKAMNGAEIAGRAIRVDFAPPKQDNGERGGFGGGRGGGGFGGRGGGRGG
FT                   GRGRGGFDRGGRGGGRGRGGPPRGGARTGGIVKPEGQKVTFD"
FT   gene            1223187..1225246
FT                   /locus_tag="CNA04610"
FT   mRNA            join(1223187..1223279,1223378..1223461,1223529..1223615,
FT                   1223670..1223799,1223862..1224031,1224084..1224138,
FT                   1224193..1224271,1224335..1224437,1224487..1224539,
FT                   1224588..1224666,1224724..1224827,1224933..1224984,
FT                   1225042..1225246)
FT                   /locus_tag="CNA04610"
FT                   /product="isocitrate dehydrogenase, putative"
FT   CDS_pept        join(1223226..1223279,1223378..1223461,1223529..1223615,
FT                   1223670..1223799,1223862..1224031,1224084..1224138,
FT                   1224193..1224271,1224335..1224437,1224487..1224539,
FT                   1224588..1224666,1224724..1224827,1224933..1224984,
FT                   1225042..1225131)
FT                   /codon_start=1
FT                   /locus_tag="CNA04610"
FT                   /product="isocitrate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41018"
FT                   /db_xref="GOA:Q5KP10"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP10"
FT                   /protein_id="AAW41018.1"
FT                   /translation="MFARSASKSVVSSLRTVQAPVGVRYYASAFNSSTPTSAFAGKKGA
FT                   DGNYTVTLIPGDGIGPEIANSVKQIFKAAQVPIVWEEVDVTPILKDGKTVIPDDAIKSI
FT                   KKNTVALKGPLATPIGKGHVSLNLTLRRTFSLFANVRPCVSIKGYKTPYDNVNTVLIRE
FT                   NTEGEYSGIEHEIVDGVVQSIKLITREASERVARYAFHYASESGRNKVTAVHKANIMKM
FT                   SDGMFLTACRDVAKEYPNISYDEDLLDRVCLRIASDPSPFADRVMVMPNLYGDILSDLS
FT                   AGLIGGLGLTPSGNIGKDASIFEAVHGSAPDIEGKGLANPTALLLSSLMMLRHMSLYEL
FT                   ADKIEKAALSTIAEGKAITRDLGGKAGTKEYTDAILSKL"
FT   gene            1227512..1229968
FT                   /locus_tag="CNA04620"
FT   mRNA            join(1227512..1227523,1227589..1228082,1228163..1229968)
FT                   /locus_tag="CNA04620"
FT                   /product="hypothetical protein"
FT   CDS_pept        1228427..1229617
FT                   /codon_start=1
FT                   /locus_tag="CNA04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP09"
FT                   /protein_id="AAW41020.1"
FT                   /translation="MTSFSDTSSASPLPVTPSSSRRAPSPVVAASSLATHDLSTPVSSG
FT                   PYITPPPSLRLYSSALKEKMAAGMTAAMRELKGDRDGRERKYDVEYGYDEDPIERHVKL
FT                   FLTPRTAIRPDRPRPSLSHLSTSASIRPVSAPPAVKSAKLRVTDDGYGVNMTVDDSQRI
FT                   ELAVSDESDTEMLAASPSTVGQSPVLTRERDSFVPGLIKFHRAYPSSSSLMPPRPDAWR
FT                   TDSTGSTASSIASEASFEAIKAEDMVSLYGGGGGVKRAEGPFHEETYWGDESEWGFNRA
FT                   SMLSTSTNETVRPAKTPKRTPTSTVHTSSPTATLACSLLPRATLSPAPHQQPPPRRPGC
FT                   SQQMSAASDDGRSIDGLGDLSMENDPVWLKERTLSEKMVLQAGLRSQRQRVEVRRR"
FT   gene            1230510..1232637
FT                   /locus_tag="CNA04630"
FT   mRNA            join(1230510..1230618,1230697..1230721,1230785..1231256,
FT                   1231317..1232637)
FT                   /locus_tag="CNA04630"
FT                   /product="RPN10-like protein, putative"
FT   gene            complement(1230514..1233992)
FT                   /locus_tag="CNA04640"
FT   mRNA            complement(join(1230514..1232589,1232642..1233131,
FT                   1233179..1233326,1233374..1233844,1233892..1233992))
FT                   /locus_tag="CNA04640"
FT                   /product="expressed protein"
FT   CDS_pept        join(1231068..1231256,1231317..1232483)
FT                   /codon_start=1
FT                   /locus_tag="CNA04630"
FT                   /product="RPN10-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41022"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP08"
FT                   /protein_id="AAW41022.2"
FT                   /translation="MTDDGQFASRTVLSRKKPSQWAISDYDRYQDEEDCRPPDLPWWDS
FT                   AVSDATRWYKERCKASGFDITQPANRQRAITEWSSVVASTIKPLLKHNSSGFVIHPKLA
FT                   IVTDEDIDFALRNEYSFQDGEYAPVIVSRSGTQHGSDIIRVKTEEECGSRSSATSSRLA
FT                   VPNAHLIIHSEYASDSGAPPAVHTRLALPSDPALLSKTSPAVYALFDPEDTEAQQSMQS
FT                   VINQAVEAFDQFDRDPYRSRVIEKGLMGHSRRTWSEHTRDPIDKSKYLSKYTAAFLASF
FT                   FDEPGDNEENTQGTVSGAYLTPEVVSLHGHKNSTWESCLENGTIHPAFLCDSSSIKQEI
FT                   TEDVQGRLQGLSGYGGPEFETPPPPYESQENLQEDHWEAGSLFLDFVEDGESSQLPSRR
FT                   TGGVRSVFSRSFWTRDRGTDGREDFQDSRTPRRSLRASLILRLLGNSDLSDL"
FT   CDS_pept        complement(join(1232661..1233131,1233179..1233326,
FT                   1233374..1233844,1233892..1233917))
FT                   /codon_start=1
FT                   /locus_tag="CNA04640"
FT                   /product="RPN10-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41024"
FT                   /db_xref="GOA:Q5KP07"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR027040"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP07"
FT                   /protein_id="AAW41024.1"
FT                   /translation="MPLESCMLILDNSEYMRNGDYPPTRFQAQAEAVQTVFTAKTDANP
FT                   ESAVGMMTMAGNSPSLLVTPTNDLGRLMHALSKVLVSNTAQLSTAISIAQLALKHRENK
FT                   NQRQRIVIFVGSPLGESAESLVKLGKRLRKNNVFVDVVTFGDEGRDNDEKLRGLVEAVG
FT                   EESNLVSVPSGERFLSDVIASSPILFDGENPMAAAGGFEGDIDPNMDPELAMAIRMSLQ
FT                   EAQAQQSQPADAGPSSGSGVALPDSLTQPLSTTHPSSSSGDVLMAPGDKGDLPGTPSAQ
FT                   AHAEAADKAGAIAESGTGSTFTSGNPLTGNRAPDAVQQEEEDEELKRALAMSRGEGGDI
FT                   EMEEDEDEEAAIARAIAMSLGGQEEGKDKNQ"
FT   gene            1234101..1236271
FT                   /locus_tag="CNA04650"
FT   mRNA            join(1234101..1234146,1234654..1234687,1234740..1234821,
FT                   1234867..1234935,1234982..1235745,1235800..1235940,
FT                   1235994..1236271)
FT                   /locus_tag="CNA04650"
FT                   /product="actin"
FT   CDS_pept        join(1234669..1234687,1234740..1234821,1234867..1234935,
FT                   1234982..1235745,1235800..1235940,1235994..1236052)
FT                   /codon_start=1
FT                   /locus_tag="CNA04650"
FT                   /product="actin"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41026"
FT                   /db_xref="GOA:Q5KP06"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004001"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP06"
FT                   /protein_id="AAW41026.1"
FT                   /translation="MSMEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV
FT                   MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
FT                   VLLTEAPLNPKQNREKMTQIMFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTH
FT                   TVPIYEGFSLPHAILRIDLAGRDLTDYLVKILMERGYLFTTSAEREIVRDIKEKLCYVA
FT                   LDFEQELQTAAQSSQLEKSYELPDGQVITIGNERFRCPEALFQPSLLGLEAAGIHETTY
FT                   NSIMKCDLDIRKDLYGNIVMSGGTTMYNGIADRMQKEITALAPSSMKVKIVSPPERKYS
FT                   VWIGGSILASLSTFQQMWIAKSEYDESGPSIVHRKCF"
FT   gene            complement(1236290..1238693)
FT                   /locus_tag="CNA04660"
FT   mRNA            complement(join(1236290..1236407,1236470..1236828,
FT                   1236902..1237200,1237286..1238146,1238208..1238693))
FT                   /locus_tag="CNA04660"
FT                   /product="tricarboxylic acid cycle-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1236321..1236407,1236470..1236828,
FT                   1236902..1237200,1237286..1238146,1238208..1238503))
FT                   /codon_start=1
FT                   /locus_tag="CNA04660"
FT                   /product="tricarboxylic acid cycle-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41028"
FT                   /db_xref="GOA:Q5KP05"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP05"
FT                   /protein_id="AAW41028.1"
FT                   /translation="MFFRLRRFGLLHRPRSPTACISPISYSFASPSHLNFSGKFRICSR
FT                   PLHQSSAALKLSPFKLHDIGEGITEVEILKWHVTDGQAVEEFDALCEVQSDKSVVELTS
FT                   HAKGIVRDIKTDPGHMVKVGTVLCVIETDEPSEDAAEDDLQAPPQLDNAQDSVEDNTKS
FT                   PTLGVQPQKLSGQDEIRAHESATVAQAEDLSEELERASERESPPPTPSASRRKHPLADA
FT                   DKDEDDRFSETETLFRAHDASMDASGPTKLSGEAAILPSASRREPEQYTGPVPERRSQP
FT                   VGDRERAVIKAAPAVRTLALRLGIDLSQVTPSGEGGRVVREDVFSAANTTAGVENQSAQ
FT                   VKKYNTQATSNKSEVIEQETTRVEFGRTRKVMFKALSEQAKIPHFGYSHTLDLTALIPY
FT                   LKSKPFSPSKPSYTASDIPSSLIHEDEAIPEVGKNAKPTLLTFLIKTILLALEEHPIMR
FT                   SRVKHGTDGTEKWLEVSRHGIIGVAVSDPKYGLLTPSLPPLNPSTPIPILTNHLTHLRQ
FT                   TAHRPSSQEGAHLTVSSVGGLGECSGASPILPPGGGLAICAVGRAKWEVEWVKKEGGKV
FT                   FDLGVEDVKSAGLKAVLRVPVGWSADHRVLEGAELISFTETWKKYIEEPWRWMKFSG"
FT   gene            complement(1238955..1240564)
FT                   /locus_tag="CNA04670"
FT   mRNA            complement(join(1238955..1239475,1239523..1239723,
FT                   1239785..1240018,1240076..1240203,1240255..1240291,
FT                   1240389..1240564))
FT                   /locus_tag="CNA04670"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1239094..1239475,1239523..1239723,
FT                   1239785..1240018,1240076..1240203,1240255..1240291,
FT                   1240389..1240453))
FT                   /codon_start=1
FT                   /locus_tag="CNA04670"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41030"
FT                   /db_xref="GOA:Q5KP04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP04"
FT                   /protein_id="AAW41030.1"
FT                   /translation="MDQKSVKDVAQDLATKFVSLDKVEFDSAINQYFDANCKQTSRLAE
FT                   VQGVSRIKKLAALEAAVASDSHLAGNVNYDPKDETIRFSWERTFRPPAIPSVIPLSHWA
FT                   NHHLEKVALKSTWDSQLHMNAARDEEGETKLYVTKVGPTKRRDTTWFEDILPFFLIRPI
FT                   ISFFFILASDVYSIISRHPVAEEGQLEASLSIVSELFGCDTSVDKGIAAKRIITWPVYF
FT                   LFGLFGLLISSVQSSIHFVHDTLHLDSNPIAQLVSVFEDYALRLFNIIYPNVRHIVLSS
FT                   VNVAENTAKAYGVPAEEYHELAERKVGEAVKWLGRATEAQSSRNEASGTRRNPQAPGAP
FT                   SYAEAVKE"
FT   gene            1240793..1241633
FT                   /locus_tag="CNA04680"
FT   mRNA            join(1240793..1241252,1241316..1241407,1241462..1241633)
FT                   /locus_tag="CNA04680"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        join(1240896..1241252,1241316..1241407,1241462..1241540)
FT                   /codon_start=1
FT                   /locus_tag="CNA04680"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41035"
FT                   /db_xref="GOA:P0CR32"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR028882"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR32"
FT                   /protein_id="AAW41035.1"
FT                   /translation="MSVLRALPRVARVVRPAPPSLRSISTTNTIFKSPTADPFPLPFSD
FT                   PELAHANNSLPSNSEEWPLPEPLDRTGEDEKTLRARLIYQTRKRGTLETDLILSTFARD
FT                   ELPNMDFEEMKQFDKLLDEPDWDIFYWSVKKRDPPARWKGTPLLEKLQKHAKNEGKVVR
FT                   MMPELMQKEPDL"
FT   gene            1241680..1244940
FT                   /locus_tag="CNA04685"
FT   mRNA            join(1241680..1242019,1242068..1242172,1242232..1242336,
FT                   1242402..1244164,1244214..1244940)
FT                   /locus_tag="CNA04685"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1241762..1242019,1242068..1242172,1242232..1242336,
FT                   1242402..1243706)
FT                   /codon_start=1
FT                   /locus_tag="CNA04685"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY6"
FT                   /protein_id="ALO60335.1"
FT                   /translation="MQHPRVNRYPDNVLIRLPAYYADYGGPGWYPELQFPHQTRLAVRY
FT                   SSALRKDVYIQPNALYISGIKEELGKEGICEILYSFGVERGLEFTMYQPLRHLPGLVMT
FT                   TMQFPSQRQAEDVLIIVNKNSHLFVSSTSEFKARYSEINSRGVNAASTRDILLVREELS
FT                   LAPAYIPTVASSHPAHPLSLQPSRWNAVGYARDAFVNKRKLTEYDHDLHPLVYGHLHDP
FT                   SDKRTHRGRGYDRMNRCNPHDRRVVPSPRKKRLLAHDFLPSSLHRYEDIPKLHHHDYQV
FT                   SSHLIESVPESALQHGRKSPYTRFQNVLADYSQHKSASRSTLWNTTQRPPKKKIKRRKN
FT                   LFKAKYAYALDMGIRSHVGNETVRTGANAQKRTFLSKRLPTLTETSENQMEGENQTEAP
FT                   SIPSADVLEWLRQTVLDNDGNAKTLATAAETLKVNVPVQAEQGRNLTSEEHPGWNGEAN
FT                   AALDKESRPQLRALPQTCAINLGPPRPSCSTPSPFIYSDLQPFATYFCPFIRQTGYCEP
FT                   KFIALSNDRKTLSLMRRYDPHESRSFSAVCAIDALPEDQRNLLGLERRWTMIGHAEKMW
FT                   RESEKGAVQFRAPE"
FT   gene            complement(1243859..1245799)
FT                   /locus_tag="CNA04690"
FT   mRNA            complement(join(1243859..1244097,1244155..1244287,
FT                   1244338..1244581,1244633..1244653,1244707..1244796,
FT                   1244849..1244867,1244917..1245002,1245055..1245443,
FT                   1245505..1245799))
FT                   /locus_tag="CNA04690"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1243984..1244097,1244155..1244287,
FT                   1244338..1244581,1244633..1244653,1244707..1244796,
FT                   1244849..1244867,1244917..1245002,1245055..1245443,
FT                   1245505..1245692))
FT                   /codon_start=1
FT                   /locus_tag="CNA04690"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41038"
FT                   /db_xref="GOA:Q5KP02"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035547"
FT                   /db_xref="InterPro:IPR038885"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP02"
FT                   /protein_id="AAW41038.1"
FT                   /translation="MWIHRYSPIVQFLLVLALVPLNCWSLPPHLPKPQLPGKLVPFSRL
FT                   HECPSLPSRAYPTVAKDVRPDDFRVVMALGDSITAGLLARGSRSSSASSAPSQVDPQRP
FT                   LLPFLDIQEYRGLSYPIGSDPGAITIPEILRHFSPSAKEIPGSSKGKHPPVTCLNGWGI
FT                   KGCAERPEEDGLNAAVSGSVSSGLLRQVEDFILPRLKDMEIRKEDWKFVNLGIGANDIC
FT                   SFCLYSNMTDIDFNGSPKRFAKDIKRAVNALRKNVPNIIINIIGLFRVSAIYKLTLKDP
FT                   YCQPPLFPYPIPHFPLGCSCALLPGPTGDWTRQKMDELGEAYDEAVLEIVREWEKEDDE
FT                   HFGAIWQPGTAIDLPNYPITALSPIDCFHPSEASHQRMAAGIWNRLTLSLEEKYLPISW
FT                   DDEIMVRCLEEDDRVSVGMVSESFRGAS"
FT   gene            1245947..1247099
FT                   /locus_tag="CNA04695"
FT   mRNA            join(1245947..1246089,1246160..1246305,1246367..1247099)
FT                   /locus_tag="CNA04695"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1246031..1246089,1246160..1246305,1246367..1246404)
FT                   /codon_start=1
FT                   /locus_tag="CNA04695"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LHZ9"
FT                   /db_xref="InterPro:IPR028036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHZ9"
FT                   /protein_id="ALO60336.1"
FT                   /translation="MSSTALDTADKRAFPGKDCLTCRLTGAAAFTGIGTYALVQANQQG
FT                   AFKRIRPQGAPVVAGKITALVGTVFIGLGIGRLFI"
FT   gene            complement(1246583..1248510)
FT                   /locus_tag="CNA04700"
FT   mRNA            complement(join(1246583..1246694,1246748..1246945,
FT                   1247002..1247086,1247137..1247411,1247475..1247722,
FT                   1247775..1247817,1247876..1247933,1247980..1248066,
FT                   1248143..1248243,1248298..1248510))
FT                   /locus_tag="CNA04700"
FT                   /product="acetyl-CoA C-acyltransferase, putative"
FT   CDS_pept        complement(join(1246662..1246694,1246748..1246945,
FT                   1247002..1247086,1247137..1247411,1247475..1247722,
FT                   1247775..1247817,1247876..1247933,1247980..1248066,
FT                   1248143..1248243,1248298..1248417))
FT                   /codon_start=1
FT                   /locus_tag="CNA04700"
FT                   /product="acetyl-CoA C-acyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41040"
FT                   /db_xref="GOA:Q5KP01"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP01"
FT                   /protein_id="AAW41040.1"
FT                   /translation="MASTIQNITNSIPSLGRARLLINSSDDVVIVSAVRTPIAKAKKGG
FT                   FKDCCPEDLLAAVFTEAVKRGKVNPSQIQDVAVGNVLPPGGGANVARMAQLYAGIPYTT
FT                   PINTVNRQCSSGLTAVVQIANEIKAGEIDIGIGAGVEHMTAHYGAGVLPEKMSEEILSN
FT                   PESADCLTPMGITSENVAKQYNISRDVQDTFAANSFGKAAAAQKAGKFKEEIVPVKVRW
FT                   TDPKTNDEKEIIIDSDEGIREGVTAESLAKLKPAFAKDGSTHAGNASQVSDGAAAVILA
FT                   RRSVAQKLGLPILGKFVISAVVGVPPKLMGIGPAFAIPKVLEKAGISKDDVDFFEINEA
FT                   FASQAVMSIQHLHIPFEIVNPVGGAIAIGHPLGCTGARQIATAFSEAKREKKKIFVTSM
FT                   CIGSGMGMAAVFVNEQ"
FT   gene            1248657..1249970
FT                   /locus_tag="CNA04710"
FT   mRNA            join(1248657..1249100,1249160..1249302,1249364..1249434,
FT                   1249486..1249697,1249776..1249970)
FT                   /locus_tag="CNA04710"
FT                   /product="expressed protein"
FT   CDS_pept        join(1248738..1249100,1249160..1249302,1249364..1249434,
FT                   1249486..1249601)
FT                   /codon_start=1
FT                   /locus_tag="CNA04710"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41042"
FT                   /db_xref="GOA:Q5KP00"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KP00"
FT                   /protein_id="AAW41042.2"
FT                   /translation="MASICTACSRLLPRPAIPSSSRLPASLARLPPPRHFSTLLTPYFQ
FT                   RRVPRSDPKPCRLATTSAYNSSRSGLPDLPPIPSRPNIKVSAPSLAAIKEEGFYDDDVK
FT                   LLPPEEAFLNITPEAVQQLTRITSREPLEVLSQGKLALRVGVESGGCHGYQYIMDLTEE
FT                   RGVDDYVLQPEGVACIPVVIDLTSFGLLKGATLHHATELIGSSFRLQDNPQAKEGGACG
FT                   CGVSWEAK"
FT   gene            complement(1249592..1252492)
FT                   /locus_tag="CNA04715"
FT   mRNA            complement(join(1249592..1249871,1249933..1250007,
FT                   1250061..1250093,1250144..1250779,1250847..1251661,
FT                   1251715..1251946,1252013..1252492))
FT                   /locus_tag="CNA04715"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1249669..1249871,1249933..1250007,
FT                   1250061..1250093,1250144..1250779,1250847..1251456))
FT                   /codon_start=1
FT                   /locus_tag="CNA04715"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LHY7"
FT                   /protein_id="ALO60337.1"
FT                   /translation="MSTHLEELKNHKKMIWNDAACTQLDILRRSYSAVQSHLTTNQMLP
FT                   DIATKIYDDLCSLRSGASKPLTGKNKNRSRPWTKALSELRFAVSNLQSSAWDIDPELLI
FT                   DIQQKADRFFTETTERQEGPIRKCHMDALTKGDLDDPTYGPSVLRFSLTRLKELESYTK
FT                   AKRDEVAKMVNTINKDWEECSDGRNFKWNEVTTPRVSRQNVANSWFGMSSSTPFTQENA
FT                   TADEPSLHDYLLERMIPYIPSKVDYTPDLSALKPMPQVAFNCLSELQQDINSYADTLPS
FT                   GQPRNKMVSSQQAKYSAAISSAMEEIVERSKAKWEEMATPLNDSTVASEGLEAHNALTS
FT                   RAASNYFTLRALQTEHSKPPATTKNEHKAWATSVQRDREEAKKWERDVEEWHVSRMANE
FT                   SIGVGSDGEASRQLDAVTTQIDAATVSETHTIAPRQLTELEKLFIANGLELNEQFDWFE
FT                   EVQTNLPLPESAAITSQSGTRTREKSASAMSVPSSGSTLSNSDRWRKIRDLPSWRKTGV
FT                   E"
FT   gene            complement(1252581..1257493)
FT                   /locus_tag="CNA04720"
FT   mRNA            complement(join(1252581..1253361,1253417..1253812,
FT                   1253880..1254341,1254398..1254492,1254546..1255173,
FT                   1255228..1256823,1256903..1257022,1257188..1257310,
FT                   1257417..1257493))
FT                   /locus_tag="CNA04720"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1253296..1253361,1253417..1253812,
FT                   1253880..1254341,1254398..1254492,1254546..1255173,
FT                   1255228..1256823,1256903..1256929))
FT                   /codon_start=1
FT                   /locus_tag="CNA04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41351"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ9"
FT                   /protein_id="AAW41351.2"
FT                   /translation="MQSGPRMVMPSAPHIQHPGMNPPIDPALQQQMMVVNGAQRVPFEQ
FT                   QTMSDENRAYLEQQVRLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQGREVK
FT                   TAAQRSLGVAAQQAPRHMMQHPQMVQSLQAQGIRQVLTPQGGVVWLDAQNRQVQINQAW
FT                   QNDPRQQQQQQQQQQVGQGQQMQALYQQQQQQHLQQQQLLQQMQQQQVQQQQQQQVQQQ
FT                   QQMMTPQQQAQLQHLQRQQALAQQAAQAQQRASLPPSARPPPASLPTPSLLQVPPPPSM
FT                   KRPMHDISRSASPMPPHMRMQQSQPPQPQATHMQASSSALSVTGNAPAILPPRASTIPV
FT                   SMSDSHIAQNRPQQVGQSQANGLQIPPQIPPEPPMRWSKTLILSSQNRLERWKQKTDKL
FT                   ESMLADAKLGLAEMEKEAKEGKKRAEERSHDPQGMFDKEILAYLKRAGYSNAVQAFEED
FT                   MKRAGRNIEGKPGSPSGSSPKMQSPRDVKTSSTPAGQSVSATGKDDPQGSDSIFGRETD
FT                   DEKMGVDKDGEEKDETKDLGELFTWWMLYQDTRTLLAQKPHLFQPPTSLISSHSANAAN
FT                   NVAFPPTTTRTAPQAKHDDTQLRLQQAEEMKQAQQAQISAQQESVRRQLAMQQGQNQHP
FT                   HQQQQQQQGQEQRHIVMINNQPHTLTQDEVHRLIQQQQYMTQQNQIQQQQRQQQQQQHQ
FT                   QSQMFAISNGHIASQTPGMHHQTQQQRMQFESPLQKRKREGEDGQMGGKFPKVGAPTPE
FT                   DQRRQAVELARSVSAQMTPQQGHMNEISQSPASQTSQDPTRQHNLAEAQRVYAATQAAY
FT                   ARQQVERTSVANSPANFTIGVSPVQLGTSPMGNGQSPAVGHDVDGNSNVNGNTVDRAPT
FT                   PASAKGKKKPARITIDTEVGGASDLDAPQSGAASATSKRKTPSAGKRPLKSATTTAEKP
FT                   VKGKAKTKAAKNAYANQPTGDALRTEGEEPAQTPSGQVAQTPGSTQSTVYPLPAQTPSQ
FT                   EQPTPAPLTEIEHIHPESQPAPPPPPAQVPAQMQTQAPQSQNTSFEAPFEFDDSNELFK
FT                   MLDFNDGDGGGFDNEVFNFDGFAFPSVGENQEDWQAIDSSS"
FT   gene            complement(1257731..1259800)
FT                   /locus_tag="CNA04730"
FT   mRNA            complement(join(1257731..1258256,1258317..1258397,
FT                   1258487..1258764,1258828..1258976,1259034..1259074,
FT                   1259129..1259230,1259288..1259375,1259454..1259800))
FT                   /locus_tag="CNA04730"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1258017..1258256,1258317..1258397,
FT                   1258487..1258764,1258828..1258976,1259034..1259074,
FT                   1259129..1259230,1259288..1259375,1259454..1259746))
FT                   /codon_start=1
FT                   /locus_tag="CNA04730"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41044"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ8"
FT                   /protein_id="AAW41044.1"
FT                   /translation="MSGPLGNLPGMTYDPLKNRYFPTPKGPLQNDQPTPSLYASASLSR
FT                   KGRPEMILGILDCQPQRKRQKPDIHESLVSGPGRKLVKGRGRMGVGMGKRSERGEEAIL
FT                   SKLQLDAEHHSCGCHGETITSYKSFGEEAYLATTDHGKLVMHGPEGETVVLYICPQVLM
FT                   GVHFDIMRMTLIAVSGGADPHVHLFKRDPQMLEHIFMSHSELNLNGGDMYEVSSFDDRC
FT                   TIGGHKSLTTINYTSSFTTSNRRLPSDALAVHQYSRDLVFTGQRSGLVTCEDLRVKPKS
FT                   PVVVGGTRGRKAVVNVKRVQDGAVPWGLVVSGMGDELLLYDVRFSDKPLHTFQGHINNY
FT                   QTQVSTALSPSGTHLFASGSDNRIRAYSLLTGSPLTPWPEDEYHQQEENPLVKEFEDKI
FT                   TGLSVRDDLGLDVVVKGQLLRFAK"
FT   gene            1259986..1260727
FT                   /locus_tag="CNA04740"
FT   mRNA            join(1259986..1260269,1260337..1260727)
FT                   /locus_tag="CNA04740"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1260051..1260269,1260337..1260624)
FT                   /codon_start=1
FT                   /locus_tag="CNA04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41046"
FT                   /db_xref="GOA:Q5KNZ7"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ7"
FT                   /protein_id="AAW41046.1"
FT                   /translation="MSQPSQQALLAALAAQSSRPRPATVPYAALGPSQLKSEATSGNSR
FT                   KLHCPRDGCGSVLLQPGVGVWADLQASVLPDDPSSPFPAPAAPHAVWHVASGPFAFDNI
FT                   GFSRPDASTTLPPHTPSGSAQGADKGKVKWLICADCDLGPLGWTYEGERDAWLAVERVS
FT                   YGESK"
FT   gene            1260951..1262953
FT                   /locus_tag="CNA04750"
FT   mRNA            join(1260951..1261623,1261712..1261866,1261944..1262362,
FT                   1262453..1262588,1262700..1262953)
FT                   /locus_tag="CNA04750"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1261012..1261623,1261712..1261866,1261944..1262362,
FT                   1262453..1262588,1262700..1262859)
FT                   /codon_start=1
FT                   /locus_tag="CNA04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41048"
FT                   /db_xref="InterPro:IPR031355"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ6"
FT                   /protein_id="AAW41048.2"
FT                   /translation="MDDPWADAPASPLPKSEHRFGNVNINDNENANAFSNYSLPKSPSA
FT                   NGPEKVQEEQTEEKTKVETETEPSREEINGASESDDEAQVAQVQSSPAQESHQWLSPQV
FT                   EASDQEEKAEREESEEREEDGEEEQDDFDDFNSFDGPRSSSFPTPNPDKGAMPGEGGDI
FT                   DDGFGDFADFEKGEFDEPVGAEAGIGGNGLVEEPEPIKERWHALELRPPPPKSEIANQL
FT                   SSILSPLFLHQDSLSNEPIRMVGGLKQVLVSQSSRDAYAQLTTPPITKPLDWTRSRVRR
FT                   EHLISMGVPVNLDEVDSHRLSALPPLRIVTSSGSGSSRPQPRRAETFDAYTGVKYTSDQ
FT                   KGKGRDTDGSMSAGPGVGVGYMERDMNGEETGKYGLGEKPEMDTLRAEELCGLEEDALS
FT                   ILPIASLRKLQSDLVENTSQVSATLAWMLQLKDAQLHDSATYNGMISSLIANAARVKAS
FT                   ENTGGGGVFRRGSSKRPQSVSGGMTPKRTGSPGVW"
FT   gene            complement(1262944..1265816)
FT                   /locus_tag="CNA04760"
FT   mRNA            complement(join(1262944..1263840,1263898..1264325,
FT                   1264375..1265325,1265373..1265816))
FT                   /locus_tag="CNA04760"
FT                   /product="response to osmotic stress-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1263116..1263840,1263898..1264325,
FT                   1264375..1265325,1265373..1265716))
FT                   /codon_start=1
FT                   /locus_tag="CNA04760"
FT                   /product="response to osmotic stress-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41050"
FT                   /db_xref="GOA:Q5KNZ5"
FT                   /db_xref="InterPro:IPR007632"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ5"
FT                   /protein_id="AAW41050.1"
FT                   /translation="MPSQVPASPTAPGPPVLSAPTMSSSPRSLGPINDNPYNVDLVVPY
FT                   SIALSKKDLKNRPKAEAEIKEGYVYLLRELEGSGFRLASKAGRGNKGQEEVWIFVGASE
FT                   ERVEQLVEEERRLDASHNLLTAPSAFPPAPATRLRLIYNTLTAPKLQGGLGITPGRGKW
FT                   SRVKSISALHDEAADKAWVEKWTTGGDWQVGLTKGLDEDTRKRGGLGDQQPPPVHLYFD
FT                   FLTTYTLSLFPITVVSVLFYFFTPADSYPPLYALCLSLYSTIFIAIWRVKQRKFAVKWG
FT                   TYGCENVAFGRLRPEYVASLGLDKTTAQQDVETVDAVQAGSELKRDSKVAASIPVIAAC
FT                   GVGLGVVLMGLFVLEAFVSELYDGPGKQIVPLIPTGLFVLIVPSIVGAYQLLAKFMVKW
FT                   EDHPTPVGEEKSLTAKTFAMNAIVAYLGLFLSAYIYIPFGSFIMTHVQTHLMGRLPVPG
FT                   SRRVNSTTSSVTSPTSSAPASISAEKHAINGGRLKSQLFTYTVTNQVSGAFLELGMPFI
FT                   MRFIHDWRAGKTTIKEALKKTNGHGESEKVPTTEEEIEKRFLNKVERELALPEYDTFTD
FT                   YAEMVTQFGYVVIWSLVWPLAPVFALINNYIELRSDALKICKHVRRPVGDRVETIGSWL
FT                   ETLSIISWIGAITNATLIYLFRPSPASPDLHSQSPNPNFPTPGSPSLSHIVSAYHSSSS
FT                   LQEWYPQLATLGLWALGASHGYIVLKWVVEGIVERVWWRGSEEEREVQRMRAGSSSPST
FT                   SGVVNSPSKSISARTPEPEFRYGDETDQNGGLGKILGKEPVSTFWNGGEEGAKEIARII
FT                   KAE"
FT   gene            1267190..1270455
FT                   /locus_tag="CNA04770"
FT   mRNA            join(1267190..1267668,1267746..1267846,1267908..1268000,
FT                   1268048..1268256,1268322..1268853,1268903..1270103,
FT                   1270158..1270455)
FT                   /locus_tag="CNA04770"
FT                   /product="phosphoprotein phosphatase, putative"
FT   CDS_pept        join(1267515..1267668,1267746..1267846,1267908..1268000,
FT                   1268048..1268256,1268322..1268853,1268903..1270099)
FT                   /codon_start=1
FT                   /locus_tag="CNA04770"
FT                   /product="phosphoprotein phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNA04770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW41052"
FT                   /db_xref="GOA:Q5KNZ4"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR026070"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KNZ4"
FT                   /protein_id="AAW41052.1"
FT                   /translation="MPSTPTRAFPNEVAVFSNYLVFTTLTLKEVQAHAKTPYGHPGNKR
FT                   ACSLFTLDDDMRYTSFAMDHGPLNLAFTFHACIRIHEKLEKARERGKPVCLYTTTEPKM
FT                   KSNMILIAALYSLIVDKQPPWNAFRPIAQFEIMPFRDAGSGPMDYGLTVQDILYGVEKA
FT                   IGNGLLDLSSFDADEYQYYEMVENGDLNILGPFIPFASPTENSWIEGVLQSPSNGHIIH
FT                   TPVKSKTISHQLRCVLDIFQRENVGLVARLNDELYDRRHFLDMGIEHIEMFFDDGTNPP
FT                   DDIVREFIRLAEYTIEHKRQKVAVHCKAGLGRTGVLIGAYLVYKYQFTAQEAIGFMRIV
FT                   RPGMVVGPQQQYMVLNQLKWVGWAARDQALREIAHASCVESNPSMSPPVEIVINPHAGQ
FT                   DIETPTRIRPITRSSKLRPRRSHSSSSLVTTSPRRGGDAVGQPRKPRQLVESTTETEQE
FT                   ELRSSQSRLPPSSPPVVAEVPADQKENEFNPSTVSSLGSIRGTKRSAARPSSGYEHPNS
FT                   LPRVSLNVPPSNLTRANSNVSIGSEGSVDERAPKRRTGSSPEVEGSGAIVSPVSEPMVT
FT                   EQVETPVRLTVTKKLRLHIHSSPPTSPPASTPCVPRATPPSVNLAASTEAPSTPTRVPT
FT                   RAIHEDMSVTASVRRTMPAKKSFLPVRKSVESKSSPVRATTNPATAQSPSLSTRNSGRI
FT                   ANTLNKYEGIAVNSNGNAKNVRTATPASKKLGRGVMKKGVLTPPRITEMWGQLSRIGSS
FT                   PPADKEKQ"
FT   gene            complement(1270242..1272201)
FT                   /locus_tag="CNA04780"
FT   mRNA            complement(join(1270242..1270710,1270788..1270931,
FT                   1271014..1271313,1271371..1271526,1271586..1271649,
FT                   1271703..1271828,1271879..1272201))
FT                   /locus_tag="CNA04780"
FT                   /product="carnitine/acyl carnitine carrier, putative"
FT   CDS