(data stored in ACNUC3476 zone)

EMBL: AE017344

ID   AE017344; SV 1; linear; genomic DNA; STD; FUN; 1783081 BP.
XX
AC   AE017344;
XX
PR   Project:PRJNA13856;
XX
DT   10-JAN-2005 (Rel. 82, Created)
DT   29-NOV-2015 (Rel. 127, Last updated, Version 16)
XX
DE   Cryptococcus neoformans var. neoformans JEC21 chromosome 4 sequence.
XX
KW   .
XX
OS   Cryptococcus neoformans var. neoformans JEC21
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes;
OC   Tremellales; Cryptococcaceae; Cryptococcus;
OC   Cryptococcus neoformans species complex.
XX
RN   [1]
RP   1-1783081
RX   DOI; 10.1126/science.1103773.
RX   PUBMED; 15653466.
RA   Loftus B.J., Fung E., Roncaglia P., Rowley D., Amedeo P., Bruno D.,
RA   Vamathevan J., Miranda M., Anderson I.J., Fraser J.A., Allen J.E.,
RA   Bosdet I.E., Brent M.R., Chiu R., Doering T.L., Donlin M.J., D'Souza C.A.,
RA   Fox D.S., Grinberg V., Fu J., Fukushima M., Haas B.J., Huang J.C.,
RA   Janbon G., Jones S.J., Koo H.L., Krzywinski M.I., Kwon-Chung J.K.,
RA   Lengeler K.B., Maiti R., Marra M.A., Marra R.E., Mathewson C.A.,
RA   Mitchell T.G., Pertea M., Riggs F.R., Salzberg S.L., Schein J.E.,
RA   Shvartsbeyn A., Shin H., Shumway M., Specht C.A., Suh B.B., Tenney A.,
RA   Utterback T.R., Wickes B.L., Wortman J.R., Wye N.H., Kronstad J.W.,
RA   Lodge J.K., Heitman J., Davis R.W., Fraser C.M., Hyman R.W.;
RT   "The genome of the basidiomycetous yeast and human pathogen Cryptococcus
RT   neoformans";
RL   Science, e1252229 307(5713):1321-1324(2005).
XX
RN   [2]
RP   1-1783081
RA   Loftus B., Amedeo P., Roncaglia P., Vamathevan J., Utterback T.,
RA   Van Aken S., Fraser C.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1783081
RA   Janbon G., Paulet D., Chon C.C., Mornico D.;
RT   ;
RL   Submitted (17-NOV-2015) to the INSDC.
RL   Institut Pasteur, 25 rue du Dr Roux, Paris 75015, France
XX
DR   MD5; 232f83a80e7823bc5e49992094397b8b.
DR   BioSample; SAMN03081418.
DR   EnsemblGenomes-Gn; CND00230.
DR   EnsemblGenomes-Gn; CND00270.
DR   EnsemblGenomes-Gn; CND00330.
DR   EnsemblGenomes-Gn; CND00590.
DR   EnsemblGenomes-Gn; CND01610.
DR   EnsemblGenomes-Gn; CND02760.
DR   EnsemblGenomes-Gn; CND02850.
DR   EnsemblGenomes-Gn; CND03990.
DR   EnsemblGenomes-Gn; CND04000.
DR   EnsemblGenomes-Gn; CND04650.
DR   EnsemblGenomes-Gn; CND04820.
DR   EnsemblGenomes-Gn; CND05380.
DR   EnsemblGenomes-Gn; CND05420.
DR   EnsemblGenomes-Gn; CND06210.
DR   EnsemblGenomes-Gn; EFCNEG00000000030.
DR   EnsemblGenomes-Gn; EFCNEG00000000039.
DR   EnsemblGenomes-Gn; EFCNEG00000000047.
DR   EnsemblGenomes-Gn; EFCNEG00000000048.
DR   EnsemblGenomes-Gn; EFCNEG00000000062.
DR   EnsemblGenomes-Gn; EFCNEG00000000073.
DR   EnsemblGenomes-Gn; EFCNEG00000000093.
DR   EnsemblGenomes-Gn; EFCNEG00000000096.
DR   EnsemblGenomes-Gn; EFCNEG00000000097.
DR   EnsemblGenomes-Gn; EFCNEG00000000111.
DR   EnsemblGenomes-Gn; EFCNEG00000000147.
DR   EnsemblGenomes-Gn; EFCNEG00000000148.
DR   EnsemblGenomes-Gn; EFCNEG00000000150.
DR   EnsemblGenomes-Gn; EFCNEG00000000152.
DR   EnsemblGenomes-Gn; EFCNEG00000000159.
DR   EnsemblGenomes-Gn; ENSRNA049504489.
DR   EnsemblGenomes-Gn; ENSRNA049543154.
DR   EnsemblGenomes-Gn; ENSRNA049543233.
DR   EnsemblGenomes-Gn; ENSRNA049543311.
DR   EnsemblGenomes-Gn; ENSRNA049543335.
DR   EnsemblGenomes-Gn; ENSRNA049543380.
DR   EnsemblGenomes-Gn; ENSRNA049543437.
DR   EnsemblGenomes-Gn; ENSRNA049543485.
DR   EnsemblGenomes-Gn; ENSRNA049543625.
DR   EnsemblGenomes-Gn; ENSRNA049543642.
DR   EnsemblGenomes-Gn; ENSRNA049543647.
DR   EnsemblGenomes-Gn; ENSRNA049543700.
DR   EnsemblGenomes-Tr; CND00230.
DR   EnsemblGenomes-Tr; CND00270.
DR   EnsemblGenomes-Tr; CND00330.
DR   EnsemblGenomes-Tr; CND00590.
DR   EnsemblGenomes-Tr; CND01610.
DR   EnsemblGenomes-Tr; CND02760.
DR   EnsemblGenomes-Tr; CND02850.
DR   EnsemblGenomes-Tr; CND03990.
DR   EnsemblGenomes-Tr; CND04000.
DR   EnsemblGenomes-Tr; CND04650.
DR   EnsemblGenomes-Tr; CND04820.
DR   EnsemblGenomes-Tr; CND05380.
DR   EnsemblGenomes-Tr; CND05420.
DR   EnsemblGenomes-Tr; CND06210.
DR   EnsemblGenomes-Tr; EFCNET00000000030.
DR   EnsemblGenomes-Tr; EFCNET00000000039.
DR   EnsemblGenomes-Tr; EFCNET00000000047.
DR   EnsemblGenomes-Tr; EFCNET00000000048.
DR   EnsemblGenomes-Tr; EFCNET00000000062.
DR   EnsemblGenomes-Tr; EFCNET00000000073.
DR   EnsemblGenomes-Tr; EFCNET00000000093.
DR   EnsemblGenomes-Tr; EFCNET00000000096.
DR   EnsemblGenomes-Tr; EFCNET00000000097.
DR   EnsemblGenomes-Tr; EFCNET00000000111.
DR   EnsemblGenomes-Tr; EFCNET00000000147.
DR   EnsemblGenomes-Tr; EFCNET00000000148.
DR   EnsemblGenomes-Tr; EFCNET00000000150.
DR   EnsemblGenomes-Tr; EFCNET00000000152.
DR   EnsemblGenomes-Tr; EFCNET00000000159.
DR   EuropePMC; PMC2651461; 19129161.
DR   EuropePMC; PMC2912664; 20689742.
DR   EuropePMC; PMC3390403; 22792079.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00020; U5.
XX
CC   This record represents the complete annotated sequence of the C.
CC   neoformans JEC21 genome. A small number of gaps exist which are
CC   represented by NNNNs within the final sequence. The genome has been
CC   annotated by TIGR and the annotation data is available for viewing
CC   and download from the TIGR database
CC   (http://www.tigr.org/tdb/e2k1/cna1/).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1783081
FT                   /organism="Cryptococcus neoformans var. neoformans JEC21"
FT                   /chromosome="4"
FT                   /strain="JEC21"
FT                   /variety="neoformans"
FT                   /serotype="D"
FT                   /mol_type="genomic DNA"
FT                   /note="MAT-alpha"
FT                   /db_xref="taxon:214684"
FT   gene            1076..2305
FT                   /locus_tag="CND00010"
FT   mRNA            1076..2305
FT                   /locus_tag="CND00010"
FT                   /product="hypothetical protein"
FT   CDS_pept        1076..2305
FT                   /codon_start=1
FT                   /locus_tag="CND00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43042"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA7"
FT                   /protein_id="AAW43042.1"
FT                   /translation="MAENGFKMLGTMVGPKKAREEFLKSKMESEVKKIARLKDLPNQHA
FT                   LLLLRFCIQQNLRHLQRSLKSDDLKDYWEKMDQELWDEVQRMRTRQTEGTEAENALGKK
FT                   LSHLPARFGGLGLLSFTDVAPLAYKAAAAQADKHLANIFGLDLPDEAPTPSQRELCSSM
FT                   WEHQQTTILEGLNDPARKRLIENASKIGKRWLNVIPYFQPLRLSNQEVATGLHDRTLVG
FT                   SSIAICSFCGSDSPLGHDELCRSRNSWAQRRHDSINRIIHRGLQSVEGAVVSLEPRTLE
FT                   GQRRNDLRVRGRCGLHATDYDLKVYCLNDRDARSTLSAKLPSTPVATHVLNRCLSWLDK
FT                   VSEIATKKAPATHAGVFKAVVMSTGGLMSRETADEMRKWRREMGHMAFEGMMRKMSLEL
FT                   VRARARTFAM"
FT   gene            3682..6115
FT                   /locus_tag="CND00020"
FT   mRNA            join(3682..3846,3906..4005,4053..4236,4287..4546,
FT                   4595..5010,5059..5164,5216..5548,5598..6115)
FT                   /locus_tag="CND00020"
FT                   /product="myo-inositol transporter, putative"
FT   CDS_pept        join(3700..3846,3906..4005,4053..4236,4287..4546,
FT                   4595..5010,5059..5164,5216..5548,5598..5719)
FT                   /codon_start=1
FT                   /locus_tag="CND00020"
FT                   /product="myo-inositol transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43040"
FT                   /db_xref="GOA:Q5KJA6"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA6"
FT                   /protein_id="AAW43040.2"
FT                   /translation="MSPTLDTITPMPEGGNNQTSVNISKEDLKVETEHYENVAYIASTH
FT                   DGLIDENLVRAENEDKVTPYFMFLISVAAIAGFLFGYDTGIVGAALPMVDTALGHTLSA
FT                   TESEIITAGTTIGAIFGASILGTMADKLGRKWAMVISDFAFTAGAIIIAASYSVPQIIV
FT                   GRLVLGVGVGGAAVIAPLYIAELAPTAVRGRCVGVNAFCIPFGQVIASAIGAGFQAGVP
FT                   YHIGWRVLFALGVVPSVVQLCLMHFLPESPRVLVLRGKEQEARVCLKKIYGAATDDIID
FT                   LKLRIVKQYVAATTAMQRDLSFTERAKKYWTHKPYRRAIISISGVQAFGQLTGFNTLLY
FT                   YSGTIFGLLGIKNGSAAGLIPSCLNALFVFIGMSIVDKVGRRKLMVTFIPGMMIAFTWT
FT                   IISFHYLTKPTGGLLLKDYQYSTPLVGSVLGSIVLFVIPYGLTYSHIIWYQSEFLPLEI
FT                   RAAGSAISTTACWLANLVVSVAYLTQLEKLGATGTYGLYLGFITIGYVFVYFCYPETKG
FT                   LSIDETAEIFIDGFGIEKAHQMLREKRAFAAELHANRA"
FT   gene            8313..9185
FT                   /locus_tag="CND00030"
FT   mRNA            join(8313..8587,8626..8695,8767..9185)
FT                   /locus_tag="CND00030"
FT                   /product="maltose O-acetyltransferase, putative"
FT   CDS_pept        join(8330..8587,8626..8695,8767..9074)
FT                   /codon_start=1
FT                   /locus_tag="CND00030"
FT                   /product="maltose O-acetyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43048"
FT                   /db_xref="GOA:Q5KJA5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA5"
FT                   /protein_id="AAW43048.1"
FT                   /translation="MILPHQSNSRISPPSEDENPEELSQMLAGRPYHSWDSYIGRIRDA
FT                   QAREVWEINQIIDMEPRMKAMRDFIYMGDQVWIAQGFFCEYGFNITIGEEVFIGANCTL
FT                   LDVCPIKIGSRTMLGPNVQILTPAHPVSPEERNGLKGKEWAKPVTIGNDCWLGAGVTVC
FT                   PGVTIGDGVTLGAASVVTKDVPSRSLVVGNPGRVIKEIKADGTLEPAC"
FT   gene            9430..12508
FT                   /locus_tag="CND00040"
FT   mRNA            join(9430..9672,9751..9864,9929..10011,10109..10537,
FT                   10596..10820,10881..11138,11196..11288,11348..11467,
FT                   11516..11597,11656..11669,11771..12128,12178..12227,
FT                   12286..12508)
FT                   /locus_tag="CND00040"
FT                   /product="transketolase, putative"
FT   CDS_pept        join(9661..9672,9751..9864,9929..10011,10109..10537,
FT                   10596..10820,10881..11138,11196..11288,11348..11467,
FT                   11516..11597,11656..11669,11771..12128,12178..12227,
FT                   12286..12388)
FT                   /codon_start=1
FT                   /locus_tag="CND00040"
FT                   /product="transketolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43050"
FT                   /db_xref="GOA:Q5KJA4"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA4"
FT                   /protein_id="AAW43050.2"
FT                   /translation="MSVNKVQDWDFEKFPIDLKKYKPFPLDPTKDKKLSQEQKDGLIAN
FT                   ISLLRDVIVFFTATGAARGLAGHTGGAFDTIPEVVILLSFLLADQDKSKYVDILFDEAG
FT                   HRVATQYLLSALDGHIPVEHLLHYREANSKLPGHPELGLTPGVKFSSGRLGHMWPLVNG
FT                   VALAEKNKAVFILGSDGSQQEGDDAEAARLAVAQGLNVKLFVDDNDVTIAGHPSEYLKG
FT                   YSVARTLEGHGLKVVEANGEDLDSLYSAIVEVMNHKGPAAVVTHRPMAPKIKGIEGSPH
FT                   AHDAIKVEPAIEYLDARHPKCAAILRAIQPSNYAELLSGSTKERGACRVQFGEAVSAVL
FT                   DKTSKEQNKAKVLVIDSDLEGSTGLSVIHKKHPEVFLSSGIMERGNFSAAAGWGAFNAD
FT                   RQGVFSTFSAFSEMIISELTMARLNFANVLTHFSHSGVDEMADNTCHFGINQFFLDNGL
FT                   EDGYETRLYFAADCSQMDAIVDRVFYDKGLRFVFSTRSKVPWILKEDGSRFFDSDYKFV
FT                   PGKDEVIRKGTKGYVVAYGEILYRALDAVDRLRKEGLDVGLINKSTLNVVDEDMIKEIG
FT                   STEFVFVAESLNRKTGLGSKFGTWLLERDLRPRYNYIGTSKEGCGGLGEQIGHQNLGSS
FT                   DIALKVKQMIK"
FT   gene            complement(14544..17533)
FT                   /pseudo
FT                   /locus_tag="CND00060"
FT   gene            14558..17569
FT                   /locus_tag="CND00050"
FT   mRNA            join(14558..17009,17071..17569)
FT                   /locus_tag="CND00050"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        14578..16320
FT                   /codon_start=1
FT                   /locus_tag="CND00050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43368"
FT                   /db_xref="GOA:Q5KJA3"
FT                   /db_xref="InterPro:IPR018289"
FT                   /db_xref="InterPro:IPR031052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA3"
FT                   /protein_id="AAW43368.1"
FT                   /translation="MASTDLHSSDPLSPQPGICPPSPIIRVPEAEIYSGHQSMAFDFDE
FT                   GNLHAMEGSDSSEVSNIADEEDSEDDIIQAPIDSFNDDEMISTPGFDEQAYYQSKDECK
FT                   GAVQAYAASQGFAAVIRRSKRKKPTKTHKEGRELIQYSCIFGDEYRCTRGDSFKDVRIR
FT                   TIQTVKNGCPFAAVAWEMAEAEVKEHGGDKCWTWKVVNASHNHPPVANIGIALLRRASR
FT                   TPEAKELINTLIDSRTPFPSIISTMSQRFPTVMLTSEDLHRLAFRRRADLRAGSSASAA
FT                   CIRQLVSNDELHRPFVNTRDELIGLVYTKRTARALIHRFPEVLFFDCTYKTNLYRMPML
FT                   HIVGSTSTGMTYTAGVILMLRETTNWYTQALNSFFELVGKPDVKVVITDRDPALINALM
FT                   SVLPKAYRFSCFWHLQENVKSNIRPCFVDEENIVMAVSNFCKAWVRYCVHAKSDEQLEE
FT                   GYRKMEELYPGQKYARAISYIRGLDEIKERFVHAYINKQLHFGQTGNSRLEGQHATLKK
FT                   SIDTKYGDLLLVIGSLSTYFDQQWLKILKRIELERTRCATHIPSTFVRVCSFLLSVLFV
FT                   IVLI"
FT   gene            18103..20919
FT                   /locus_tag="CND00070"
FT   mRNA            join(18103..18690,18746..18814,18873..19090,19143..19307,
FT                   19360..19445,19496..19980,20036..20072,20126..20458,
FT                   20524..20919)
FT                   /locus_tag="CND00070"
FT                   /product="myo-inositol transporter, putative"
FT   CDS_pept        join(18553..18690,18746..18814,18873..19090,19143..19307,
FT                   19360..19445,19496..19980,20036..20072,20126..20458,
FT                   20524..20768)
FT                   /codon_start=1
FT                   /locus_tag="CND00070"
FT                   /product="myo-inositol transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43052"
FT                   /db_xref="GOA:Q5KJA2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA2"
FT                   /protein_id="AAW43052.2"
FT                   /translation="MMSATHIENRDDNFLENKHFDHTERLENIKGWQEPPSPSGFGGHL
FT                   IDENLVRVEGEDKVTWYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSALNSSQ
FT                   QEIITAGTTIGAIFGSAILGGWGDRLGRKKAILISDVFFTIGAVIIASSYSVPQIIVGR
FT                   IVLGIGVGGAAVIAPLFITETAPTAVRGRCIGINAFFIPFGQVVSDAIGAGVQNMHNGW
FT                   RLLFALGAVPSLLQLLLFHYLPESPRILILKGDTEGARTVFQRIYPTATSEMIEYKFRV
FT                   AQEYVAATTALQSGTTFWERAKKVWRTGSYRRSIIAVSVLQAAGQLCGFNTLLYYAGTL
FT                   FSLLGLSNPALGGLIPAGTNAVFLLIGMTTVDKIGRRGLLLIGVPIMLLGHVWNIVAFY
FT                   YLCKPTGGFLDTSYTYDTTNVGIVIGGIVFFVAGFGLTYSHLVWYQAEYLALEVRSMGS
FT                   GIATTICWIANLVVSVSYLSELETMTPSGTYGFYFGISVVAFVFVVFCFPETKQLSIDE
FT                   TSLLFENDWGVKRSAQMRKERRETQKRFQDAEVAEAATAHLEARQQKSTSVSPAELSKF
FT                   MAGLKSGKRKPSVSV"
FT   gene            complement(20889..23304)
FT                   /pseudo
FT                   /locus_tag="CND00080"
FT   gene            23771..29354
FT                   /locus_tag="CND00090"
FT   mRNA            join(23771..24233,24299..24535,24583..24840,24889..25587,
FT                   25638..25720,25772..25946,25997..26479,26532..26848,
FT                   26905..27217,27276..27934,27989..28069,28117..28267,
FT                   28318..28549,28603..28908,28961..29042,29099..29354)
FT                   /locus_tag="CND00090"
FT                   /product="ATP-binding cassette (ABC) transporter, putative"
FT   CDS_pept        join(23846..24233,24299..24535,24583..24840,24889..25587,
FT                   25638..25720,25772..25946,25997..26479,26532..26848,
FT                   26905..27217,27276..27934,27989..28069,28117..28267,
FT                   28318..28549,28603..28908,28961..29042,29099..29224)
FT                   /codon_start=1
FT                   /locus_tag="CND00090"
FT                   /product="ATP-binding cassette (ABC) transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43038"
FT                   /db_xref="GOA:Q5KJA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029481"
FT                   /db_xref="InterPro:IPR034001"
FT                   /db_xref="InterPro:IPR034003"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA1"
FT                   /protein_id="AAW43038.2"
FT                   /translation="MAFSGVGQGIGTYDRTEQTSGASLGRVTSRAHFTDVHPNDNLPAQ
FT                   TGEHCARDVGHLARQLTRQSVAAADDSAAIFSYQEGSDLDPFSEKFNAKKWTKLMFEAS
FT                   QSSGPGRKAGLSFRNLDVHGFGSDADYQKTVGNLPLVGIGALRDLIGNRKRKVQILNSM
FT                   DGVLEAGEMLVVLGPPGSGCTTMLKTIAGEMNGIYLDESSSLNYRGITPKQIYGQFRGE
FT                   AIYTAEVDVHFPNLTVGQTLSFAAEARAPRKPPGGISKKEYAKHMRDVVMSVFGISHTL
FT                   NTIVGNDFIRGVSGGERKRVTIAEASLAGAPLQCWDNSTRGLDSANAIEFCKNLRLNSD
FT                   YIGISSAVAIYQAPQAAYDCFDKVSVLYEGEQIFFGKATEAKQFFVDMGFHCPSQQTVP
FT                   DFLTSLTSASERTPREGFEGKIPTTPQEFATRWKQSDKYQELLAQIAEFENKYPVHGEK
FT                   YQEFLQSRRAQQSKRLRPKSPYTLSYGGQVELCLRRGFDRLRADPSLTLTQLFGNFIMA
FT                   LIIGSVFYNLPATTSSFYSRGALLFFAILMSAFGSALEILILYAQRGIVEKHSRYAFYH
FT                   PSAEAVASALTDIPYKVVNCIIFSLTLYFMTNLRREPGPFFFFMLISFTLTMVMSMLFR
FT                   SIASLSRSLTQALAPAALLILALVMYTGFAVNVANMRGWARWMNWLDPIAYGFESLMIN
FT                   EFHGREYECAAFIPMGPGYEGATGQQLVCSTAGAVAGSSVVNGDDYINLSYEYYHAHKW
FT                   RNFGILIGFFLFFSAIYISATEFITAKKSKGEILVFPRGKIPRALLAQSTHSHGSSDDV
FT                   EGGKFAGGSKMKKEITGADRADAGIIQRQTAIFSWKDVVYDIKIKKEPRRILDHVDGWV
FT                   KPGTLTALMGVSGAGKTTLLDVLATRVTMGVVTGEMLVDGRQRDISFQRKTGYVQQQDL
FT                   HLETSTVREALRFSAVLRQSNTISIKEKYEYVEEVLKLLEMESYADAVVGVPGTGLNVE
FT                   QRKRLTIGVELVAKPALLLFLDEPTSGLDSQTSWNILLLLRKLTEHGQAILCTIHQPSA
FT                   MLFEQFDRLLFLARGGKTVYFGEVGKGSHILIDYFEQNGAPKCPEGENPAEWMLAAIGA
FT                   APGSHSDVDWHQAWINSPERVEVRRELARIKETQGGKGEAALQNKDQEKSKSEVKAEYA
FT                   EFASPLWKQFIVVLTRVWQQHWRTPSYIWSKAALCALSALFIGFSFFKAGTSQQGLQNQ
FT                   LFSVFMMFTIFGQLTQQIMPNFTTQRSLYEVRERPSKAYSWKIFILSNIVAEIPWAILM
FT                   GAVIYFTWYYPIGYYRNAIPTDAVHLRGALMFLYIEMFLIFNATFAIMIVAGIATAETA
FT                   GNIANLLFSMCLIFCGVLAPPSSLPGFWMFMYRVSPFTYLVEGMLSTAVADTNVVCSDI
FT                   ELLTMNPPSGQSCGDYMSTYISNYGGYLVNENATTACEFCSMSSTNTFLAQFSIYYSNK
FT                   WRDFGLLWAYVVFNIIAAVGIYWLARVPKNTGKEQASEPEDVQEKLVPAQSTEKKPESV
FT                   SRGSQSTAA"
FT   gene            31270..32259
FT                   /locus_tag="CND00095"
FT   mRNA            join(31270..31893,31975..32000,32080..32259)
FT                   /locus_tag="CND00095"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(31336..31893,31975..32000,32080..32110)
FT                   /codon_start=1
FT                   /locus_tag="CND00095"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIH3"
FT                   /protein_id="ALO60514.1"
FT                   /translation="MPSRNDIKPSISDPVSVTSTTGFGLGFTPSNTSTDNSITGSSIRG
FT                   QKISHPFNVASSTGFVLTSNNTANPPPVASQGLPFSRSAQSDVNSAISDTSREVVFHLY
FT                   NPTTPPPHQTDNKCGHTQASAWSSPSSSYGAGSPPDQSAWSPDSSVQGGNSIRLPPSQS
FT                   SNTIDSVVLGSAVPSLSGSVSGLSTETFQTAPERMERSQQL"
FT   gene            complement(32252..35885)
FT                   /locus_tag="CND00100"
FT   mRNA            complement(join(32252..33727,33815..34216,34280..34866,
FT                   34941..35125,35418..35729,35791..35885))
FT                   /locus_tag="CND00100"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(33216..33727,33815..34216,34280..34866,
FT                   34941..35125,35418..35588))
FT                   /codon_start=1
FT                   /locus_tag="CND00100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43053"
FT                   /db_xref="GOA:Q5KJA0"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJA0"
FT                   /protein_id="AAW43053.2"
FT                   /translation="MPPKRPTPSRSYAPNKLQRRATLPAAARAIKEVSELSEEDDDVDD
FT                   EMKAKLARKEARTIRNRESAQRSRNQRKAHLAWLESRVLELEAENQALRAGPPNAKPKA
FT                   KKESTENVTEISGPSTLRTSSSTSVSASESPSPSVHPNPISAAVSTWTKRSFHPNTSYS
FT                   CTRTHSREPSPAQSVFSLATDLGLPTELVNGGAGVRLASVTPPSKEMLSEMGVDDDDDD
FT                   REATHGDRIGVGNFFHTHLGHIQPSSNSFDEEEARLKEENAHLRERVGLLENLVKQVVI
FT                   LFDLNPNSTSLRIPVSMPNMSAPVPAPPSPMLLGQNSMSISIPTHTLPYSTSDGAGGMQ
FT                   EARRGSEIATNRAAVENFWAQESTHSGQQPDFGASRTQPSHPHQFYTSDGHTKHSAHPS
FT                   HLPSPRPLLSSQLGQHPNQMEQMEQRRQCAHSGYVRSTTGATVTSAALEDSNPRSYSNS
FT                   NAGLHLNSNMHADNSPSTLQQFHSGTGRNGESASFVPLPQGPMTSTSEIPSAMSTTSFL
FT                   STFISTSLSNPTATPTPLSTSLFSDSPSISICSNDEKQAKHTPVACHSAVVATSSLISS
FT                   ASLPFAPANPQAYERMRRWHEALQRARGVWCLVSGWKRQKVW"
FT   gene            37802..41759
FT                   /locus_tag="CND00110"
FT   mRNA            join(37802..38085,38145..38573,38623..38712,38766..38780,
FT                   38839..38908,38963..38977,39027..39059,39119..39189,
FT                   39247..39322,39388..39523,39595..39631,39712..39765,
FT                   39839..39915,39976..40040,40101..40108,40171..40318,
FT                   40379..40440,40502..40876,40939..41759)
FT                   /locus_tag="CND00110"
FT                   /product="ATP-dependent DNA helicase, putative"
FT   CDS_pept        join(37879..38085,38145..38573,38623..38712,38766..38780,
FT                   38839..38908,38963..38977,39027..39059,39119..39189,
FT                   39247..39322,39388..39523,39595..39631,39712..39765,
FT                   39839..39915,39976..40040,40101..40108,40171..40318,
FT                   40379..40440,40502..40876,40939..41652)
FT                   /codon_start=1
FT                   /locus_tag="CND00110"
FT                   /product="ATP-dependent DNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43036"
FT                   /db_xref="GOA:Q5KJ99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ99"
FT                   /protein_id="AAW43036.2"
FT                   /translation="MPSSSTTPIVVSDDSDADDFFPRKDVSANRSGESKERISEEFVKG
FT                   EKGGDLNLDARDAIKTTLAKLDTEIAEVVAQLEPLQALHASLTAERRALEFQLSSISRN
FT                   PCPSDSLFSTAANTIDYQSSCFPFSSAIAATLRNTFNLNKFRLCQEGVINAAVDDRDIV
FT                   CVMPTGGGKSLTYQLPAVMGRGLTVVVSPLLALIWDQVRALKEIGIECVMLTGSTSTQE
FT                   QNEIYKRLRDGPSHGEKEIRLCYVTPEKVSKSKRFMSVLEKMNQSGRLRRFVIDEAHCC
FT                   SQLGHDFRPDYKKLSMLKTLFPRVPIQAVTATLSSKTLPDLLKILRLGPITDGRSSKTT
FT                   GTVFFSSPLFRPNLHYKVLPKASNAKTAIAEMGRWIQDKHPGESGIVYCLSKKDAETVA
FT                   EELKGWSNGSIKTGVYHAGIDDTEKETIHVKWREGKINCICATIAFGLGIDKGDVRYVI
FT                   HHSMSKSLEGYYQETGRAGRDGKDSDCVLFYRGQDATRLAGLIYTDVDGTGKLHEMLRF
FT                   AQDLRTCRKVAFAKYFSASAHLSTASWDNPTSLSSSDSDSTSTSPCEICDNCLRPPSSI
FT                   STRDVTLESWKILRIAQEVVKQSGRVTLPNLASLTRGLGGGSFGVVGGGEGKKGKKQKS
FT                   TGERGYIDIEEFGGKVAMSADDVEVLIIHLLLIGYLQDSYHATAFSVNVYVIPSPAAVR
FT                   LTRMEREEIEAGRGVRVECTFAVPQRKEKKAPGNGSNKVAVKRKKGEEDDEFDQAGGSS
FT                   GRKLGGNMDFVGTGGRKPGNAKKARTQTHPQDENREEEEYEYFSDVYGGLYSDGDIDQE
FT                   ADQQHGGDGDDWNGDGDEMEEDDEPKDDWDEMIGDGWRDEGGWKVLNAGSGSGSGTGTG
FT                   RAKGQGANGGGKQRAAIVTDSD"
FT   gene            complement(41771..44668)
FT                   /locus_tag="CND00120"
FT   mRNA            complement(join(41771..42300,42407..42894,42992..43411,
FT                   43493..44047,44113..44668))
FT                   /locus_tag="CND00120"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(42018..42300,42407..42894,42992..43411,
FT                   43493..44047,44113..44469))
FT                   /codon_start=1
FT                   /locus_tag="CND00120"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43051"
FT                   /db_xref="GOA:Q5KJ98"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ98"
FT                   /protein_id="AAW43051.2"
FT                   /translation="MKPPTKLHIPISEKSSPFFSSPYPPHQPSSSQLSPIPDSSPSSAA
FT                   FTNSRSPLLPMSPKVLESGYPFPATAHTNASGRWARMRMVLRQGVVPQGVLRRALMLFM
FT                   VLGLAVLVLHRSGTALQLAEKYNPASTQTKSRPASTQTEAHPASTHTESHVPYIPPTSS
FT                   PHGVREIDISSEPLPLDATLRERLDAWKNAPGGRGEVEGEVEAGGFVAWNLEQCSTISE
FT                   QHNTHMIQHSANTWASLNRTLLHKYRMELVDHMEGVLKRREHEKYGKGRGIVTVAGNAD
FT                   TLQRVKWSLQMLRSYGSELPVEIYHFPSEAPPADDPIRTELAELGARLVEAKGQTRDKG
FT                   KNKSYHLKALAVVQCPWQEVLYIDSDSVPTRDPLYMFDAPNYKRLGIWATPDYWKTSAN
FT                   NPIWAIMGVKCRNEWEMETGQMFIDKKRHLDVFLLVQYMLENHHFWFAFSDGDKDTFRW
FT                   ALLALRKRWAVPGRWVGAGALPSGTASGDFCAHTMLQHDSWGEPLFVHYNLLKQIPSGV
FT                   GRGYSWGRTKQLPLFNTWPATPATARLGEPERKPEDGDKRGLGDVDCDMLADAGEDGRA
FT                   RGEAKEMVMRRAARERGVKVKYHGGVTSALCIDLEYIDPRPTERQEEDAARRAALSASA
FT                   ALTPQSTSADGDGADDTPAPEWVGVVEPDWSQSPIEIVHWRDDEHLKSFEKTIYDFGFK
FT                   PSGKGF"
FT   gene            45732..48564
FT                   /locus_tag="CND00130"
FT   mRNA            join(45732..45828,45875..45979,46032..47119,47170..47496,
FT                   47546..47651,47699..48102,48158..48564)
FT                   /locus_tag="CND00130"
FT                   /product="tRNA (cytosine-5-)-methyltransferase, putative"
FT   CDS_pept        join(45796..45828,45875..45979,46032..47119,47170..47496,
FT                   47546..47651,47699..48102,48158..48386)
FT                   /codon_start=1
FT                   /locus_tag="CND00130"
FT                   /product="tRNA (cytosine-5-)-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43054"
FT                   /db_xref="GOA:Q5KJ97"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ97"
FT                   /protein_id="AAW43054.2"
FT                   /translation="MGRPRGKKHGGRGGGRAPQTRDNGAGEWKVFSPADYKNEAFEAYY
FT                   KEQNIMTPEEWPEFMSSLKQELPLTFRVTGSRAHAETINDIIKDTYVPNMQNVEFEGKK
FT                   YNPPTQLAWYPGQLAWQVNAPKRVVRKTEPFKNFQRFLVGETEVGNLSRQEAVSMIPPL
FT                   FLDVQPHHHCLDMCAAPGSKTAQIIEALNPHHTTSTGLLIANDSDYKRTHMLVHQTGRM
FT                   PSKGLMVTNFDASMFPAIKLEEGKNLQFDRILADVPCSGDGTLRKNMEIWAKWGVADGN
FT                   SLHSLQLRILERAMNMLKPGGRLVYSTCSLNPSEDESVIAAALLKHTQFSLVDVSSDLP
FT                   ELKRRPGMDKWKVATQEGKDGEIHWYETFDEYRKAVDEGKEKEKGEKGKGLPSSLWAPE
FT                   NVESLNLNRCMRLLPHDQDTGGFFVAVLERAGASQTSSLKRQASPVEGEAEIKRAREKS
FT                   PAPAASAEAEAAPAAAAAAAESAVKAEKPVTTKKEKRDNSFKEDPYSYVDPSHAEVKAI
FT                   IEKFQFKDTFPRDNLLVRNEYGDPLRTMYLTNDIVKQIILNNDYTRMRLISAGIKSFTR
FT                   QDSATSKNSELICKWRPPIDGILELLPHLGDGVLIEGTLSELRTLLEDHYPALEKFKRS
FT                   EWKEEMEKREMGAAVVKFNAGNCDGGELKLPMYLPIWKAKMSLSLMIDKREKSILSLRT
FT                   FGEDICKPPPIQSDQKVASASTDPTPASTDPTPAEKEAQKMEDLVAGDAEGEGKPGVAL
FT                   ATEGGEEVVA"
FT   gene            48566..49850
FT                   /locus_tag="CND00140"
FT   mRNA            join(48566..49202,49271..49339,49393..49850)
FT                   /locus_tag="CND00140"
FT                   /product="GTPase, putative"
FT   CDS_pept        join(48914..49202,49271..49339,49393..49736)
FT                   /codon_start=1
FT                   /locus_tag="CND00140"
FT                   /product="GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43056"
FT                   /db_xref="GOA:Q5KJ96"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ96"
FT                   /protein_id="AAW43056.1"
FT                   /translation="MGSLQWDYILKYVLIGDSSVGKSSLLVRLTDDRFDLTEPTLGVEF
FT                   GSRILTVGEQGKRVKVQCWDTAGTESFRSITRSYFRGAAGALLVYDVTRRDSFEHVTSW
FT                   LDDLRRHADENVSIILVANKTDLCSPTPPSLPTASYGQAIPPPSPTPPSSSPQFSFKPR
FT                   AVTSQEGMLFAKSNNLLYVETSAKEGWNVENAFEWTAREILKRVTEEELERKKGGNGVK
FT                   LGEGKKAGGCC"
FT   gene            50395..52811
FT                   /locus_tag="CND00150"
FT   mRNA            join(50395..50539,50599..50782,50859..51093,51154..51355,
FT                   51417..51750,51814..52129,52207..52506,52586..52811)
FT                   /locus_tag="CND00150"
FT                   /product="ferric-chelate reductase, putative"
FT   CDS_pept        join(50466..50539,50599..50782,50859..51093,51154..51355,
FT                   51417..51750,51814..52129,52207..52506,52586..52710)
FT                   /codon_start=1
FT                   /locus_tag="CND00150"
FT                   /product="ferric-chelate reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43058"
FT                   /db_xref="GOA:Q5KJ95"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ95"
FT                   /protein_id="AAW43058.1"
FT                   /translation="MTICLIEDCPTSAQRMAASANADSWYKAMHWARTTAIGCLVLIAL
FT                   LAILNWSRWHFRYRPRKLTAALRGLGYPHLAFIDLSLGITLGLFTLFMSLFIWCFQMKP
FT                   YYRPGVEWGNPPLGIRAGWIAQALLPFVFVMGSRINPLAWITRVEASRWMIWHQYGARV
FT                   LLFFSVIHTFIILYAPYRQGGISWTRAYWTTYNKPSNFFNSHGRMVNGTFALAALSWIV
FT                   FSSFAKIRNWNYEFFIVQHILSIVAFLISLWPHVKVSIPDALYYIYASVAVWGFSILVR
FT                   FFWETVEFAGLGKWKGKAILQGFGGDEMSGKGGVTRLVVETKRGSWETGQYVYLRVPSV
FT                   NPFQSHPFTIASSPPTNSDIDTPSPLTILISSRSGITKRIARSALSNPSKSIPVIVQGP
FT                   FGGFGEKLERFDKVLVICGGVGAAMGWPVASKLVREGRKVKMIWSVRNIDCLEWFNDDR
FT                   SFDRTDVTIHLTGPNPDQTSTFSAPMKPSSSKIESSQPVEAETTASTPGVEEKLFDIAS
FT                   GTVVNSGRCDITKVLREYTEGMDQGERLAVIVCGPTSMLADTANAVAKLQWDIVRGKSV
FT                   LGEVWMHKERFGW"
FT   gene            complement(52935..54919)
FT                   /locus_tag="CND00160"
FT   mRNA            complement(join(52935..53246,53490..53549,53616..53672,
FT                   53799..53917,53986..54052,54120..54191,54252..54316,
FT                   54379..54491,54542..54558,54627..54919))
FT                   /locus_tag="CND00160"
FT                   /product="adenylate kinase, putative"
FT   CDS_pept        complement(join(53076..53246,53490..53549,53616..53672,
FT                   53799..53917,53986..54052,54120..54191,54252..54316,
FT                   54379..54491,54542..54558,54627..54890))
FT                   /codon_start=1
FT                   /locus_tag="CND00160"
FT                   /product="adenylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43034"
FT                   /db_xref="GOA:Q5KJ94"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028586"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ94"
FT                   /protein_id="AAW43034.2"
FT                   /translation="MSMLVRPRAIPRIAPILAPQRPSKRFNSSSTASTSSPVSHVASAV
FT                   ADTAHSLADKFREAARFINSPSYDGVEEKGLRMLVFGKPGSGKGTLSSRLVKEYDISFV
FT                   STGDVLRKEIAAKSEVGRKAEAVVASGGLVSDELMLEIVKAELDRLKGKSWIIDGFPRT
FT                   LHQGELIDTVLNQENRPLNMVVHLNVPDSVIMARIAARWVHLPSGRVYNTTYSAPKVPG
FT                   KDDVTGEPLTKRPDDTPETFSKRLQAYYESTAPLLKYFEETYPESLHSISGSSSDELWP
FT                   QLVELIEPFNLRRRQTPAEKGRVDAEKVRKQADDLRDSREVDVPGEGKKVVAR"
FT   gene            55035..56097
FT                   /locus_tag="CND00170"
FT   mRNA            join(55035..55384,55436..55686,55751..56097)
FT                   /locus_tag="CND00170"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(55519..55686,55751..56026)
FT                   /codon_start=1
FT                   /locus_tag="CND00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43369"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ93"
FT                   /protein_id="AAW43369.2"
FT                   /translation="MTTQHDIPPTVELRALVSKGKLRVWNRVRVLNGGDSIRVSRMDTA
FT                   EEDRRCASFVSYMVSIDRNRRHPTRHVEFEDHLCYGELLNLITIDLPHHPKSYNTPPVT
FT                   LAFAHIKPALSHKHRIGSHEWSYYKECQAEEGSGLCQSAGWKG"
FT   gene            complement(56601..60967)
FT                   /locus_tag="CND00180"
FT   mRNA            complement(join(56601..56870,56936..57216,57277..57636,
FT                   57687..58233,58283..58374,58424..58858,58911..59066,
FT                   59115..59800,59841..60078,60395..60525,60583..60692,
FT                   60750..60778,60944..60967))
FT                   /locus_tag="CND00180"
FT                   /product="glutamate dehydrogenase, putative"
FT   CDS_pept        complement(join(56760..56870,56936..57216,57277..57636,
FT                   57687..58233,58283..58374,58424..58858,58911..59066,
FT                   59115..59800,59841..60078,60395..60525,60583..60692,
FT                   60750..60773))
FT                   /codon_start=1
FT                   /locus_tag="CND00180"
FT                   /product="glutamate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43072"
FT                   /db_xref="GOA:Q5KJ92"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR016210"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ92"
FT                   /protein_id="AAW43072.1"
FT                   /translation="MSTPTQGTLQTPLPAQLSKVLAESGAHISRPGSDLSTNRIRKDTI
FT                   GYKSSPFPLKADQQAAVTRILSESGFMPQELVPGEVDWFYNHLGIENSYFLWEKPEAIA
FT                   DNVLSLYSAKLLAYTKHDPEQLVIDLEKIIPEGVDKSREGAVWIHSSKAGVSSSEGPGA
FT                   KVEKKIDSLYLDDSSPEKAYRLETYRSSGAISSTVSQQLRCYFISRCSFPTSGPVKTAE
FT                   GTTDIRSVSDASFLEKASENTLEVYQRIMNEVERRYGPVIEMFEVEDSRERRLVIGYKI
FT                   GGTRKFFSALSDLYHFYGLYSARKYVEQFSNGITIISMYLNPVPNTRAPPIEHSIHQVV
FT                   REASLLYVLPDNPFFSVTENEDTNHAVQEATYAYVGWIFAQHFCNRLGQAYIALKDALD
FT                   ESNPDHAEVLNKIKTRFREETFTRESIREVIQSHPGLVRMLYINFAMTHYPVADEASQL
FT                   TPTLSFQRLKTEQPLSDEDLHALIRKTAANQHAVQILEALLIFNRQVIKCNFYQPTKVA
FT                   LSFRLNPSFLPEVEYPKAPFGMFFIVGAEFRGFHVRFRDVARGGIRIIRSRGKENYNTN
FT                   VRTLFDENYALAATQNLKNKDIPEGGAKGTILPILGANIQHCFEKYVDSIIDLLIPGKT
FT                   PGIKGKIVDVSNRPDPEILFFGPDENTADLMDWAAEHARSRNAPWWKSFTTGKSAEKLG
FT                   GIPHDTYGMTSTSVRQYIVGVLKAHGLNEKDVTKFQTGGPDGDLGSNEILLSKDKTVAI
FT                   IDGSGVLYDPAGLDRSELVRLAKARSPISGFDPAKLGEGGYKVLVDDKDYRLPTGEVIP
FT                   DGTSFRNTFHFRVKADLFVPCGGRPEAVNISNVNQLVDSEGKPHFKYVVEGANLFFTQQ
FT                   ARLWLEKKGVVLFKDSSTNKGGVTSSSLEVLAGLGLSDEEYIDLMIFKDGKPSTFYQNY
FT                   VKDIQQKICENAAQEYTCITKEWLRNKGTKPRTTISDQLSSTLNQLQAELEQSDLYENI
FT                   GSRKTVLNKAFPKTLVDKIGLETLMQRLPEQYQRATWSAWVSSHYIYECGMTASNVDFF
FT                   HFFSKLSA"
FT   gene            64207..66206
FT                   /locus_tag="CND00190"
FT   mRNA            join(64207..64467,64515..64677,64731..65859,65914..65992,
FT                   66042..66206)
FT                   /locus_tag="CND00190"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(64264..64467,64515..64677,64731..65859,65914..65992,
FT                   66042..66191)
FT                   /codon_start=1
FT                   /locus_tag="CND00190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43032"
FT                   /db_xref="GOA:Q5KJ91"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040132"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ91"
FT                   /protein_id="AAW43032.1"
FT                   /translation="MADGSEAYNIDAFPNADFSARELPRPSFSRTQDVRGLVKHVRTVA
FT                   WSCDGKKAATGGEYKEIQVWDESLDSKTTTPLPSASKPSPHNHHVSSIAWSPVDPNILV
FT                   SADKTFSVGSVIAVWDVTSPSAPIATFKTPGDVINLAWHPSGQHFAAVYPVKSRDLVDF
FT                   FRLSFSESGEPKWEKREDITLGGLSHGIGSEEINSLRFINSGQLVCAVSNDGSVSAWVY
FT                   PVESVRVDLVEEQVEPEPEQEREQEREQEQEQEHEQEQEQEQEQEQEQEQEQEQEEKEA
FT                   EVVTEEKEDEVVTEEKEDELATEEKEDEVIAEEKEDEVATEENEEKEDREDKEEDQNEE
FT                   NKQDVEDGPATPELPAIETPTERPLGDVKPAENNGDVEMTETENADAKANEESKGEEAP
FT                   ETNKPEFQDVEMVDAAQSNTQPSSVQPSRQSSPPPPTKTSPKPRAQPLKRYRHDVCYAA
FT                   SLLSLAYDPRGRYFVVGGQDALLSLFDTKEWICEKSFDVCTAAIRHTAFSYDGEFVAIG
FT                   GDDLFIAIVSVYTGQTVAKIPIPAAVNALSWNPNKNSLAYCHQGKGGVPLWHIVHQE"
FT   gene            complement(66231..69248)
FT                   /locus_tag="CND00200"
FT   mRNA            complement(join(66231..66942,67005..67229,67293..67665,
FT                   67730..67822,67871..68682,68731..68746,68799..69248))
FT                   /locus_tag="CND00200"
FT                   /product="transcription factor, putative"
FT   CDS_pept        complement(join(66303..66942,67005..67229,67293..67665,
FT                   67730..67822,67871..68682,68731..68746,68799..68961))
FT                   /codon_start=1
FT                   /locus_tag="CND00200"
FT                   /product="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43070"
FT                   /db_xref="GOA:Q5KJ90"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ90"
FT                   /protein_id="AAW43070.1"
FT                   /translation="MTAMQHGNGHENTNPPGFSVLEESQGHESEEGGGNEPTRRVRRRT
FT                   GPFKRSRTGCGTCKRRGKKCDEEWTPQGHCQRCIIGQFECSGRTNIQSKSAARRAQQQQ
FT                   RTKNMSENNLQRESSESQWSSTDAQPSGSVSATHNHSHVDQSSMQAATGQQFLSNSTPA
FT                   SSNHNHQTPPNPLGTTSSSTQQQANVPFAWYNPTHAPPTAPHHDPTTFLTIDHSQSLLD
FT                   WASMFGNQPSTFLASSTECGALGLESIMPWSGGSNGDATTTASGGGSGSTGGSGVQVGD
FT                   GLWNDGVFGVPNQPGSNGPNQGGVGQVVNGISPNTADKHMRDGVSLSDLYVRVLESWLV
FT                   GIPSSTRENAQSRLRTYNENSGVMQFSRHALARAYMTLFSSSMSQVYPLSQFADLFPKS
FT                   PRNMNNLQDFPIPDLISEFNVHLPRDPKGKGKEKTYEAGQLERRMREYEQKVVTRLNAD
FT                   EEGLKWIEDETTLLREVIVTNPSHLAELLWGVMNLRHVEYIRSGASQSYNVLALGDRLI
FT                   RSALGSNHPPITLSQLRTAETWSVRMFATADIGRCIVERGRKTIFNFWSDIPTDPNPPS
FT                   PSQEEPWSFHLGLPDSILILLAEIINLSSSVSSLSSLSVKTQADELEKAIRGWQSHQVD
FT                   MSEGMESGVRMERIVVGELWRLSALVLLYESVHKVGGLHPVLRNARYELLNLLDSLTPL
FT                   TQDRPPNHTALPAFLAATLSTSCQDRHRSMMHLLRVGPEKVWMDNVAVVEKVWEESDTS
FT                   GVLPDWWDKMKREGMSVAFF"
FT   gene            70002..73808
FT                   /locus_tag="CND00210"
FT   mRNA            join(70002..70250,70303..70466,70519..70588,70635..71092,
FT                   71152..71285,71331..71508,71567..71893,71944..72395,
FT                   72450..72527,72586..72821,72877..73087,73143..73205,
FT                   73258..73808)
FT                   /locus_tag="CND00210"
FT                   /product="exocyst complex component protein, putative"
FT   CDS_pept        join(70055..70250,70303..70466,70519..70588,70635..71092,
FT                   71152..71285,71331..71508,71567..71893,71944..72395,
FT                   72450..72527,72586..72821,72877..73087,73143..73205,
FT                   73258..73744)
FT                   /codon_start=1
FT                   /locus_tag="CND00210"
FT                   /product="exocyst complex component protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43060"
FT                   /db_xref="GOA:Q5KJ89"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="InterPro:IPR033960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ89"
FT                   /protein_id="AAW43060.2"
FT                   /translation="MSAQDAPPRRPAKRNASTAVRSSKPRDPAIERALQLSTFESNYST
FT                   EEFIGTLSEKLIAESKANPGPFNPTPFLQTFSPALDTLLELRKQVTERTKKMETDVRRA
FT                   EREYGKRLRELDGGFEAIGKSFSNLESKVTDVGRTAVRIGEQLENLHQTRSTAQNTSLL
FT                   LSYYLSLTHQTATTGENTSPLEQLFATRTSRQGREKLAVVLRRLMAISKDVADNAATLL
FT                   SDAEAGAVPKEVTNGDGESQEPIVNQKVISKRRMEKEKAEKVRDEIEGYCERFEKELLK
FT                   LFDRSYRKGDPRMMAHCAKTLQEFNGGASCIQIYVNQHDFFIKDHSQIEKDEQDGVRVD
FT                   IWATIGNPDEPPPTTEPGLEALCKSIRSTISQESQIMKAVFYPNSSAVMEGFLQRIFAQ
FT                   VIQQHLEGLVQRASSISTLAILRILHLTHSICSSLVEDLKTYDSTLTTPPASSSRAPAP
FT                   AGSGGSFSAFLDRALEEMYVPWLEGTRYLECESKNLVELYAGLLSRFTRYHETVLQAKP
FT                   NSLLNKVVHQLASSSSAATTSSTAQTAAAAISKYANLFTSSTNNPKTGTATPVLPPSFQ
FT                   KPGLAGQMRGANGADTATWGTGTSTPVIRSVTGQELKGDLVNKGLEDKVWSTDGILAPT
FT                   MAERMLKWHAEAVGRAVELSNSGDVGKNALALLKVLSEAIGRSFIETALDSTLARLEQQ
FT                   DNKTEPDLQPLAVLKPADQICHLWQRYTTTALFPLAGSNVPIRREMTTLNTHNVVRMEG
FT                   KANNVIQKAIDNVIGWLSYLLTKQKKNDYKPKNDELSFARTITEPCELCCEFLATVRDA
FT                   VNEGLSGKNAEAFLTEIGVSFHTLLLDHYKKFPVNPTGGLMLTKDLASYQDVMASYSVP
FT                   AINDRFDMLRQLGNSFIVQPNVLKSYLTESHLGRIDARLLRPYLAQRSDYSQFSRSLQL
FT                   DDGLSAGAASDDTFTTSHAPGHGHGLFKGTRLSTMSGVAGAGMGKLKDMLKELDTLSPE
FT                   EVSDERKARANAARASAAYQPMPMFYMH"
FT   gene            complement(74195..75265)
FT                   /locus_tag="CND00220"
FT   mRNA            complement(74195..75265)
FT                   /locus_tag="CND00220"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(74276..74788)
FT                   /codon_start=1
FT                   /locus_tag="CND00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ88"
FT                   /protein_id="AAW43371.2"
FT                   /translation="MLPSTQGKSEMSAQTWDSSDPRSYNERRAAQALDILEQEDIEYDC
FT                   NTRQPSTARSYVISSSVFNPATRKVERAFFTSLAPTDPAVTDDERTRRISIANQLSCKI
FT                   TEGLKQSSEQWLPSCVRDGSTFELQRKERELYNKFLSEDTGNKEAGLTFYPYEDMAESM
FT                   PWDPLVC"
FT   gene            complement(75422..75509)
FT                   /locus_tag="CND00230"
FT   tRNA            complement(75422..75509)
FT                   /locus_tag="CND00230"
FT                   /product="tRNA-Phe"
FT   gene            75862..77990
FT                   /locus_tag="CND00240"
FT   mRNA            join(75862..75902,76071..76225,76278..76561,76611..77058,
FT                   77107..77282,77332..77552,77609..77990)
FT                   /locus_tag="CND00240"
FT                   /product="adenosylhomocysteinase, putative"
FT   CDS_pept        join(75900..75902,76071..76225,76278..76561,76611..77058,
FT                   77107..77282,77332..77552,77609..77617)
FT                   /codon_start=1
FT                   /locus_tag="CND00240"
FT                   /product="adenosylhomocysteinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43030"
FT                   /db_xref="GOA:Q5KJ87"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ87"
FT                   /protein_id="AAW43030.1"
FT                   /translation="MSNYKVADISLAAFGRKEIELAEHEMPGLMYLREKYAQSQPLKGA
FT                   RIAGCLHMTIQTAVLIETLTALGAQVTWSSCNIFSTQDHAAAAIAATGVPVFAWKGETE
FT                   EEYLWCIDQTLKAFPGGQALNMILDDGGDLTSLVHEKYPELLGDVKGVSEETTTGVHHL
FT                   YKMFKDGKLKVPAINVNDSVTKSKFDNYYGCRESLVDGIKRATDVMLAGKVAVVAGFGD
FT                   VGKGCAESLRSYGARVIVTEIDPINALQAAMAGYEVTTMEEAAPRGNVFVTTTGCRDII
FT                   TGAHFEAMPEDAIVSNIGHFDVEIDVAWLKANAAECVNIKPQVDRFTMKSGRHVILLAE
FT                   GRLVNLGCGTGHPSFVMSCSFANQVLAQIALWTNPEAYPLGVHMLPKSLDEEVARAHLA
FT                   QLGIKLTTMTKVQADYLGLPVQGPYKPDHYRY"
FT   gene            78134..80501
FT                   /locus_tag="CND00250"
FT   mRNA            join(78134..78372,78429..78530,78593..80501)
FT                   /locus_tag="CND00250"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(78187..78372,78429..78530,78593..80269)
FT                   /codon_start=1
FT                   /locus_tag="CND00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ86"
FT                   /protein_id="AAW43028.2"
FT                   /translation="MPIPIFLQSLLCRTDAAPRIDPLPAGYSSTPLARSVLGPTFVPLQ
FT                   LPPDGHMDPDTFKDITEAKLKTDLVLSHMRLVLAAQTQGGRRTTDTNDWNLIYNCIRDY
FT                   SEQILTRWLNTYANHTAALRQLQQAGLYPPQHVASGPHRVGDQTMYAPVKSRSSQYVPP
FT                   PLIRQSPLSVVSRDITPENAIAAPGTSRMQPISAQSKGGIPPPLPEKTKPFPSSRPTSS
FT                   QFPLADKPLAPLKYGDPRPRPASWQAMPETTGALFKALKRLSESEGLIPQEYAQLLERA
FT                   SRQEVSPTENQPATGDSIPSSPLQSYTPAGSVSAVKITDEHKKTIRRIRPPSRDTASRH
FT                   GADDGNNTYNHLNKTSPTTSNTPISYSGNSTPRLTPTAETFSQGKVNDQPIFKCLPTPP
FT                   PKMDIISLAPTNSVLETPGLTPLSQKEPFPIREPHPTPTELTQRDSKTSRTPPPKSPAR
FT                   VAANLVREKAALNTAPEAISLQPPDHDLPLYANVNPGHTLLAENESVNVRAPYTATSEE
FT                   TKPEIHIEVPTPNSVTSGLTPLSETEPISIREPHPTPIDAERRDLQNALTPPPPKALSA
FT                   ASTPCGGYKTPDGSPVKAAISGFKKLVEKAKSSREPVSERTEENAKARRVVQEVVGSPQ
FT                   LADVVDCDGKSSDQSRGEL"
FT   gene            complement(79716..81833)
FT                   /locus_tag="CND00260"
FT   mRNA            complement(join(79716..80302,80364..80860,80926..80985,
FT                   81039..81094,81149..81243,81303..81388,81445..81595,
FT                   81686..81833))
FT                   /locus_tag="CND00260"
FT                   /product="calcium-dependent protein serine/threonine
FT                   phosphatase, putative"
FT   CDS_pept        complement(join(80833..80860,80926..80985,81039..81094,
FT                   81149..81243,81303..81388,81445..81595,81686..81737))
FT                   /codon_start=1
FT                   /locus_tag="CND00260"
FT                   /product="calcium-dependent protein serine/threonine
FT                   phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43026"
FT                   /db_xref="GOA:P0CM54"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM54"
FT                   /protein_id="AAW43026.1"
FT                   /translation="MGAAESSMFNSLEKNSNFSGPELMRLKKRFMKLDKDGSGSIDKDE
FT                   FLQIPQIANNPLAHRMIAIFDEDGSGTVDFQEFVGGLSAFSSKGGRDEKLRFAFKVYDM
FT                   DRDGYISNGELYLVLKQMVGNNLKDQQLQQIVDKTIMEADKDGDGKLSFEEFTQMVAST
FT                   DIVKQMTLEDLF"
FT   gene            82130..82234
FT                   /locus_tag="CND00270"
FT   tRNA            82130..82234
FT                   /locus_tag="CND00270"
FT                   /product="tRNA-Val"
FT   gene            complement(82503..85244)
FT                   /locus_tag="CND00280"
FT   mRNA            complement(join(82503..83202,83251..84441,84491..84942,
FT                   84996..85244))
FT                   /locus_tag="CND00280"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(82633..83202,83251..84441,84491..84508))
FT                   /codon_start=1
FT                   /locus_tag="CND00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43370"
FT                   /db_xref="GOA:Q5KJ84"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ84"
FT                   /protein_id="AAW43370.2"
FT                   /translation="MFPWVKKIKQAFDHHDSQANRKIPPLAPYGAYVDPFYASPATTVR
FT                   LSRSSEDNPAFPAEFQLSTPPRRPYSHGKSYSSPPGSQTSPTAPLLPYSRLPDLTSTKS
FT                   AGPYQTYTATRNHPSGYELVDEPISTTFNISALSPTETVTSIPETPLLTPTTDAPFFAP
FT                   LNIDWVRSIVEQAKETSAGIPPGSSKDASLHLKNRSFTVPEITITDDNKPGTQQSIYTL
FT                   YDFGWLLDYIGIDRPLSHFPPSVSTKASLDPSQVKAVELFIKSARNTLARSGSKMGIDN
FT                   PPLTTADGVHIIDKLKKLEQFFRHDSSICTDGETTLRDDTKYNKLPPHDGPIDVPVSMF
FT                   GNTICMSATLSSQTREKYKQPAYADSTMSPPQYKAERDITEKGDTRCIENEDEFVEIVL
FT                   DSDKIQSAEWSIIDETTIVNDSNDTVALSESYERLVKRPRPPVPVQSIRVSQWPRVFDS
FT                   QYLARPTEWKPYQMEVAPLPRSSESDIAREHPRPARRQSPLLITCFILGFFMPFIWIIG
FT                   GWFINPSKPRPKPAFIDFETGVSFVLPSTNVEETKLPWYTHSHPMIRACRYAVIIGAPS
FT                   ITLMVVTFIIMFTVVH"
FT   gene            85410..88952
FT                   /locus_tag="CND00290"
FT   mRNA            join(85410..85605,85660..85790,85841..85914,85976..88952)
FT                   /locus_tag="CND00290"
FT                   /product="expressed protein"
FT   CDS_pept        85983..88742
FT                   /codon_start=1
FT                   /locus_tag="CND00290"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43190"
FT                   /db_xref="GOA:Q5KJ83"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ83"
FT                   /protein_id="AAW43190.1"
FT                   /translation="MSAMSFDPLPSSTSSNSLRRFSLPTTLFTPIPATLFEPSRQPRSS
FT                   GMPQSVQLFQEKHATEFAHLYEYDDEAERERRLQQEQQVLEEARRVGRLMRESLKAKTK
FT                   EQLEVRVDTPFQQSNKKGRRPLSLLSDRQLEFRSPELVRVSECVTPRPVERTRLIPPLK
FT                   DDMEHLTPDLSTPILSDTYSPDPTIVTPDQRGLGLEFQQSSTRESIHEEPSSSLANTSF
FT                   RHSTYSWASSFSGETEELRVAAHYVPPQTPQEEEQDKDHGEEVIDTPEKTKRRRKRIIA
FT                   IAHTVRQLEGIGSREVEDPTLYQKLAKAWNERPGFMPQEPVWAPDEQSAEERAPKVSTN
FT                   SGAWLAPSLANDLTQIQSHSSSNPSTLNDSQISSPFRYSFASSAHDLVDDGGIERGAQI
FT                   LSEKAWLKTPLYGHDAFFGAHSPSNPYPNSSFQPKPRARNSGNSFEGAGSIRSHDEKSE
FT                   EEVKIERAEPKRTLKRIQTDISKLRAEGTFVPLKPEAEAGPSVPPIFGLGFIGNYMVSV
FT                   DNGRRPLEIKPEESGFQQGEDGVEIREAKKGCKQQGSIHSLSGIIPQSTRPVEDDSMET
FT                   IDLTLAASRPASFYTTSDGRRQQRQQLTPGKTDYPFSNHSQQPDCWTPSTISLPQHIEY
FT                   TLGPPIDLGAPVSIPDRLTMGIWQKEEAEGPETEEGEWLEDLDSYRSSAICSSPSISHP
FT                   SPRQSRLQVRPKSIPPTTPVKEQKHPIFPDMLNTPARRKERRNGEESEDEHRSSAKRRR
FT                   QSYDRFYYRGMSAEGGEDIAAVGEDTGSVAAGITDRSEAMRAEVEKGHTQSEAVAPVTQ
FT                   PHPTTNSDLEKGTLSPSSLPRSRTPLVFFILGFFLPLLWLVGGWLLPHSSTQTPETETI
FT                   PQTITHYLPQWLYHSNYTVLACRIASLASLSFLLIAGITLAIVLPLTL"
FT   gene            complement(89050..91493)
FT                   /locus_tag="CND00300"
FT   mRNA            complement(join(89050..89330,89387..89500,89554..89626,
FT                   89677..90314,90362..91050,91098..91216,91269..91493))
FT                   /locus_tag="CND00300"
FT                   /product="ATP-binding cassette (ABC) transporter, putative"
FT   CDS_pept        complement(join(89269..89330,89387..89500,89554..89626,
FT                   89677..90314,90362..91050,91098..91216,91269..91451))
FT                   /codon_start=1
FT                   /locus_tag="CND00300"
FT                   /product="ATP-binding cassette (ABC) transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43068"
FT                   /db_xref="GOA:Q5KJ82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ82"
FT                   /protein_id="AAW43068.1"
FT                   /translation="MAPSASKQKRLAEKAAKAASKTGSSKSSVTGASTPLTSVSDDPTD
FT                   AAEQMKKLNLATDRSASGVLVSDPKGRDIKIDQYMLSFHGRLLIEGAEIALNYGQRYGL
FT                   LGENGSGKSTFLQSIADRDIEIPDHIDIYLVSGAVDPSDVNALDYIVSSAREKVERLEK
FT                   LAEDMSTADDVDELALDAIYEELEEMDPSTFEAKAGAILNGLGFSQQMMAKPTKDMSGG
FT                   WRMRVALARALFIKPHVLLLDEPTSHLDLGAVVWLEAYLSTYNHILILTSHSADFMDTV
FT                   CTNIMDLTTKKKLVYYGGNYTTYVRTKSENEVNQMKAYAKQQEEIAHIKKFIASAGTYA
FT                   NLVKQAKSKQKIIDKMEAAGLIEKVEQPRQLRFNFEDVKKLPPPIIAFSDVAFSYSGKK
FT                   EDYLYQDLSFGIDMDSRIAIVGDNGTGKSTLLNLITGALQPVEGTINKHTQLKLAKYSQ
FT                   HSADQLPYDKSPVEHIASLYSEKFPDKDIQFWRQQIGRFGITGAHQTSPINQLSDGLRN
FT                   RVVFAILAMEHPHIILLDEPTNHLDMASIDALAAAIKEFEGGVVIVSHDFRLISQVAED
FT                   LWEVKDKKVINLTKQDISIVDYKKALAKRSQAQIEKARLISKSATKGVA"
FT   gene            95077..96033
FT                   /locus_tag="CND00310"
FT   mRNA            join(95077..95734,95797..96033)
FT                   /locus_tag="CND00310"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(95120..95734,95797..96003)
FT                   /codon_start=1
FT                   /locus_tag="CND00310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43024"
FT                   /db_xref="InterPro:IPR018613"
FT                   /db_xref="InterPro:IPR040233"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ81"
FT                   /protein_id="AAW43024.2"
FT                   /translation="MSQDIPEEDVSRILFHLQLPPSDFLPLPPLQFLRAYLHLLPPSLL
FT                   EPFAIIPPKTRTLIPSIKRRRLIHSTTHPSFLTASQGRLRWPLLWERMGGDPFAPISES
FT                   AEEEAAWAESSFMKGTAGNQQVRKLGGFLRLMEEEREAEDVRAAKRMERRLDQEGEEFE
FT                   EESDEEEERFGANQRPQMAEDQQEVELAFEKRLLELFLDGLDTIDYSPIDFVDPPGGDP
FT                   IAQRDAEDRYFDDEEPSQTPNGTTQGEGLRGREMMVDEDKTAQNGQGDYDY"
FT   gene            complement(96291..97544)
FT                   /locus_tag="CND00320"
FT   mRNA            complement(join(96291..96631,96708..96774,96854..96936,
FT                   97042..97544))
FT                   /locus_tag="CND00320"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(96449..96631,96708..96774,96854..96936,
FT                   97042..97419))
FT                   /codon_start=1
FT                   /locus_tag="CND00320"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43065"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ80"
FT                   /protein_id="AAW43065.1"
FT                   /translation="MLSPKLRTITAGFLLLATVGSSTFAMLQPEAYNRSSTSSDSIDNR
FT                   KDHSQVSFSGNGDKVRGEGNAGGLTREEGSLVDVILGSGGSRDHDVNVGVDVTTGPTVA
FT                   DMLTTERTASLWWSYARDSVEIAKRLESKLKSSTVLVPVDKAILALEKKPHQSPGQTPE
FT                   DAALKFISAHIIDGTPREGTLPTLLPNFSVEFVKDESAKGGWRVRPGDVEVLAEKDGVN
FT                   GRVMYLAEVLPFLN"
FT   gene            complement(97632..97719)
FT                   /locus_tag="CND00330"
FT   tRNA            complement(97632..97719)
FT                   /locus_tag="CND00330"
FT                   /product="tRNA-Phe"
FT   gene            97871..99913
FT                   /locus_tag="CND00340"
FT   mRNA            join(97871..97960,98096..98191,98305..99913)
FT                   /locus_tag="CND00340"
FT                   /product="expressed protein"
FT   CDS_pept        join(97932..97960,98096..98191,98305..98401)
FT                   /codon_start=1
FT                   /locus_tag="CND00340"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43062"
FT                   /db_xref="GOA:Q5KJ79"
FT                   /db_xref="InterPro:IPR006721"
FT                   /db_xref="InterPro:IPR036742"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ79"
FT                   /protein_id="AAW43062.1"
FT                   /translation="MSSTWREFMSWNKYTSIASRALRQALNETDRVAAEKRAIIGVRYQ
FT                   LWENGQSGESNYVVPPPKEAKTSGKPSV"
FT   gene            complement(100573..102186)
FT                   /locus_tag="CND00350"
FT   mRNA            complement(join(100573..101142,101198..101483,
FT                   101538..101646,101704..101818,101878..102186))
FT                   /locus_tag="CND00350"
FT                   /product="low-affinity zinc ion transporter, putative"
FT   CDS_pept        complement(join(100710..101142,101198..101483,
FT                   101538..101646,101704..101818,101878..102044))
FT                   /codon_start=1
FT                   /locus_tag="CND00350"
FT                   /product="low-affinity zinc ion transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43085"
FT                   /db_xref="GOA:Q5KJ78"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ78"
FT                   /protein_id="AAW43085.1"
FT                   /translation="MSDDAADVDACAIDNSESHFGLRIGSIFIILVTSVIGTVLPIILR
FT                   QSSFVPRPVFDFAKYFGSGVIIATAFIHLLAPAWEELTSECLSGAWEDYDWAPAIVMAA
FT                   VYFIFFAEVAAYRAGTRRLQRLGINYSSHAHDETDAHAHTHDHEPPLGVDVTAPAPDHH
FT                   IHPDHSNITSHPHGHHRTSSGEKGKDAESASDVSTVNQLPSQAEAAAQLIAVAVLEFGV
FT                   VLHSVIIGLTLAVDESFVTLFIVIIFHQMFEGLGLGSRLSILTLPENLWWTRYAAAIFY
FT                   SLCTPVGVAIGLGVRSTYNGNGAKANIISGVLDATSAGILLYTGLVELLAHEVLLNPRM
FT                   MKSSNSKLAYVFCCMLLGSGLMALLGRWA"
FT   gene            106390..109418
FT                   /locus_tag="CND00370"
FT   mRNA            join(106390..106541,106597..106863,106924..107128,
FT                   107184..107269,107325..107775,107835..107924,
FT                   107981..108037,108094..108208,108274..108469,
FT                   108517..109085,109142..109418)
FT                   /locus_tag="CND00370"
FT                   /product="transcription factor, putative"
FT   CDS_pept        join(106498..106541,106597..106863,106924..107128,
FT                   107184..107269,107325..107775,107835..107924,
FT                   107981..108037,108094..108208,108274..108469,
FT                   108517..109085,109142..109143)
FT                   /codon_start=1
FT                   /locus_tag="CND00370"
FT                   /product="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43074"
FT                   /db_xref="GOA:Q5KJ76"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ76"
FT                   /protein_id="AAW43074.1"
FT                   /translation="MYTTACEACRKVRMKCIRPSRGYDMSEICERCRSTGIECITVKRR
FT                   VGRQPGVKNRKRKADSISEQTGASSASNSEAQIPRDVDHLPNPLHVLASEAIRRHFTPE
FT                   AEEATAQDSYHIRSSKSIFHRYSDWAEKIQPEGGKEAIMRRLDSLLSKKPIEMSSDVDE
FT                   PSVFCGRIDMARPDASPEHDVISLQIVSLAEAQHLFDSFMELITNGSMYFDPRLHTLAF
FT                   VRSRSSFLLAVILAIASTYKSICPSARLHTLLMNHAHRLEAVVRNNHLKSIEIIQGLLL
FT                   LASWMEIPSTLARDKTWMFVSYALALVVELRLDTALPYCVQTDPLYDKSNHDLLVRNAH
FT                   RVCFLMYIHDRNMAMVAGRHPIFRDSALVSPDSLAKWGKHPLAHRFDAAICASVSLRKL
FT                   VTSAHARLSTQNYPDFASGEEYIDRSMAEWRRRWSYEIQSTHEYDIIARFSAFVLALTL
FT                   VKKRQLTGQIEREARRACEVLAFDVVCAAIHHYKTWKGLLNSATFDTSMVAFCAIYTIQ
FT                   SINHSASPYLSDLSLLRLATVHELIGELETQAEARHTVDIPGYFSVVDAMARQLSRNMR
FT                   LLLSKKEIYQAPHSETSETHSSTYNPHTNFIHTHPHLHHLQDPHHYTNNQFPQFDEVAQ
FT                   FMFTADDGGLPFMGDWGLEGLLPDMDFGIDTGYSGSESGGTSHEMTQGVNMQHMLNLG"
FT   gene            110375..113034
FT                   /locus_tag="CND00380"
FT   mRNA            join(110375..111176,111217..111483,111535..111996,
FT                   112048..112198,112258..112275,112350..112467,
FT                   112545..112622,112686..113034)
FT                   /locus_tag="CND00380"
FT                   /product="glucosidase, putative"
FT   CDS_pept        join(110440..111176,111217..111483,111535..111996,
FT                   112048..112198,112258..112275,112350..112467,
FT                   112545..112622,112686..112726)
FT                   /codon_start=1
FT                   /locus_tag="CND00380"
FT                   /product="glucosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43075"
FT                   /db_xref="GOA:Q5KJ75"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ75"
FT                   /protein_id="AAW43075.1"
FT                   /translation="MRSSQRQGREPLLQSAENPGQSQRLSDSSFTSFDHPGMSHRGSHN
FT                   DASVNSYGSSSSNRFGPTASLASANSAAVVAGNTGGFSDELPRQASPQAQMGNWHDVDD
FT                   LDDHLHTFTSQDHKDLGSPFDITSVRGWANALTLGILAGGGVMLFAGYPIISFYYGDSN
FT                   SSGANTSGYNLGGINSSGQYPEIPGLPTLIDADTPEWAYKRTGFDGDEWTLVFSDEFNK
FT                   DGRTFFEGDDPFWTGMDIHYWPTGDFEWLDPSAVTTADGHLVITMTQEPIHDLNFKSGM
FT                   LQTWNKLCFNKHAYFEFSASMPGQTMNGGFWPGIWTMGNLGRPGYGASTEGMWPYTYDS
FT                   CDVGTLPNQTYVNGTGPIATLTTGADDSPLSYLPGQRCSACTCPGEDHPGPVHTKGRAA
FT                   PEIDIVEAQIIISESRGEVSQSFQVAPYDDYYQSDNSSKNFKHYDTDLTYWNTYLGGHF
FT                   QQAVSSLTRLPRNIYWDQPGDSKQFTVFAMEYQAFPEARDQGYITWWADNKTSWTMYAD
FT                   AVAENPRTGIGRRIIPEEPMAMIVNLHMSNNFQAVDFANLKWPNYFRIDYVRVYQKPDQ
FT                   ISIGCDPEDYPTADYIARHAEVYSNPNLTTWGAAGYTFPKSSMKGDC"
FT   gene            114499..117205
FT                   /locus_tag="CND00390"
FT   mRNA            join(114499..115496,115550..115731,115785..116313,
FT                   116367..116437,116490..116675,116750..116849,
FT                   116908..117205)
FT                   /locus_tag="CND00390"
FT                   /product="multidrug efflux pump, putative"
FT   CDS_pept        join(114802..115496,115550..115731,115785..116313,
FT                   116367..116437,116490..116675,116750..116849,
FT                   116908..117109)
FT                   /codon_start=1
FT                   /locus_tag="CND00390"
FT                   /product="multidrug efflux pump, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43020"
FT                   /db_xref="GOA:Q5KJ74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ74"
FT                   /protein_id="AAW43020.1"
FT                   /translation="MSTHHTNQIHDHSPSSPSNQPVLEEGEDEYRPLPHAWSGATLYEP
FT                   YTLSRDKLKNVNSVEFCSQVNERESEESGEVQGNVGLTREVPNSVFVEPQEDYIPYSSG
FT                   KGPNKRSDLPHLYYDSPWPESANDSSPGPAHNARDGDQNEKLGGLNASTIPNFSSSGNA
FT                   SLPPLTSSQSYLQSRSSFFRLVFLLTTCATQLIVQAQLGMVMMPLHATAEWLGKANNSG
FT                   EMSWMAASYGLTVGMFLVMAGRLGDIYGPRLIWAVGCTFMIVCNIGSGFATTAIGFDIA
FT                   RAVAGIGSALALPNALAILGRTYPPGQTRNMVFSILGALAPVGFWIGGVLGGLFAQFAH
FT                   IKWVWWFTAILTALFLGVGFYVLPPDSLCPSVSKPHFDTVGAILLSLTLGLFNFVWNQA
FT                   PLVSWSAAYIPAMLGVSLIFGGIFVWWERRVGKGALIPMEVLSKQSLLVYLSLWLGWMS
FT                   YGTFLLYTMFFIYGIRGYTEPLTMAFQLAPLLPAGVIAALIVPLLIRHLPNHFIFLLSM
FT                   FAFIACNIIAATASSSTANGEYWKGTFWSLIIGTFGPDLSFSTGQLIVSNSVSHEFQGI
FT                   AAGVVSMITNYSIAIGLGLTGTLEYYIRGSGDTIDDVLRGYRASFWFATGLAGIAGIVV
FT                   ALFVRVPKQTGGLQVIHPV"
FT   gene            117679..120453
FT                   /locus_tag="CND00400"
FT   mRNA            join(117679..118020,118067..118255,118306..118919,
FT                   118968..119051,119104..119405,119452..119681,
FT                   119744..120453)
FT                   /locus_tag="CND00400"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(117727..118020,118067..118255,118306..118919,
FT                   118968..119051,119104..119405,119452..119681,
FT                   119744..120397)
FT                   /codon_start=1
FT                   /locus_tag="CND00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43018"
FT                   /db_xref="InterPro:IPR012583"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ73"
FT                   /protein_id="AAW43018.2"
FT                   /translation="MAEQTQVIPLLSSLQFTHPSFVPLLESHKPLARPSISSQSQLNKL
FT                   ISRLNTVLLAKDDSREKRAACIVAKEMINQDEEGWVLAGWGKGWLGGCLGWIASTSSPI
FT                   PSIPPYISLLSTLVLTSSHFPSFERQNVHPIMGKLSVSLGRLLQRCLAEPQPDWDVMLD
FT                   ILDSYQSLLLHSPANFRPSTATLKPILLALLLMIPTPTSPNPSIPAEIRTASAKLLACC
FT                   HVTAGKAQSPASWTADVKDLLGGIGKAAAGITADAWEADPVAVNPPPSPNTPELPIDPL
FT                   QRVPVALDWLEGLTEAVLEMLRFPTNRPVHVPVAGIVSAGLRFLSLTLDTPTVSYISPQ
FT                   HHALLVASLPRIWSIGMQLLGGIALAVEDHLFPHLSNILDHSVWLLERIPSSMSECRTQ
FT                   LLKFHTLLLTLFPPSLVPTDYPTRLLRFCISTFSPLLERKDVSASAAASQNESGGGKRG
FT                   KKRARNAEDGLVGDLEGKGRQSLGAGEVKVILQALKLSPILHTTPLISPSLLTLSIRLH
FT                   LSLYLALPSLFSSVFPSINAKSETLEAVQKVLESVLSVGEGWSKGYESVIISVLSHKSQ
FT                   SSIDKIIHPKLPPMLRAQPALRELHFFTKEGDEEKKERKLARLGIDDEDIEVEKEEEEE
FT                   AVRPPPTQVTSTTGFASFALPATREVPSSMPLAASAPLVPIAAPVAAPSVAPAPSAAFV
FT                   LDSTSAPATATAPVVAPIPSQPEQTTSTIPSSSFISFTSNLASATTNSKTNETVVKQTT
FT                   HVEKMEVDDEDEGIPELDSGSDDDLLEDDDGEEDD"
FT   gene            complement(120644..122305)
FT                   /locus_tag="CND00410"
FT   mRNA            complement(join(120644..121418,121492..122305))
FT                   /locus_tag="CND00410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(121496..122293)
FT                   /codon_start=1
FT                   /locus_tag="CND00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43372"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ72"
FT                   /protein_id="AAW43372.2"
FT                   /translation="MAMPLPASHTKHLELLFHPLPQDPSVILPLKQISSSGSTSIGTTG
FT                   TTLWLSAQVLSSYLSSLPSSMSEKALRVIELGAGIGYTSLVLASLGYQVTSTDIEPVFS
FT                   SVLAPNLETGKDRLVRSRLPCNVYARKLDWTDISRLQQGEKSVKELEWVAEGWDMVVMT
FT                   DTFYAPQILEPLWDTLIYLSSNSKSPPSPPKEEKEKEKRPPIYIALEARDPVFISRALE
FT                   IGRQKGFELKKIAVRRVARDVERWGWSREDWEGIDVWKGRWKG"
FT   gene            122446..124337
FT                   /locus_tag="CND00420"
FT   mRNA            join(122446..122813,122861..122960,123002..123311,
FT                   123360..124009,124073..124337)
FT                   /locus_tag="CND00420"
FT                   /product="expressed protein"
FT   CDS_pept        join(122451..122813,122861..122960,123002..123311,
FT                   123360..124009,124073..124281)
FT                   /codon_start=1
FT                   /locus_tag="CND00420"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43076"
FT                   /db_xref="GOA:Q5KJ71"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ71"
FT                   /protein_id="AAW43076.1"
FT                   /translation="MSVPSYIALSLPPSAIHIPSPSATNISASATSSNAKPHLPFPPSS
FT                   APRGKPTGSTLGMSLPSLSTNVSDMLLSSLLPPNLPKLPSGGARGIDGGGPRQLTTQRE
FT                   GLTVPLLSNNFRRFVTRVGPVFWLQDRIEEVLYWRKPVWTWGWMLTWVFICFQPRVLLL
FT                   LPSLALIVLLLHIHERTHPVPSLIGIISPPPLATARVHPESSTGDSSPDRSYTATTTRD
FT                   ESGETVGVPVVPPKEAESGVDYFMNIQAIQNLMGLVSDAYDYLAPILSNLQSPNTSSPT
FT                   CFPLTHTHIILLLLPPTLFLPLVPSWLIPYVILPLGLLPPLGFHPNLTPWLLSLPRHPS
FT                   IRKTKSVLEKWILTDKLPDKYSGHKISQVYVWENERLDPKLASSSSSFTGPIPTTSWSA
FT                   RFLRQGDRRAWIKISDVAEGEECLWKSVDDTGLPNGDDESEVEAKVLALKDGWEWLPED
FT                   WKVDVNGLWSENGVDEEGWLYTDDSWQNPSPTPYTEPDLPANSASIPGQLVQSVQTGKE
FT                   KDMPGLGLRRVTRRRRWWKRVYKVDS"
FT   gene            complement(123285..125255)
FT                   /locus_tag="CND00430"
FT   mRNA            complement(join(123285..124535,124625..124699,
FT                   124786..124825,124901..124943,125021..125255))
FT                   /locus_tag="CND00430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(124483..124535,124625..124699,
FT                   124786..124825,124901..124943,125021..125121))
FT                   /codon_start=1
FT                   /locus_tag="CND00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43016"
FT                   /db_xref="GOA:Q5KJ70"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ70"
FT                   /protein_id="AAW43016.1"
FT                   /translation="MASSSDYLGYAYASLLTIGGVMGGIRKGSVISAVAGVGSGIAAAY
FT                   GANRVSKDPLDVIPSLSVSAVLLTLMSWRLYKTRKFMPAGLVVTLSLLMTVRYALLLA"
FT   gene            complement(125326..127806)
FT                   /locus_tag="CND00440"
FT   mRNA            complement(join(125326..125967,126021..126364,
FT                   126410..126472,126524..126946,127001..127261,
FT                   127309..127396,127450..127806))
FT                   /locus_tag="CND00440"
FT                   /product="aflatoxin efflux pump AFLT, putative"
FT   CDS_pept        complement(join(125540..125967,126021..126364,
FT                   126410..126472,126524..126946,127001..127261,
FT                   127309..127396,127450..127741))
FT                   /codon_start=1
FT                   /locus_tag="CND00440"
FT                   /product="aflatoxin efflux pump AFLT, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43014"
FT                   /db_xref="GOA:Q5KJ69"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ69"
FT                   /protein_id="AAW43014.1"
FT                   /translation="MALSEHSAMVSPTTTISVDGDREKRFSVEEDPLPTASAAIPSSAV
FT                   ANTPDDQSSVQGTGGQTPPKGHSGFTAPLEIPKWRFMAIFGSLMISVFLFALDQLIVAT
FT                   AIPKITAEFNSLTQLSWLTSGFFLTLLSFNLLYSQLMNIFPSKHVIVFAVFIFEMGSLA
FT                   CGVAPNMNVLIFGRALAGAGAAGIFSGGMVIIAELTPLHSRAQYFALFGVCFAIASVIG
FT                   PLIGGAFSDHVSWRWCFYINLPLGGVAIGCLLFFQPSRPPLGRESSYKGYSKAMLKQLL
FT                   MCDWVGVVLSMAWAVCFILATQWGGVTRSWDSASVIVTLVFAGVLPIAFCVYEYFIKES
FT                   ISYFRIRLFKRRTVAGAAIVSFCVFGIFMILVYYLSLTFQAVHGTSATSAGVKLLPLIL
FT                   VQVFILILTSRIIPRIGRFKPVICVGPVFLAIASGLFYSTDYSTPIANLYGYQVILAVG
FT                   IGCCLQNVMVAVQHDLKKEPWLISLGTGLVVFTGFAGRIVALSMSGSVFENMIQRHLKS
FT                   MVPGISEEIISAVVNDATAVWTSVPEDLREPVLRAYTKTLSQVFIIGLPLSIIALVGAL
FT                   VMKNDKMATKEEEEKGIADARAAQQAKKDEEAGVNGVNERSEEGARGSAEDEEGRA"
FT   gene            complement(128688..131261)
FT                   /locus_tag="CND00450"
FT   mRNA            complement(join(128688..128973,129022..129121,
FT                   129174..129421,129473..129835,129889..130054,
FT                   130109..130239,130285..130335,130382..131261))
FT                   /locus_tag="CND00450"
FT                   /product="MFS transporter, putative"
FT   CDS_pept        complement(join(128760..128973,129022..129121,
FT                   129174..129421,129473..129835,129889..130054,
FT                   130109..130239,130285..130335,130382..131028))
FT                   /codon_start=1
FT                   /locus_tag="CND00450"
FT                   /product="MFS transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43012"
FT                   /db_xref="GOA:Q5KJ68"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ68"
FT                   /protein_id="AAW43012.2"
FT                   /translation="MADPFESHLCSYVSLISTTYTMNVRETRSSSASPPPMIQSPITQN
FT                   EPRQDTVDSATETANVDQYKRVESEQTLCDKSGTVSPKTEKFFSYHQKSSGDMREHRIE
FT                   EDTGPQFLGAYEQEQPSTPEHDRQASSDILHCQLSRPQGDDIELGPEPEREAVQWIEGQ
FT                   SSFVRFCFITCCCTTQLIVQGQLGMVMIPLHYIGDYLGTTDNGQLNWMVASYGLTIGMF
FT                   LVASGRLGDLYGPKLIWVLGFIVLMSANIGTGFCKSPIPFDICRALTGVGSAMCLPNAL
FT                   AILGRTYPPGKVRNVTFAILGALAPAGWCISGGVASLFAQFVDVRWIWWFVAIFIAAFL
FT                   AIGLYILPPDQNLPPRSERHFDIPGAVLLALALGLFNFCWNQASVVGWETVYVYVLLIV
FT                   SIVTFVAFFLWERRIGRKALVPLEILTRKNLLVYLSLWLGWMSFGTFLLYTTLFIHDIR
FT                   GYTLPLTMTAQTTPFVFGGVTAALSVPFLIHRLPGHVIFFIAMCAFMIGNILAATAPVD
FT                   GTYWGNTFFSILIGVFGPDLSFATGQLIVSNSVDVEFQGIAAGLVSMITNYSNSIGLGL
FT                   TGTVERYVRGPENLSQSDLLYGYRVSFYFGTALAAMAVIVVGLFVRMPTEGKRLDDERK
FT                   KAEH"
FT   gene            complement(131369..137974)
FT                   /locus_tag="CND00460"
FT   mRNA            complement(join(131369..131753,131804..132116,
FT                   132166..132261,132310..132615,132666..133292,
FT                   133345..133493,133543..134335,134387..134511,
FT                   134565..134930,134985..135611,135662..136536,
FT                   136585..137384,137432..137575,137624..137772,
FT                   137818..137974))
FT                   /locus_tag="CND00460"
FT                   /product="nucleolus protein, putative"
FT   CDS_pept        complement(join(131431..131753,131804..132116,
FT                   132166..132261,132310..132615,132666..133292,
FT                   133345..133493,133543..134335,134387..134511,
FT                   134565..134930,134985..135611,135662..136536,
FT                   136585..137384,137432..137575,137624..137772,
FT                   137818..137950))
FT                   /codon_start=1
FT                   /locus_tag="CND00460"
FT                   /product="nucleolus protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43061"
FT                   /db_xref="GOA:Q5KJ67"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021714"
FT                   /db_xref="InterPro:IPR032436"
FT                   /db_xref="InterPro:IPR039844"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ67"
FT                   /protein_id="AAW43061.1"
FT                   /translation="MAPKRKWQEGQEDALPTIIRAKPGTKAFASGKSVKDALATGSPQA
FT                   FVSFRQQIVTPYSELPLSINHPTVIILQHYLDISPACDEIFRAWQVGEQTKSEQQVHAA
FT                   VELLSEIIQVLTPVPFFRSIVIGLVNKVISPSEPYHDHINHLIQSGKRDDVYHGLLLSA
FT                   VSMSVDPPSTSSMSGRLGMKFWNTLVEGGSVRGFGKQMGMRRRNKEGMVGYGDRDPLDK
FT                   PDIRHLILRIILPLFPSPSFQPHAKIILPPLYSNLAADPPITVLRILTALWAAISSPSF
FT                   GLNRRVSLVLFQERSIEALWGQLGRDDVEGKSGKKVGELVRAFLEGITATPGKGVCFPD
FT                   EGWYPRRMDDSKEGDNKVGDGGDTWRKGLHNRILGNVVRKVGNKVVDDEGIVGEWMIEV
FT                   FRACPELVSGYWAHSALSLEPRLNVRWMATMSYVGRIISLPIPPLQTFRQPVPAGTDPS
FT                   FSPFRTAPPQASTIVESVLPAPFTKSHLMKGLQHTEGIVQHMTAVTLSRALAKLGQVQE
FT                   LFSFIESELYPNGQPDNPWARRQRELEMEVRKRLPELAVIVAFAQKSAQLAPAEPDPDS
FT                   EEDRALVTKSAMLTELALRIFSLCNRTLPSMASELKFDVGRLLVSSSSAKQEKKEKQQA
FT                   REGSVIGDDVQSVKSIGTVGSKGTIGMRGGFGQSRGEVEGFEALSQVHVLELLGEVRDW
FT                   NWSNKAAGSQYTYLYHILLLHLSTPQSVTYSKTTALLSHLLLPTLLFEHDPEELPIWLD
FT                   AMPKKVREAGPMLFAQQIQLLAFLDDCFRRCLKTPYRYIEDTLALSPSSTPDLQSNSKE
FT                   MVSPLMMTILEQLSAKLMGQLISTEAACIIVNYLRRVVLGLVGKQRELSWLLAVLNRLE
FT                   ECVKKAKEAGQERKGLEECVQVIKGDFDVIRGKSEPTDEQDPSLPQLLDHREWSSSSFE
FT                   YQALFIGRPSTLSSLIFLIERKDASILLHVNFLIHLNILQPSSTSAIKNQDSTQAVLIL
FT                   FARSLENLEGASKWQDQIKRNVFGDLGSRKLLFSEDGHEFRDSLNTLIRHLIFGKSTDE
FT                   EIAQGFVDGCVELLDNDKEGKKVDQNLSLLAPWVRFLTPSQASQISQILFRYKNPVLFS
FT                   HALLLSDIITSTKSPAFAVEHLGKLGELGVVGAVIRLVDDAVKDRKSSEELTSLKIKRE
FT                   TIQLLLNLASNDSISLLVRLIQANSSAAEVTSSALQEDEALTNDRRLLPVAEALFVLGL
FT                   DVGKASIIGGVALETIASEQDEKVQGAAIEVLVRLAESASNEIVEILSTVQLSSFNSTF
FT                   MRFMERLAHICGTKIELLESICHLIGLGLQYAVRLCSNLKDMNEESATALKSLEQSIEV
FT                   VDQDRLQLQVALVEPVITAVIQDRLEIAEAVGLATLLAVRVELKASFLRQQLQAIYAST
FT                   TYTRCTNSSCPPHIRLHFIRLLHRLFASSTYVSCQPPFIEPLILLYRGTTSEVDRRVLH
FT                   MLQLFEGYRKISLASVMRYWNASGVLGIGGKSLDALTSLDPQKTFATCQAYPLHRKLRG
FT                   WGKIATDPEEGEELYDPVFVMGLFIASMHEGMRGLDWVEVLRSNVLGLTVCGLSSRDRE
FT                   VRSVASYALAKTMSLIETTGFFERAQLIYTLRLLRHALPTSTSRLPVLSTLFFAYALRS
FT                   LANPSHFFYPLSSRFLLQRSVFDSEDTPLLYGMLYANGEGWKRERSWMVRFLKEGVRSE
FT                   ADWRVIRRRKVWSLMATLFIESLDPVFRRSILQTMSSILLIPAAASSLVLRDGLFVWLD
FT                   MQWTTISAYHASLPISSKSGVRGQRAQAWEQEEKNLLLEIAERACKAIASAEKERVKEG
FT                   KDLRGWTKQLEAFLTTVLSDADGEKLEVASKILYSVSQIPVDTTTTELLPLFVDRLSST
FT                   GPVASALPNIISCLFAAGLNVKPTDVREKDDLAKALGEVRWRVEQGDAGNYLKGWVRRE
FT                   RQLTERMN"
FT   gene            138150..141653
FT                   /locus_tag="CND00470"
FT   mRNA            join(138150..138519,138568..138631,138685..138884,
FT                   138948..139109,139158..141653)
FT                   /locus_tag="CND00470"
FT                   /product="expressed protein"
FT   CDS_pept        join(138702..138884,138948..139109,139158..141413)
FT                   /codon_start=1
FT                   /locus_tag="CND00470"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43055"
FT                   /db_xref="GOA:Q5KJ66"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ66"
FT                   /protein_id="AAW43055.2"
FT                   /translation="MSPSFAGYLQPLGSNGYNAPVPSPPQVTGHFNSASSEDKENIPSQ
FT                   PTFRARDWQEKRNNLQEAGFATLKIETLVPSNIGRKKKDIANVKRKPVSSVYEEGKNGG
FT                   VTSVSSSNPLNAATFSSAINSSTPSLLTVAPQNQLEMIQLTDSAVFPRQVVPSYSPINN
FT                   DMPFVAPLPDSCSETTLTSILNACVFSSDDEFSEENIPARDALPGGLGSGLVNESIQSL
FT                   DAMIEQQYQESGVTRESHNSFDTEANNSDRSKELDSPKEKAKRNKHHSKICSNRSYNSS
FT                   ILARRSSLKSSMYTGIEFNQEAASPTNENTEGNGCYTTESDTCSNNKTVLFATPAYQFD
FT                   YFQWSRKQPLKMNEILKGDETVTDHQSYPTTSDDDVYYAALTSEKRSAMIHEITTQLAT
FT                   KLTSDGANTNVNMAEPFNPPCHSSIQALNPENSSPMSSFYASNHHTASAATVPPSHHQS
FT                   AIRRNFDGRSLAVRYAQRHPFLLEGDNVPHDDDDSSSADIRPSANSNSDVENGRPHKRT
FT                   KERWLSVCLVMGFVMPLAWVVGGWFISGVDKETEKQLVGRAALELDDDPSSQQSDLNGP
FT                   HTDDVPRNNRNSHNNESIDSQATRLGPSDEPELDLWTPRINLTTSAANVTASFPAQYRP
FT                   FTSMPNLFMPSPPTAITRNSISSPNLLGLYEPPQPPMPVSESGTLESSILPVPVHSFTS
FT                   KDMSATPSPTPTLVNLSPTNFTRHWNPNYGHRPTPYPVTLSGSNLTCVPAGPGHPVLPS
FT                   HYLYHLSVNDPASSKLAPPAPTGRPSFVSNPAWLLDRCASMRTEYPNGKNTARFWKNSL
FT                   ARKKMRAWLPGAHPHPLVRANRWMMAFAFLLGCLTAICFMLVGIKSKMNQARVG"
FT   gene            complement(141599..143516)
FT                   /locus_tag="CND00480"
FT   mRNA            complement(join(141599..142207,142327..142501,
FT                   142578..142667,142734..142772,142840..143001,
FT                   143087..143354,143425..143516))
FT                   /locus_tag="CND00480"
FT                   /product="protein phosphatase inhibitor, putative"
FT   CDS_pept        complement(join(141765..142207,142327..142501,
FT                   142578..142667,142734..142772,142840..143001,
FT                   143087..143284))
FT                   /codon_start=1
FT                   /locus_tag="CND00480"
FT                   /product="protein phosphatase inhibitor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43084"
FT                   /db_xref="GOA:Q5KJ65"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ65"
FT                   /protein_id="AAW43084.1"
FT                   /translation="MSSTSQTTNARLSRLPRKPPRPFISAHHRPPTRNHTTTDNIFRVL
FT                   LISSGSVASIKIPNIVEELVKVGNIDIQIIATKASTHFYSQEDVDKSVQSALNLSDEEM
FT                   QDDVGVRIWTDEDEWSDWKKVGDPILHIELRRWADIVVVAPCSADLLAKISCGLCDTLA
FT                   SSFLRALSSSTPVVICPAMNTHMYQHRLTAKHLAVVQDELGYLVSGPQGAGRLACGDDG
FT                   PGKMTDWHDIVSLIQGFATMHQTQVSLASLTFPSLSMPYPSASASPSDTFIDTPSPPPA
FT                   SADTSTYNLPHRFPCGASSNLPQQREKEKGIGEHPTMVVPLPDPHPLSTEAALNGEKMP
FT                   ASVYAKNVDWEKLANDGGLWHRKWWLGV"
FT   gene            144044..147372
FT                   /locus_tag="CND00490"
FT   mRNA            join(144044..144141,144569..144736,145778..146117,
FT                   146179..146463,146524..147372)
FT                   /locus_tag="CND00490"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(144089..144141,144569..144736,145778..146117,
FT                   146179..146463,146524..147300)
FT                   /codon_start=1
FT                   /locus_tag="CND00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ64"
FT                   /protein_id="AAW43010.2"
FT                   /translation="MATDNSRFPPVTGSTVHPTSSMRDLPKGATGSPDADGDRDRETAE
FT                   AVSVHDQQQLPTPVTANSSRGKSRRRKDVQEADDGEHKDKRRRLTKSKPLPLAVPQTTS
FT                   PSKEPGSGSGSGPSTGESSQSQTSNKKVGHPASSANAAANPPVGFAASREARREEGYDI
FT                   YGAVPSPVVMGFDFKTIDGEQLKTVRDTLSIKEQQQALIAARRREAAGSSAVPPGTPKE
FT                   SSREPSTYKAWKPSEAPSLSGAVLPTSGGVGRRREKIKDKVEKMSIMTGVSDKDVVPAS
FT                   KSAPLDQRLITQQANFEPPSGSQTALPPKVLPSFSSSFHYLSDPRTAPISHSRTGADAG
FT                   APGGGERERSDGHEFARQQQQGYYWRTESRGGPPMGSGRNFTVPGAFPPRFDGPLSPPP
FT                   PPPLTRPSTQPHSHTHTHTHTHSHTGSPPSSPLQPLSIPSREAFLHPFNALYDSLSSST
FT                   TLQHHLSDLVSRVSNLHAEQGVAVQEFRNTAGAAERLLTSLQQSADSLREMVRYEIERK
FT                   AREDRREMEELKERLRRLEEREK"
FT   gene            complement(147850..149514)
FT                   /locus_tag="CND00500"
FT   mRNA            complement(join(147850..148030,148080..148473,
FT                   148533..148650,148706..149150,149214..149366,
FT                   149425..149514))
FT                   /locus_tag="CND00500"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(147915..148030,148080..148473,
FT                   148533..148650,148706..149121))
FT                   /codon_start=1
FT                   /locus_tag="CND00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43083"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ63"
FT                   /protein_id="AAW43083.2"
FT                   /translation="MYIKKWICKQASSYYLAHLHSFQTLQFIILYTMTKPASLTYLEAS
FT                   TPLEEIYKVIERDGGVIIRNFLSSELLQEAMSSIEPHFAVRGNYESKSTHQELGEDFFP
FT                   SGSLRIYGLLGKIPQVITKIVRLPTWQGVMARFLNDEYSSYTGEKLIPQKSGYMLASTA
FT                   ALRLVPGAQKQPLHRDQIAYQIRPDPTNPLFTPMVGCLIAGSKCTKKNGATAVIPGSHL
FT                   WGPDRAPHVEECTYAEMEAGDALFTLGSCYHGAGENQCEKSDPDALRTLFAVFGQRDYF
FT                   RQDQEEILSTPLELARTFPEDILRIAGYYKAVGGVGYVEDHQDPVEFLKAGSSLGQFAP
FT                   IPSKSYV"
FT   gene            149604..152792
FT                   /locus_tag="CND00510"
FT   mRNA            join(149604..150364,150422..150466,150520..150623,
FT                   150678..150837,150901..150988,151063..151326,
FT                   151382..151423,151492..151665,151727..151852,
FT                   151915..152134,152202..152592,152647..152792)
FT                   /locus_tag="CND00510"
FT                   /product="amino acid transporter, putative"
FT   CDS_pept        join(150106..150364,150422..150466,150520..150623,
FT                   150678..150837,150901..150988,151063..151326,
FT                   151382..151423,151492..151665,151727..151852,
FT                   151915..152134,152202..152390)
FT                   /codon_start=1
FT                   /locus_tag="CND00510"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43077"
FT                   /db_xref="GOA:Q5KJ62"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ62"
FT                   /protein_id="AAW43077.1"
FT                   /translation="MGSDSPKAYEMEDYDPKVAGSVDQTEIHINETGEGDIMRARVLDS
FT                   VNHRKLNARQIQLSSIAGAIGAALFVAIGSGVTAGPVALLIGFIFWATVVYSIAQCQLE
FT                   IVSLFPLDGSFIRLAGRMVDPALGTMVGYNHFFAQTSFVIFEATVVNTLVSYWGYSESP
FT                   AILISVSLLLYLAINVYRADLFGEAEFWLALGKVLLAIGLILYTLITMVGGNPLKDRFG
FT                   FRYWKDPGPWAGDSPSTRLESFINAVNTAGFCIGGPEYISMIAGEATDPRKTVPRAFKT
FT                   IMARLVVFFIGGALCVGILVPYNDPTLVAGDGTYAGGSPYVISMNRLKIPVLPSIVTAA
FT                   LLTCIVSGGNAYTFNASRSLHALALDGKAPAVLRRLNKKGVPYLAVIVVMLFSCLAYLA
FT                   LGSTSAKVLNWILNFCTAATMLNWCVMAFTYVRFYSAMKVQNIDRKEFLPVYSKFQPFA
FT                   GYWALCWACLFIWLQGYSVFLKGNWNVATFIFNYGIIALAGAIGLFFKIYERTPFHKSK
FT                   DVDLHSDLDFFDALNQYYQQKKDDSPPANVKDKIMAKLF"
FT   gene            complement(153574..156518)
FT                   /pseudo
FT                   /locus_tag="CND00520"
FT   gene            154014..156624
FT                   /locus_tag="CND00530"
FT   mRNA            join(154014..154101,154167..154204,154257..154412,
FT                   154466..154668,154729..155073,155133..155228,
FT                   155280..155414,155470..156284,156346..156624)
FT                   /locus_tag="CND00530"
FT                   /product="urea transporter, putative"
FT   CDS_pept        join(154057..154101,154167..154204,154257..154412,
FT                   154466..154668,154729..155073,155133..155228,
FT                   155280..155414,155470..156284,156346..156537)
FT                   /codon_start=1
FT                   /locus_tag="CND00530"
FT                   /product="urea transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43008"
FT                   /db_xref="GOA:Q5KJ61"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ61"
FT                   /protein_id="AAW43008.1"
FT                   /translation="MSSTVLPQGAGYGVVIGMGLFFSLLMVGIAKLQTRYTSHKTSSAE
FT                   EFNSASRSVPPGLIAAGIVSAWTWAATLLQSSATAYKFGISGPWWYASGAAIQVLLFAM
FT                   ISSKLKQHAPFCHTYLEIIKARWGRAAHLVFLFFALATNIIVSTMLILGGSATVTDLTG
FT                   MNTVAACFLIPLGVSIYVLTGGMRATLIADYSHTLVLYCILISFALVAYATSPIIGSPS
FT                   KMWELLNYAAEANPISGNAQGSYLTMRSKSGLIFGVLNIVGNFGTVFNDQAYWQRAIAS
FT                   DPKTSVKAFLWGGIAWFGIPLGIATSLGLSAVALAHGTSTPIITLTPDEVSAGLPAVKA
FT                   ASALMGQSGATAMLILLFLAVTSACSAEQIAVSSILTYDIFGTYIRPNPSEKQILWVSH
FT                   VCIFSYALFMGAIATAFNYIGVSMGYLYELMGCIIGSAVVPIALCITWRKCNGTGACVG
FT                   AVLGFCAGVAGWLGITSTLNDGVINVTTTFGDYEMLTGNLLSIGVGGIITVAWSYIHPA
FT                   NFDWDITRSINNKEDFTLTENNEPSAEPLAYDDEKEKLDGEGEGFQGGAEPMRNTTHTT
FT                   VEAQPTDMTKENEELQKAFRFAAIAALSLVVILIFVIPLPLFFTSHVYPVKGFTAWVCI
FT                   SLIWLFVGLGMVGVYPAWEAREGLMKVGKGIVRDITRQN"
FT   gene            complement(157121..159870)
FT                   /locus_tag="CND00550"
FT   mRNA            complement(join(157121..157638,157705..157782,
FT                   157842..158593,158641..158907,158969..159870))
FT                   /locus_tag="CND00550"
FT                   /product="glucosidase, putative"
FT   CDS_pept        complement(join(157601..157638,157705..157782,
FT                   157842..158593,158641..158907,158969..159693))
FT                   /codon_start=1
FT                   /locus_tag="CND00550"
FT                   /product="glucosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43082"
FT                   /db_xref="GOA:Q5KJ60"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ60"
FT                   /protein_id="AAW43082.1"
FT                   /translation="MQYGSQSPTLGREPLLASAQNPGMSQRLSESSFTSYDNQSSMSHR
FT                   VGANSPTGASYASFSSGNRFGPTAHLNPGPVAGVSEAGALPTDAYAQGPIDDDDDMDDH
FT                   LHTFTAAEKKDLSTPFNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYYGDDSSSGS
FT                   NTSGYNLGGINASGQYPSITGLPSLIDSDTPEYLYTRTGFDGKEWTLVFSDEFEKDGRT
FT                   FFEGDDPFWTGVDLNYWPTGDLEWYDPSAITTADGHLVITVTQEPIHDLNFKSGMLQSW
FT                   NKFCVSKNAYIEFSASLPGTSGIGGFWPGVWTMGNLGRPGYGASTEGMWPYTYNSCDVG
FT                   ILPNQTWLNGTGPEAALTSGSSGTQLSLLPGMRTPSCTCEGEDHPGPDVTVGRSSPEID
FT                   IIEAQIIISENRGEVSQSFQTAPFDDYYQWDNTSTSNYKQYDTDLTYWNTYLGGTYQQS
FT                   VSSLTRVPRDIYYSQSGGGGEFAMFAMEYDSAPNNKEDGYVTWYSDNKTSWTMYADAVA
FT                   ANERVGIGRRTIPEEPMTLIVNLGLSFNFQPVDFDHLTFPNYLRIDYFRVYQQSDSISI
FT                   GCDPDDYPTADYISKHAEVYSNANLTTWAQAGYTFPKNELTGC"
FT   gene            161021..162734
FT                   /locus_tag="CND00560"
FT   mRNA            join(161021..162080,162138..162207,162315..162734)
FT                   /locus_tag="CND00560"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(161110..162080,162138..162207,162315..162404)
FT                   /codon_start=1
FT                   /locus_tag="CND00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43151"
FT                   /db_xref="GOA:Q5KJ59"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ59"
FT                   /protein_id="AAW43151.2"
FT                   /translation="MSHSHIHNTFAPSTLTNPFAPAPLRPRASGNGVIGNVLSAPHDTD
FT                   DGSYADNAIIPKLHSDTRKPVDRSDPKVSQVASAVVQNVKSSEGEAAVHANHQHGPYGR
FT                   QPVGFLTPNVQRNQGYGSHDYTQNSNSIPSTNGLGLASSPQRQKQSDTNAQAEHSQSVP
FT                   NQSRTQPTHGNYPPIRNVPPAITTGLVPPLSILLPAPASPICPLLAAPPQAHYSPLPFP
FT                   SSPHPSPHRTTPSSSPSTPKHILAHARASTTSESIRGFDLLAEKKASFREGEEELMTPF
FT                   SPRPRNKPSALRDGLRASGADFWKRYSVSVRLDEIDKQKGPSSDWLSKAQANRGILKKM
FT                   AWSFTLMTLVIVAIIVVVVVVTNNKSDNSSKTKSNL"
FT   gene            complement(162942..165111)
FT                   /locus_tag="CND00570"
FT   mRNA            complement(join(162942..163039,163103..163683,
FT                   163734..163898,163957..164168,164218..164268,
FT                   164315..164409,164461..164604,164660..165111))
FT                   /locus_tag="CND00570"
FT                   /product="transcription factor, putative"
FT   CDS_pept        complement(join(162974..163039,163103..163683,
FT                   163734..163898,163957..164168,164218..164268,
FT                   164315..164409,164461..164604,164660..164998))
FT                   /codon_start=1
FT                   /locus_tag="CND00570"
FT                   /product="transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43006"
FT                   /db_xref="GOA:Q5KJ58"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ58"
FT                   /protein_id="AAW43006.1"
FT                   /translation="MEGFDLPMSFGKKSKAGNSNLKAKVENTKRADIPTPVKEEKPEEE
FT                   VPGPSISTSGRKTEAEEEDDEEIGPIPPSATGKRKAEENDASDDEQEAEEEVDRLPISH
FT                   EIILKDHTKVVSALAVDPSGARIATGSHDYDTKLWDFGGMDHRLKPFKSFEANGNYYVH
FT                   DLSYSPDGQQLLVISGTVHPKVFNRNGEDEMEFNKGDVYLRDMKNTNGHTAEINAGAWH
FT                   PTDKSIFLTCSNDSTLRIWDTSNKRKQKQVIVVKSKERGARTKVTACAWSPDGKWIAGV
FT                   CLDGTLHIWDTSSNFARPKYSCENAHPKNTETTGVAFSRDGLRVATRGGDDTVKLWDIR
FT                   SIRNPLAVAKNLDNLYPETNIIFSPDDTQILTGTAAPKGQKGGLVFLNSKDLKEERRIA
FT                   IGDGSVVRVLWHSRINQIFATLSTGGVHVLYSPNSSIHGALLPLAKLPKTAPRDPSFST
FT                   VDLKPVIYTPDALPMYQEQGHRESLHQKEKKAKKMKPMEPVSGVGRAGRLGASETQSFV
FT                   HSMYPETLKFEDPREALLKYASKEEQEKKKQEM"
FT   gene            complement(165176..167715)
FT                   /locus_tag="CND00580"
FT   mRNA            complement(join(165176..167044,167091..167328,
FT                   167375..167715))
FT                   /locus_tag="CND00580"
FT                   /product="alkylbase DNA N-glycosylase, putative"
FT   CDS_pept        complement(join(165344..167044,167091..167328,
FT                   167375..167655))
FT                   /codon_start=1
FT                   /locus_tag="CND00580"
FT                   /product="alkylbase DNA N-glycosylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43004"
FT                   /db_xref="GOA:Q5KJ57"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="InterPro:IPR039739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ57"
FT                   /protein_id="AAW43004.1"
FT                   /translation="MPPSTHPQSRSKPLLNMDSDPASWLNFSLPPRARSGAGVPGSGVP
FT                   GPPRRSRKGGEGWRGGVLSREKYLNASFKFVLKPSEALSYGAHFADPDISLHWPNILQI
FT                   LVPTFSALSVAQGYVSEPHAEGGYTSHDLEEMGEEAAERRRRMEEEKRGRMCPICLGKP
FT                   VAGRMTKCGHIFCFPCILHYIQLSDIPKSAKCPICGDMVQSNALKSVKYLDAEAMLESS
FT                   THATSDAFEASLEEAKRLDSGDRHDKRHRLHMRLIQRPQMTTLALPSSSTWPSDAVPPH
FT                   TAPWYFLPDIITYSRYMLATPEYMGKELEREMKELGGEWELLRGDELGRVFVKAAMDKV
FT                   ERQMIKVKEELETELVRRSERKGREAWSSAIGGDKKEKEQQKERERKEQERMKREKQQD
FT                   IGAVPVEFLANQQTTFDNSANINIPPNLPVEPNPMPPMPRDKKSRRRLNPVPPPQSVPP
FT                   APSYYFYQSSLGANVFLHPLDIRMLLAHYGSYNLFPSSMTFETTGYDPGTINDDLRKRC
FT                   KYLSHLPLGSEIVFVETNLAELVSSTILAQFEQPLKARRQKRRDKVRKEDRAKQKWEKA
FT                   ERSKTAEELQSVRSVPSAFVRGGVEEDRELELALARSAVEFEQNFPVAYPQPGIASSPP
FT                   RSGSWGQTPIQTQSESQQDQQRSFATALHQRYDPSLSRSRREVDPEVDALWQQFESTDV
FT                   HLEPSMGANAGAGTGAGVRESERGNGRKKKEKGKKLILGGGGRRA"
FT   gene            168188..168283
FT                   /locus_tag="CND00590"
FT   tRNA            168188..168283
FT                   /locus_tag="CND00590"
FT                   /product="tRNA-Glu"
FT   gene            169004..171421
FT                   /locus_tag="CND00600"
FT   mRNA            join(169004..169581,169633..169915,169967..170193,
FT                   170241..170551,170610..170886,170938..171125,
FT                   171179..171421)
FT                   /locus_tag="CND00600"
FT                   /product="carboxypeptidase D, putative"
FT   CDS_pept        join(169344..169581,169633..169915,169967..170193,
FT                   170241..170551,170610..170886,170938..171125,
FT                   171179..171301)
FT                   /codon_start=1
FT                   /locus_tag="CND00600"
FT                   /product="carboxypeptidase D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43002"
FT                   /db_xref="GOA:Q5KJ56"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ56"
FT                   /protein_id="AAW43002.1"
FT                   /translation="MWSKVVTTALLAIALGSVIEAASDPSALRGRGPAALAAKEAKKEA
FT                   PANNASNSDASKMEKCRALLERHPKRKFYNNRTSEFLIESLPEVPFDLGEVYSGLIPID
FT                   YNNQSEALFFVFQPKLGEDSDDLTIWLNGGPGCSSLEGWFQENGLWTWQPGTYAPVINP
FT                   YSWVNLTNMLWVEQPIGTGFSIGTPKATTEEEIAQDFIKWFKNFQDTFGIKNFKIYVTG
FT                   ESYAGRYVPYIGAAMLDAQDKTYYNLSGALMYDPTIGESVFVQEQITTYPFVEANANLF
FT                   NFNKTTMAELKDLHEFCGYKEYIERYLTFPPTENQPPLFFDYYDFDNITCAIFDIVNNM
FT                   ALRINPCFDIYEINLMCPLLWDVLGMPTQLSYAPGGIYFNRSDVKAAIHAPEHIDWTAC
FT                   ATRAVFVGGIEQGPQGRGDLSLDPIQKVLPQVIEATNRVLISNGDYDMVIITNGTLLAI
FT                   QNMTWNGYLGFQSPPSEDIFIDIVDTQWSSIFESNGFDGYPGPQGVMGIQHYERGLMWA
FT                   ETFQSGHMQPQYQPRSSYRHLQWLLRHVDRL"
FT   gene            172062..173348
FT                   /locus_tag="CND00610"
FT   mRNA            join(172062..172156,172228..172275,172393..172494,
FT                   172561..173039,173120..173348)
FT                   /locus_tag="CND00610"
FT                   /product="protein-binding protein, putative"
FT   CDS_pept        join(172118..172156,172228..172275,172393..172494,
FT                   172561..173039,173120..173201)
FT                   /codon_start=1
FT                   /locus_tag="CND00610"
FT                   /product="protein-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43000"
FT                   /db_xref="GOA:Q5KJ55"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR032976"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KJ55"
FT                   /protein_id="AAW43000.1"
FT                   /translation="MPIRYISQKLAQQIDVELMSASGAFSLDQLMELAGLSCAQALAKS
FT                   FPPTKHKHVMVACGPGNQGGDGLVAARHLHHFSYTPTVYLPKPSSKDFLQRLVKQCENL
FT                   NIPILKDVDAFQTELAKSDVILDAIFGFSFQPPLRKPFDQVLKAIKGVSKKIPIVSVDI
FT                   PSGWSVTDGPQPLWTEEDDKGGKEMIETFEPEVLVSLTAPKEGVKAFKGQHWLGGRFVP
FT                   DELGKKHELNIPPYEGIDQVVELPRNH"
FT   gene            complement(173082..174898)
FT                   /locus_tag="CND00620"
FT   mRNA            complement(join(173082..173567,173678..173784,
FT                   173885..173953,174012..174053,174106..174515,
FT                   174574..174898))
FT                   /locus_tag="CND00620"
FT                   /product="glutathione transferase, putative"
FT   CDS_pept        complement(join(173501..173567,173678..173784,
FT                   173885..173953,174012..174053,174106..174515,
FT                   174574..174784))
FT                   /codon_start=1
FT                   /locus_tag="CND00620"
FT                   /product="glutathione transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42998"
FT                   /db_xref="GOA:Q5KJ54"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ54"
FT                   /protein_id="AAW42998.2"
FT                   /translation="MMSSADAPPCDALARRPPVTVESFAMTGWHGSVAACFNPFLHLPC
FT                   LIPLYSTMPHQITLHHLDLSRSDRIFWTLEELNLPYDVRVHFRLPTRSAPPSLHKVSPL
FT                   GRAPALILDDKLLTESAYIIHTLLSLPEVQQAAQKGEIDVQVENTNDDVFWSHFAEASM
FT                   MNLLQGMATVGATSQGWLSGKVPGLPEMSEDEKKGIQKYSSWLQDGYFRPNIQSTIDFA
FT                   ENFLAKQDAPFFSGTSKPGEGDFMMFFAINSFLGGSRADMGFKVGPNLKKWYDTVLSRP
FT                   AGKKALKRLKQEEESAKAKI"
FT   gene            175357..177535
FT                   /locus_tag="CND00630"
FT   mRNA            join(175357..175715,175779..175924,175984..177535)
FT                   /locus_tag="CND00630"
FT                   /product="expressed protein"
FT   CDS_pept        join(175422..175715,175779..175924,175984..177490)
FT                   /codon_start=1
FT                   /locus_tag="CND00630"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43057"
FT                   /db_xref="GOA:Q5KJ53"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ53"
FT                   /protein_id="AAW43057.1"
FT                   /translation="MLGRTSNTLRAVPRCAPQLGRTVAPAHAVSRPLLAFSFSTSRKID
FT                   HPHHAQIIPSLRNYATEASTVDTTIEPKVVQEDASQEEEATEDVLIPQLSSWTGLGVSL
FT                   PILKQLAKGFPHVQDPTPAQRLFLLAVLSGNEVYLRDAMGRGKTLALAIAALELALRPS
FT                   PRGKSKGNSPKVMILVPTPHLAHQIFSHLQTLSPYSSSSSSSPLFSLLSPKTLLAKGEK
FT                   SPAWALPDTPIIISTAKIAVQFNLDTPQLTHIFLDEPDTMVGSLPSRHATSRDLYRHPL
FT                   IRHPPPIVHAITQLLGITITRDGTLDFAKRRNGINTVWTSATMGREFKRFVKTRGWVRR
FT                   GNRVVDLDFSPSASDNKRLIRERLLQAIGVSPNDGPQLGKSAKGKGEKKGQEQKEPEHH
FT                   VILIDHETGDFAPLTPTSDLTGFTSQPKDQLASSSSSSQGYILETLALLHATSPPPPGK
FT                   YALALPPEGTSLDQLGEALASLGVSTSLLTPEVLRIGIPPVAEGVAPPILLAARSSVTG
FT                   LHLPQLQTVYMLGGLDVQGLSQAQRKNKGVGERMGFYDTVTGRLGRLGTDAVVDASVGE
FT                   GGEGETQKVVSLVLAGSEEHDKLAKMFFGDAKGNKEDGEIEVVKRKKLSEWDMESLNQI
FT                   LEQELQDERTSTN"
FT   gene            complement(177668..181956)
FT                   /locus_tag="CND00640"
FT   mRNA            complement(join(177668..178002,178060..178660,
FT                   178719..179016,179066..179095,179143..179286,
FT                   179358..179447,179508..179583,179642..179738,
FT                   179794..179854,179911..180081,180147..180318,
FT                   180379..181254,181300..181386,181438..181574,
FT                   181630..181749,181833..181844,181907..181956))
FT                   /locus_tag="CND00640"
FT                   /product="membrane protein, putative"
FT   CDS_pept        complement(join(177874..178002,178060..178660,
FT                   178719..179016,179066..179095,179143..179286,
FT                   179358..179447,179508..179583,179642..179738,
FT                   179794..179854,179911..180081,180147..180318,
FT                   180379..181254,181300..181386,181438..181574,
FT                   181630..181660))
FT                   /codon_start=1
FT                   /locus_tag="CND00640"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43081"
FT                   /db_xref="GOA:Q5KJ52"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR027815"
FT                   /db_xref="InterPro:IPR032880"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ52"
FT                   /protein_id="AAW43081.2"
FT                   /translation="MVYMGRTKLKDFSPISAHDPDAHYTPSTNRFFGWILPTLKTSEFT
FT                   VLQTVGLDAAVLLHFYRMCLSLFGVSALLALVVLIPLNLFRHGSTDSGAEQPGNNDTLA
FT                   WNGTSSFSPHQLFNTTSPHARSSLYDLLLDPTTSSTIHLIFTYLFTFLSLSFFHKNFHS
FT                   FVLSRQAFGLQLIHSISARTILVTKLPTHLRGDRALAEYFEACNFNVESVNICRDVEPL
FT                   QRGLEKRTLALTKMEEAWADWVGNPAKKGSGYDPHIYSGKSTPQGQHEGTREGMLVDVD
FT                   NSETNDTASLLSTAPQTYGTSEDTEANSHPHAHVHIQTTRPRPTFRPRWFGTKVDAIEH
FT                   WEKKFNAADEEVKEMRRTGRFGATHAAFVTFEDARDAQVACQVTHYPHHSQAVTTPAPE
FT                   PRDIVWQHVSMSIRESQIRDFIVMGIMGVLILTWIVPVSSLATLMSYEEIKKIMPWLAR
FT                   FIGSSPRLAAIVQNSLPSLALITFNGLLPFLLEWLSYMQAFKSRSATEYSLMKKYHLFL
FT                   LISVLLIFLLTSTYWALVRDLVDTPMKIPEKLARALQGSNVRNFMVSYVMLQALGLMPL
FT                   QLLNLGPLFSLALARAFWTKTPRDYAEANAPPMLNYGWVYPQALLVFTITLVYSVMSPL
FT                   ILIFGAIYFAMAYLVFKYKLLFIYFKPYESNGEAWRITFARTLWALIIFQLFMTGLFSL
FT                   RTYFWASAIMVPLIVYTLWKSWMMWQDFGPLSEYLAISSICEVQRGEGVHGILGVDSVS
FT                   RSQSMINHRRYAMNDETLYVAPSDSRTDYSQPPMNNFYYSVLNTGRRRYAHPALDGSLP
FT                   TPWLPAISKDDGEGHKGRGTKAVVLSLRRKVVKRLRGHRGDEGISGNGAASMEGSHETL
FT                   AIPESWTRGGSDTAHSPGASPSHAQQESYPSSSLSTNPWGDPSPTSSLPNTRSTPTLKK
FT                   SSYRAGTGPIALPEEGNVWEDDEPESPSTYFHNRERGRASSNIDQSAIGVSEVGQGSSA
FT                   PVPPGVGGAL"
FT   gene            183583..184461
FT                   /locus_tag="CND00650"
FT   mRNA            join(183583..183814,183866..184035,184089..184461)
FT                   /locus_tag="CND00650"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(183659..183814,183866..184035,184089..184356)
FT                   /codon_start=1
FT                   /locus_tag="CND00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ51"
FT                   /protein_id="AAW42996.2"
FT                   /translation="MRFTSIIVAALPLVGSVFAAPFAEKDSIASSPDLVKKEVNVLSVV
FT                   NEVQSRVNAAAAMPRQSQADVEACLNTVIDAFNWCGGQLGIDVSASASANAGASIHYLR
FT                   REIIARDDDKEAVAQALSSVVQTVNVGIVQQIPSQFINIPGVSNLVNQLDIALSLILKG
FT                   VDAILAGVLYLVKALLIDVGIILDSLLGGLLSIL"
FT   gene            184866..186563
FT                   /locus_tag="CND00660"
FT   mRNA            join(184866..184957,184996..185511,185559..185870,
FT                   185917..186563)
FT                   /locus_tag="CND00660"
FT                   /product="glycolipid mannosyltransferase, putative"
FT   CDS_pept        join(184909..184957,184996..185511,185559..185870,
FT                   185917..186545)
FT                   /codon_start=1
FT                   /locus_tag="CND00660"
FT                   /product="glycolipid mannosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42995"
FT                   /db_xref="GOA:Q5KJ50"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR027054"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ50"
FT                   /protein_id="AAW42995.1"
FT                   /translation="MSRPLRIGFIHPDLGIGGAERLVVDAALSLKNKGHHVTIFTSRHD
FT                   PSRCFPETIDGTLPVHVLGSSLPRSLHPKFPFTILFSILRSLLLAVLLLTSLLLPGPPS
FT                   IANPLSPLQGFDIFFVDQQSVAVPLLRFVSGTRIVFYCHFPDKLLSGGWEIDVGKDKAV
FT                   VERKGVGILKRMYRWPIDKLEEYTTGQSDIIISNSEFSSRVFALAFPSLAQKPRRVVYP
FT                   CIDLSSYTSTSSDVKDGSVNLIQSDRPTIISFNRFEAKKNVDLAIRTFAKLRDDDLISK
FT                   EEFRNLRFVVGGGYDPDQRDNAQTLLHLQNLCTNLSLSHHTIPSSSPISPNTQIIFLLN
FT                   FSSAQRAHLLTSPSTLALLYTPTNEHFGIVPIEAGACGLPVLACDTGGPVETVVDFSIP
FT                   SNAENGTGLLRPPRAEEWAPALTTLLHLSSSQRSIISQSAQTRIAENFSLATMGTQLEK
FT                   ACRDALAMGDLHVQVGDKLIWGGLGLMGFAAGGLGVIWMVWGV"
FT   gene            complement(186554..188275)
FT                   /locus_tag="CND00670"
FT   mRNA            complement(join(186554..187033,187078..187150,
FT                   187200..187718,187761..187932,187981..188040,
FT                   188080..188275))
FT                   /locus_tag="CND00670"
FT                   /product="guanyl nucleotide binding protein, putative"
FT   CDS_pept        complement(join(186777..187033,187078..187150,
FT                   187200..187718,187761..187932,187981..188040,
FT                   188080..188240))
FT                   /codon_start=1
FT                   /locus_tag="CND00670"
FT                   /product="guanyl nucleotide binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43078"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ49"
FT                   /protein_id="AAW43078.1"
FT                   /translation="MEEQHHGQEQDQNQQQQAYAPPEYSFDNASLYASINAASLSSPLE
FT                   NNFWRSARWSPDGSAVLTTTEDRSFRIHTLSETSLGTFDTHQFKQPDSITSSIWFPTAS
FT                   SLVPESFCFVAGIRDNPVKLIDAKTGNVRASYPIIDHRERFISPYSLAFHPSLSKLYCG
FT                   CSSFIEIIDLTSSSSTRLKTTFTRSSKDGQKGIISALAFAPDTTGSFVAGGYDGSVGMY
FT                   TEDGDLEGWLGGLEVGGVTQLSYHPLNPTLLFVASRRSDVIQVYDIRNPSQPLHSLPRK
FT                   GRTNQRLWFDIDVWGRWLASGDEEGLVKVWDIISPEVPVVFEEKLHNDAVSSVQLHPYY
FT                   PLLLTSSGSRNMTASGSTLDNESNEGSQSDSDSDSDDSGSGLENEGSGGMTTPISNIKD
FT                   STMKIWSFLPPASS"
FT   gene            188352..193774
FT                   /locus_tag="CND00680"
FT   mRNA            join(188352..188559,188616..188667,188726..189403,
FT                   189455..189652,189709..189802,189868..189994,
FT                   190061..190624,190696..190788,190842..190949,
FT                   191001..191750,191798..191939,191992..192090,
FT                   192148..193774)
FT                   /locus_tag="CND00680"
FT                   /product="peptidase, putative"
FT   CDS_pept        join(188381..188559,188616..188667,188726..189403,
FT                   189455..189652,189709..189802,189868..189994,
FT                   190061..190624,190696..190788,190842..190949,
FT                   191001..191750,191798..191939,191992..192090,
FT                   192148..193677)
FT                   /codon_start=1
FT                   /locus_tag="CND00680"
FT                   /product="peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42994"
FT                   /db_xref="GOA:Q5KJ48"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ48"
FT                   /protein_id="AAW42994.2"
FT                   /translation="MEQLEVHDDIFAAYHIPKISTPSTSSSSTVSSTRAQRGKGKQRAA
FT                   SSEVEEETHVATPEEEARGSSGRKKMAGQNRQEAGMTRARARMTNVVNGYSPYGASQRK
FT                   GAALGRASLAKAVPQSEFYSNPKASGSRELNTPTQQNTRASTSNTRSLSRNQLLANARG
FT                   THSAGLHDDSDDAEGSPVRRAYKPDETEDDVPVLVELPNKEPSSAQPTRRTGGEQGTNS
FT                   NPFKGKGKAADVFGNHRDARHPQPSRAAKNDDEVEYMPHGEVKITKEMRVAELDMLTKQ
FT                   VTPRFGQRQRRPMNNKDGNQVKISNRAPTQVLKSPGDSVPLNFNLAWISPNTILRCTGI
FT                   TFDGKELRLACEGGGSSWKIDFKKMISIQLCTSQEHPFICFEVNPNDTDRDSFSNLLDG
FT                   KKLNFEGTVQLCIKPSKSLQTAQRLDTFLSRLRSQAVGRVDELDQASCKLLSESCNSQV
FT                   LDTRARHEAQRRVKAAEAAEKRIASRASSPIDSWPYGIDDKKEEKEKKPAAKGGRGKKK
FT                   EEQGDRNQSKLNLYVFFSCQTARRVLTILCSAPQPVVPVRRSSRRSTNKLIEEISSDDE
FT                   RPVHVSKEPPPANKNELYFCYPPTEKAAVSITQGDKYRVKVGEFLNDTLLEFGLRHVLS
FT                   QVTDARREETHVFNSFFYGKLSNKSKGNKPTSEGWPAYNSVQRWTRNKNVFDKRFIIVP
FT                   INEHFHWYLAVIINPRGILRPRAPEPALEISRPNTRATAGTMVGGSPGHHYSELMEDPK
FT                   IEAGPELSAEAQAHKDASLEKEKGTPGLPSAQSNQSPKRSLAQSLTPPKTRKSPFFQSS
FT                   PLTPAPEDGDGEFPHPGDQSVDPLDVMSQQTDTERDEDIEMKDVRNGVQEIDLDGPPNS
FT                   KNEKDGSGDEGTGGFIVTPTLLAMQQQQNQVEKGAKLPMVTTVVDDDEEGAKAKAKNSA
FT                   SAKKGKSKGQDANFEDGRTWIITFDSLGGAHRAVGTNLSRWLQYEAKNKLNIDYEPEDA
FT                   QYWHGKVPQQGNFYDCGLFVVHYAKQLLQRPEEVLSFVQRRQPPEWSPEVGEWRADLDR
FT                   FWQASETKNLRISWVVTMDDLASEWGKIEKERPKAADDAEGEGDASQVEEVTKEEREAE
FT                   ARMEKEVEQELKRRQEEIDKGEGGKGEGERDGEGDETREGSEATEKDMEKEQPPDENAE
FT                   DPELPLHPDFDPSLDLQLDPEFDHSENSTSTPVTSQTKQISASARLEPASPDSSVVSDA
FT                   YAEKGTSTVADADTAMESQQDDAAINWESPIPIKPALDFFDRDQATAEVEQESKMNGEV
FT                   AMLIDDGDLVPSSPLPSQSLRTHISPSHGTHLRFEEEDEPESEMPGNEVKKEKASVLVK
FT                   SLRQQKEEEEEKEEEEEVKNTVRPLPRSSRFFAPSNDSTPHITKPPFRSSAAKKPRHHA
FT                   DRASSPIDDGPFAGLSESAPNASSRSRSGSIHRSASVSRKASDTTRDDGEDRVNEADED
FT                   RLEGERESTASRVSSPKKLAPASTYAPTSARKAPKRVAGRNDAETRANKRTKGGSKGKG
FT                   RPSTGASRDEAIELDSD"
FT   gene            complement(193731..194715)
FT                   /locus_tag="CND00690"
FT   mRNA            complement(join(193731..193971,194030..194090,
FT                   194141..194259,194310..194486,194553..194715))
FT                   /locus_tag="CND00690"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(193865..193971,194030..194090,
FT                   194141..194259,194310..194486,194553..194667))
FT                   /codon_start=1
FT                   /locus_tag="CND00690"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43059"
FT                   /db_xref="InterPro:IPR019171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ47"
FT                   /protein_id="AAW43059.1"
FT                   /translation="MPAPPFGTASAYTDSFPAPPPKQVTVTAETCYNLGVFRDIVRQYR
FT                   KLDDQIIIRLNRAQAELRDHTRTSTGGSWIGGGVKSMDGAEGMCVKIWSEMMAGWAHRQ
FT                   TLLTFCSQTVQSSVEGKRNEGGHVRGIKEEEVLADQLASEESIEAIIRKRTLEAFKSRC
FT                   PFFTPSDTTSKAWFNLADRGLKGHGPDLP"
FT   gene            194871..197324
FT                   /locus_tag="CND00700"
FT   mRNA            join(194871..194923,195164..195185,195593..195681,
FT                   195738..195914,195971..196291,196347..197022,
FT                   197081..197324)
FT                   /locus_tag="CND00700"
FT                   /product="argininosuccinate synthase, putative"
FT   CDS_pept        join(195624..195681,195738..195914,195971..196291,
FT                   196347..197022,197081..197138)
FT                   /codon_start=1
FT                   /locus_tag="CND00700"
FT                   /product="argininosuccinate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43079"
FT                   /db_xref="GOA:Q5KJ46"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ46"
FT                   /protein_id="AAW43079.1"
FT                   /translation="MVATGEKKGKVILAYSGGLDTSCILLWLIEQGYEVVAYMADVGQE
FT                   EDFEAARAKAMQCGAVGFHLADLKREFVEELIYPAVQCNAIYENVYLLGTSLARPVIAR
FT                   GMIEAAVKEGCDFVSHGCTGKGNDQVRFELAFYGLAPNIKVIAPWRLPEFYERFDGRSA
FT                   LLEYAAKNGIPVTQTAAKPWSTDENLFHISYEAGILEDPNQTPPDDMWKLTVSPEKAPD
FT                   APERVHIEFAKGLPVKVTFPADGNTVTDSVEIFLTLNALARRHGVGRIDIVENRFIGVK
FT                   SRGCYESPAATILRAAHMDLEGLTLDRNVRALRDQFVTTQLSQILYNGFFFSPEREFIT
FT                   AAIPASQKTVNGVVRLKLYKGNVVVEGRDADEGLYDAKFTSMDEMGGFEPTATSGFIEI
FT                   SSIRIKAWGRANIKRGQDGVSPKDVYHREN"
FT   gene            197432..198591
FT                   /locus_tag="CND00710"
FT   mRNA            join(197432..197558,197682..197879,198104..198178,
FT                   198437..198591)
FT                   /locus_tag="CND00710"
FT                   /product="protein transporter, putative"
FT   CDS_pept        join(197492..197558,197682..197879,198104..198178,
FT                   198437..198546)
FT                   /codon_start=1
FT                   /locus_tag="CND00710"
FT                   /product="protein transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43080"
FT                   /db_xref="GOA:Q5KJ45"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ45"
FT                   /protein_id="AAW43080.2"
FT                   /translation="MTIHALWIISKAGGLVFSRSYSDALPQLPVNTILTLAGILHGIHA
FT                   ITARLTPSPAASSQNQSQGPGSTGGLESFEAEGWGGKVFLTPTGTKFVLLHSLPQAGLD
FT                   DLLKRIYEIYADTVMKNPFHTLEMPINSALFDEKLGVLMGGVNVS"
FT   gene            complement(198733..199811)
FT                   /locus_tag="CND00720"
FT   mRNA            complement(join(198733..199055,199113..199251,
FT                   199319..199811))
FT                   /locus_tag="CND00720"
FT                   /product="conserved protein"
FT   CDS_pept        complement(join(198908..199055,199113..199251,
FT                   199319..199757))
FT                   /codon_start=1
FT                   /locus_tag="CND00720"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42993"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ44"
FT                   /protein_id="AAW42993.1"
FT                   /translation="MTLTFTIFGGGGKVAKHFTKLAVTAGHKVHSVIKDDGHASELDSL
FT                   GATTHILSLHAATPSTISSLFRQTKPDVVLFSAGAGGKPPGADEIDHKGAVKVFDAMEQ
FT                   AGVKRLVLVGALDVRSRDKGWPEWYNEEDKKASDKVWGSIGSYMQAKLDAELNLHTRSK
FT                   IEYTVIRPGTLTTEPAGGAVMGRTHLAHTSRELVAQTALAIATNPSTIGFTIDVMDGDA
FT                   KIEDELEKVVKEKLDAWTG"
FT   gene            199961..200792
FT                   /locus_tag="CND00730"
FT   mRNA            join(199961..200013,200083..200792)
FT                   /locus_tag="CND00730"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(199983..200013,200083..200720)
FT                   /codon_start=1
FT                   /locus_tag="CND00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43086"
FT                   /db_xref="GOA:Q5KJ43"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ43"
FT                   /protein_id="AAW43086.2"
FT                   /translation="MSDTKTSSLSGYAIWLMPSANEKLHYQHLINRLSKLYNETICQKD
FT                   EDEGRTRGSASPSFEPHITLFAFIPLDTPVGEISNTLRQVVARVTGSGLSSLGGGGHFA
FT                   LGLLPAQSGRSYFQSVLAPVQPTAELLSLYDQTVAAFPPASPSSSPDEKKKKKGGYFPH
FT                   LSLFYGDCSLAKRDEIAAIANGEDPCLGSGQATVTINELGIVKCAGEVEEWQLVESIVL
FT                   "
FT   gene            200854..202625
FT                   /locus_tag="CND00740"
FT   mRNA            join(200854..201131,201173..201470,201523..201576,
FT                   201620..202375,202443..202625)
FT                   /locus_tag="CND00740"
FT                   /product="allantoinase, putative"
FT   CDS_pept        join(200938..201131,201173..201470,201523..201576,
FT                   201620..202375,202443..202586)
FT                   /codon_start=1
FT                   /locus_tag="CND00740"
FT                   /product="allantoinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43087"
FT                   /db_xref="GOA:Q5KJ42"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ42"
FT                   /protein_id="AAW43087.1"
FT                   /translation="MPSQTILAPQAILPGDLCPQPATIVFDTDSGTITSVTLGIHQPEH
FT                   GKADVWEIEDGKILLPGLIDTHVHLNQPGRTAWEGFRTGTLAAISGGITTLIDMPLNSI
FT                   PPTTTLSALATKQACAKEVGVSCDVGFWGGIVPGNEGELRGLWEAGVKGFKCFLIESGV
FT                   EEFPCVGEQDIIKACDALKGTNALIMFHAELDAPSSDAGHATGHADPSEYSTFLQSRPQ
FT                   QWEISALQLILRIARSYPDLRFHIVHLSASDAIPILQSALGTGKGKGKDTGAGTGKDTG
FT                   KDTDTENPTLENLTVETCFHYLCLCDTDIPPNGTQFKCCPPIRDESNRVKLIEALLDGT
FT                   IHYVVSDHSPCVPELKKGDFMSAWGGVSGLGLGLSLLWTELGAGGRVELGRIVEWMGPV
FT                   QARQVGLQGKKGVIQTGAAADFVVFDPDATFEVTLETLRFKNKVSPYIGKRLTGRVEKT
FT                   YLGGALVWEHGAGAGDAARGGFV"
FT   gene            202694..204456
FT                   /locus_tag="CND00750"
FT   mRNA            join(202694..202806,202856..202957,203002..203075,
FT                   203120..203601,203650..203836,203880..203948,
FT                   203999..204056,204111..204456)
FT                   /locus_tag="CND00750"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(202727..202806,202856..202957,203002..203075,
FT                   203120..203601,203650..203836,203880..203948,
FT                   203999..204056,204111..204225)
FT                   /codon_start=1
FT                   /locus_tag="CND00750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43089"
FT                   /db_xref="GOA:Q5KJ40"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ40"
FT                   /protein_id="AAW43089.1"
FT                   /translation="MSAPVDLKKPQEPQTETQAQKGLSDDALTKYTSAGQALADVLKKL
FT                   VPQIAPGKKVLDLCIEGDKLVADAVAPLWNKPKNGVKVGKGSAFPTSVSVNNVVSHVSP
FT                   LPSDPEIELKDGDVVKIMLGIHLDGYPVTHAETIHLSAKTDGLAADVIRAAYDAAQLAM
FT                   RTLKAGAKNWDVTDVVDRATKSYDCVPVEGMLSCQHEKNVTDGKKRVLLNPSPELRRDH
FT                   ETATFEEGEVYGVDVLVVTGTNGKAKADPSRTSIYKRGDTNYQLKMKTSRAVFSEIQKK
FT                   AGAFPFTLRALDDEKRARMGVQEAVSHGLLKPYDIVQTAPGTLVAEFFFTIALLPGGPL
FT                   LLSPTPAWYSPDKVSSSKSLQDEELKNLIAQPLRAPKKKKKAAKEAEA"
FT   gene            204728..207097
FT                   /locus_tag="CND00760"
FT   mRNA            join(204728..205079,205161..205242,205328..205422,
FT                   205486..205507,205559..205690,205752..205809,
FT                   205905..206175,206305..206354,206414..206446,
FT                   206501..206839,206899..207097)
FT                   /locus_tag="CND00760"
FT                   /product="lipid particle protein, putative"
FT   CDS_pept        join(204744..205079,205161..205242,205328..205422,
FT                   205486..205507,205559..205690,205752..205809,
FT                   205905..206175,206305..206354,206414..206446,
FT                   206501..206839,206899..206992)
FT                   /codon_start=1
FT                   /locus_tag="CND00760"
FT                   /product="lipid particle protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43063"
FT                   /db_xref="GOA:Q5KJ38"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ38"
FT                   /protein_id="AAW43063.2"
FT                   /translation="MPSRANVHLVLLIHGLWGCPAHLSVAKEELEAAWVASHSASHSAA
FT                   STPRTPRTHAQVSGPAEDPVITKTLQVPTHHAEGEEQEELVIMIAGGMTSQLTYDGIDV
FT                   CASRVAWEVDEKVRELESQHKQVVKFSVTGYSLGGLVARYLLGLLHSRSPSFFDTHKPI
FT                   SFSTLSSPHYGIPRYNTLLSTTLCWLGARIMSRSGEQLYVVDKYSEDDPRPLLEIMADP
FT                   RSVFYHALEKFERLSLFAAAINDNSVPFPTAAIETVDHFAQWQDQGLVVDCDEAGMIRS
FT                   WSRGEVEDDEVDGKVNGKGNEKGRKRPVKKSLGTYIGTLPPVLRYRFPFNYLIILLFPI
FT                   MLPIVLCLILARQSLDTSRSKRRLQQLAQTSSSSSTPQTTAPIASSASGLSIQHLRDTI
FT                   RRIERNIESEFIENADGPSLDIYNKTTPLQQVVVKVQLKDSQLRMALWLNQLPFKKYFT
FT                   WWPEITNAHATAIVRDAHLFPQHERGRGMLKFWAKVMLGQATDVS"
FT   gene            complement(206980..209055)
FT                   /locus_tag="CND00770"
FT   mRNA            complement(join(206980..207171,207225..207296,
FT                   207349..207376,207448..207873,207912..208501,
FT                   208553..209055))
FT                   /locus_tag="CND00770"
FT                   /product="expressed protein"
FT   mRNA            complement(join(206980..207171,207225..207296,
FT                   207349..207376,207448..207873,207912..209055))
FT                   /locus_tag="CND00770"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(207131..207171,207225..207296,
FT                   207349..207376,207448..207873,207912..208501,
FT                   208553..208961))
FT                   /codon_start=1
FT                   /locus_tag="CND00770"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43067"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ37"
FT                   /protein_id="AAW43067.1"
FT                   /translation="MIKLKEVEKNKSAHSKLIKPPPSCNLDHATDEPKTAKKGIDNIVE
FT                   DNKYPKERKDRVVAQILRAFSLSKIKPTAKKKPGPGGEIMRNQSDFKVNTKLDKVARKM
FT                   ETLNRRTATESSFELVEKEEETEEPEPVARIKVPHALSRHRFGCYAQTSLPVNRTPEPQ
FT                   LPNVSTKVVQEQCSEETERQKSISKQRAKISTSSVQAAQLSKDVIYPSPSSTDTFETSD
FT                   TTCSPENKPPMPPFPTQRVISHHLKRPSQSPFGPRATFSTSTPMTRRVRSASNLLFKRS
FT                   PSKISIVTRKPVPVYIDVPLSLDDGHISGVSIFTRDIVQTPLEKTSSAGPHKNQLLATP
FT                   PTPKFNILTDVFFSEQSPTKRGSLFIVNNSFDSYEQYQNTLFEDVLKTWGLPLDVIHPK
FT                   EVELYKKDIAAVHSKETVDKNVPPVQTQKRTPRTVAFSKPVKTNPGVKKFISMDERRLR
FT                   KPVGRVKDIVEIFEDRSVDRTMTPIRELGRILQRPSSVSSDNLAAESRQMMEGARKKVR
FT                   GVVV"
FT   CDS_pept        complement(join(207131..207171,207225..207296,
FT                   207349..207376,207448..207873,207912..208520))
FT                   /codon_start=1
FT                   /locus_tag="CND00770"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ36"
FT                   /protein_id="AAW43066.1"
FT                   /translation="MITHTTVPHALSRHRFGCYAQTSLPVNRTPEPQLPNVSTKVVQEQ
FT                   CSEETERQKSISKQRAKISTSSVQAAQLSKDVIYPSPSSTDTFETSDTTCSPENKPPMP
FT                   PFPTQRVISHHLKRPSQSPFGPRATFSTSTPMTRRVRSASNLLFKRSPSKISIVTRKPV
FT                   PVYIDVPLSLDDGHISGVSIFTRDIVQTPLEKTSSAGPHKNQLLATPPTPKFNILTDVF
FT                   FSEQSPTKRGSLFIVNNSFDSYEQYQNTLFEDVLKTWGLPLDVIHPKEVELYKKDIAAV
FT                   HSKETVDKNVPPVQTQKRTPRTVAFSKPVKTNPGVKKFISMDERRLRKPVGRVKDIVEI
FT                   FEDRSVDRTMTPIRELGRILQRPSSVSSDNLAAESRQMMEGARKKVRGVVV"
FT   gene            209389..210646
FT                   /locus_tag="CND00780"
FT   mRNA            join(209389..209753,209812..210233,210283..210368,
FT                   210426..210646)
FT                   /locus_tag="CND00780"
FT                   /product="expressed protein"
FT   CDS_pept        join(209447..209753,209812..210233,210283..210368,
FT                   210426..210606)
FT                   /codon_start=1
FT                   /locus_tag="CND00780"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42992"
FT                   /db_xref="GOA:Q5KJ35"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ35"
FT                   /protein_id="AAW42992.2"
FT                   /translation="MLSFGVTVRPLAVTSRLHSPTVHMWRRNAHTAAMSDDSLDQGSSS
FT                   SYGGSASQGHPGKGKGRQDPLAQSYRFPEKGRNGGPPDPFEVMALDRSATQQEVKQQYY
FT                   KLALLLHPDSSHPSSSPDHFATLNKAYNLLSKQSSRSAFLKTGYGWDVSTSSGGTQTWS
FT                   DSLMRAEIARRRNGGAAAWSGASRRYRDSDAGRGAWGGFDGSQGWRPYEDPSKGFSPPT
FT                   SGPAEERYMSNPRFLAVVGVASAVIAWVHWHRLGYATETHRDMLDKQNIDASRALAQAR
FT                   YEAATHGRVRREQIRRRVREAEVLKELEKAEQGHIAVAGPPTAYPPSNRE"
FT   gene            complement(210628..212966)
FT                   /locus_tag="CND00790"
FT   mRNA            complement(join(210628..210749,210787..210823,
FT                   210862..210934,210983..211103,211154..211235,
FT                   211275..211354,211434..211447,211488..211812,
FT                   211857..211881,211952..211979,212034..212134,
FT                   212176..212219,212276..212424,212515..212966))
FT                   /locus_tag="CND00790"
FT                   /product="glucan 1,3-beta-glucosidase, putative"
FT   CDS_pept        complement(join(210641..210749,210787..210823,
FT                   210862..210934,210983..211103,211154..211235,
FT                   211275..211354,211434..211447,211488..211812,
FT                   211857..211881,211952..211979,212034..212134,
FT                   212176..212219,212276..212424,212515..212715))
FT                   /codon_start=1
FT                   /locus_tag="CND00790"
FT                   /product="glucan 1,3-beta-glucosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43031"
FT                   /db_xref="GOA:Q5KJ34"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ34"
FT                   /protein_id="AAW43031.2"
FT                   /translation="MVKLSPCPIILLSHFLIPAIASPVRPLAPLGNDGSVILNKRTTLA
FT                   PGFTWGLDPMRGVNIGGWLVLEPWITPSIFEGKPDWVVDEWTYGVYMNNQSDTMDEITN
FT                   HWNTWFSYTELHNIAAVGLNTIRIQIGFWSVIPLENGEPYLVGAYDYLKLAVTWASSLN
FT                   LKVMVDVHGCPGGQNGFDNSGIRGVREWFTNDTNISRTLSTLQVLTAEFSQSFYNNTVI
FT                   AIELVNEPFPYSTSELNILKSYYQAGYRTVRSNDGASKVVVAIDEGFQGLQTWEAFMQE
FT                   SSYNNVAMDTHIYTILDWYCGQQDYLVASNNVHWTIVGEFVPANTDCAYWLNGRGVGSR
FT                   YDNTLNTSAALQYPGNCDGKTGADPSKFSAEYVEYLAKSFETQTWVYEQASGWVMWTWK
FT                   TEQAADWSMQTGMTYGWIPTPIYSKPHGTPCASNTSAKATSGETRYRVDWWLVLVPWVV
FT                   LLLH"
FT   gene            complement(213354..217000)
FT                   /locus_tag="CND00800"
FT   mRNA            complement(join(213354..213642,213706..213995,
FT                   214049..214195,214244..214637,214703..214809,
FT                   214890..215068,215129..215619,215676..216571,
FT                   216618..216793,216834..217000))
FT                   /locus_tag="CND00800"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(213429..213642,213706..213995,
FT                   214049..214195,214244..214637,214703..214809,
FT                   214890..215068,215129..215619,215676..216571,
FT                   216618..216793,216834..216948))
FT                   /codon_start=1
FT                   /locus_tag="CND00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43355"
FT                   /db_xref="GOA:Q5KJ33"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033770"
FT                   /db_xref="InterPro:IPR033771"
FT                   /db_xref="InterPro:IPR041505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ33"
FT                   /protein_id="AAW43355.1"
FT                   /translation="MAAVKSHPPITILKRTREDQHLSQNKFLKKTARGKVINIFRERYV
FT                   RDDIPCGYQDCHQCAQFPGYKPVLPRTGYLQHTKFAGNGHYLVIDTNIVLHQMDLLQSL
FT                   PAQLPLIIPSTTIRETRHRSLPLYNRLQQLIQDEDRLIWVWWNEERRETATVREVDEEH
FT                   GREKINDRNDRAIRQTVLFYAEHLSRLASNAPSLILLTDDAANRGLAAEQGIVAVSARE
FT                   YVDGLEPAEREKLVDLVVGGVDEIEVVERRSRRIYPDYLPQDTLLAGVKTGRYHQGHFN
FT                   ANQYNYLEGTVNVPGLVRPVLLVGRQAMNRSVNGDVVVVEIFPETEWKAPREEVVDQDI
FT                   ALRDDDVEDDESGGVADKEFVKEKQERLETDDAKKNKKEILPTGRVVGIVKRNWRAYVC
FT                   HLDRSSLSDSAFTSLAQQTVFATPLSRALPRIRLRTRQAPQLVDQKILVTIDNWSPTSR
FT                   YPDGHFVRALGKVASKEAEQESLLLEYEVPYRPFGKAILNCLPAEGDNWVVPKKDMECL
FT                   EWRDREDLRDLDICSIDPPGCQDIDDALHARRLPNGNIEAGVHIADVSHFVHPDNPMDS
FT                   EAASRGTTVYLVDKRIDMLPSLLGTNLCSLRPFVERLAFSVIWELNQDAEVVDVRFVKS
FT                   VISSKEAFTYEAAQLRKDDKSMNDPLTNSIRLLNHLAIKLKDARMRAGALSLSSPELKI
FT                   HLASSESAEPINVEQKKLLETNSLVEEFMLLANIWVAKKIQEVFPATAVLRRHSPPPKT
FT                   NFEVLQDILMKRKGITLDVSTSKALADSLDACVIAGEPEFNTLVRIMATRCMLSAEYFC
FT                   SGSVSKESYGHYGLASPIYTHFTSPIRRYADVLAHRQLAAAINYTPLHPSLQSKSHVER
FT                   ILSTVNKRHRLAQMAGRASVEFYVSLTLKGKGTGEEIGVRRKEEAWVVRTFKNGLAVFV
FT                   PKLGLEGLVTFHKELHTYDAENYTISVPSPSGEVVVAVFDKIMVDISIEKDENTQRGKV
FT                   KMIMVEPVDSDTL"
FT   gene            228723..229800
FT                   /pseudo
FT                   /locus_tag="CND00830"
FT   gene            260738..262233
FT                   /pseudo
FT                   /locus_tag="CND00840"
FT   gene            274742..276722
FT                   /locus_tag="CND00870"
FT   mRNA            join(274742..275051,275108..275205,275293..275562,
FT                   275636..275817,275921..276157,276249..276440,
FT                   276514..276722)
FT                   /locus_tag="CND00870"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(274742..275051,275108..275205,275293..275562,
FT                   275636..275817,275921..276157,276249..276440,
FT                   276514..276694)
FT                   /codon_start=1
FT                   /locus_tag="CND00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ28"
FT                   /protein_id="AAW43021.1"
FT                   /translation="MPPRRYPLNTSASKNSQAALTQRSLIDPHLEPQEGNQSQTHISSK
FT                   YSKTLQSRTHAKKSLQQASSARPRGAGEAVGHDKCFGDEDSDSLDGIGEESGTDAEEQE
FT                   LNGIESDDLESADDAESQRPHKALKANHRLSVFPQIRTTAEVINNNGRHSPRDGRRPGD
FT                   RLNRPVTVVRRNGVQCPSNPTAERASNASQQTSQETHSTGSRGISRGNSSSASAVPIHD
FT                   STNTPLQNMEQTSSREIGQPSQITRDSVTDRSRFSPWPTTHICKDLPESPIDTNIEEIY
FT                   SILKAKQEYKSPFKTVLDRCCRLVARYYSIHTSSYTGGILCSLRYKHYLNSSILEMEEG
FT                   EISPDIWFTNTTGDDILEKYAQFLDIEPAMLMMYYNDALSLAAQVLAPLRALPRLCWLI
FT                   MSLLMKSKAFYLPLLGTKLMITLSMAPWLAISTTMPLTPSICIYRTYGRASHRSSHQPT
FT                   YMMKKMWFFDSTIIAMTRKRMVASKLRSPLA"
FT   gene            276898..277542
FT                   /locus_tag="CND00880"
FT   mRNA            join(276898..276951,277005..277136,277201..277340,
FT                   277407..277542)
FT                   /locus_tag="CND00880"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(277119..277136,277201..277340,277407..277506)
FT                   /codon_start=1
FT                   /locus_tag="CND00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43375"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ27"
FT                   /protein_id="AAW43375.1"
FT                   /translation="MYAASLVHFVLSVAPKIDNVDIAIHDTIYHSGIFFFRSLEEVEQQ
FT                   AIIDFYDGHARDDRGEGDGRISSMWQDLWRWRRSQQRRGE"
FT   gene            complement(278992..283664)
FT                   /locus_tag="CND00900"
FT   mRNA            complement(join(278992..279151,279205..279365,
FT                   279417..279536,279594..279668,279720..279758,
FT                   279818..279920,279983..280492,280538..281061,
FT                   281115..281238,281287..281529,281584..281911,
FT                   281965..282125,282174..282372,282422..282578,
FT                   282632..283283,283333..283664))
FT                   /locus_tag="CND00900"
FT                   /product="pre-mRNA splicing factor, putative"
FT   CDS_pept        complement(join(279101..279151,279205..279365,
FT                   279417..279536,279594..279668,279720..279758,
FT                   279818..279920,279983..280492,280538..281061,
FT                   281115..281238,281287..281529,281584..281911,
FT                   281965..282125,282174..282372,282422..282578,
FT                   282632..283283,283333..283455))
FT                   /codon_start=1
FT                   /locus_tag="CND00900"
FT                   /product="pre-mRNA splicing factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43017"
FT                   /db_xref="GOA:Q5KJ25"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ25"
FT                   /protein_id="AAW43017.1"
FT                   /translation="MMSTDKELYKLELLSLVSKVSQELFNHTKLQDKKLAEFVIALHEQ
FT                   SKTTEAFQKKLNEIGADFPEWFVKNLDRLIVTMHPKYKRKAAKMKASKQSGKSDDGQSV
FT                   MEEQKQLQARKFPGLSMPDQDWKPAEKYVDERAAKEPHETLPESLSTSDTMAQLESIAS
FT                   RRNRPAAEDFLDGEPAAKKLRSATSSGHDGSSGRRGGYEGGSFRDSFRHGRPTVDERPV
FT                   LYKIYNGTIANITDFGAFVTLDGVERKIDGNQRSNEGLIHVSNITNGRVNSPRDFLKRG
FT                   QRVKVKVMAVSPKIGLSMKDVDQNTGDDLSPHLTVKTAEEAAVQQQRMSSYAASGSNST
FT                   PLLAVDERQRSSAKRLSSPERFEIKQLIASGAVSAADYPDLDEDFSTNVANHEIEEDID
FT                   VEVNEVEPAFLSGQTKVTLELSPVKIIKAPDGSLNRSALAGASLAKERRDLKRLEANEQ
FT                   ADAETREINQPWLDPMANQNERQFASDIKGNLLGQKAAQMPAWKAANKVVSYGKITSMS
FT                   IQEQRRSLPIYKLREQLVAAIRDNQILVVVGDTGSGKTTQMAQYLAEEGFLEKGRLGCT
FT                   QPRKVAAVSVAKRVAEEVGCRLGAEVGYTIRFEDMTSPETKIKYMTDGMLLRELLVDPD
FT                   CSKYSVIMLDEAHERTIATDVLFGLLKKACKRRPDLKLICTSATLDAAKFATYFWGCPI
FT                   FTIPGRTYPVETLYTKEPEPDYLEASLITILQIHLMEPAGDVLLFLTGQEEIDTACEVL
FT                   YERVKALGPQVPELLILPVYAALPSEMQSRIFEPAPPGARKVVIATNIAETSITIDGIY
FT                   YVIDPGFAKQNAYDPKLGMDSLIVTPISQAQARQRAGRAGRTGPGKCYRLYTEVAYRNE
FT                   MLPNPIPEIQRTNLASTILTLKAMGINDLISFDFMDPPPAATMLTALEQLYALGALDDE
FT                   GLLTRIGRKMADFPLDPPLSKMLIKSVDYGCSEEALTIVAMLQAGGQVYYRPKDKQTQA
FT                   DAKKAKFHQPEGDLLTLLAVYNGWKNSKFSNPWCFENFIQTRAMKTAQDVRKQLIGIMD
FT                   RYKHDLVSCGTNYNRVRMAICSGFFRNAAKKDPTEGYKTLVEGTPVSIHPSSALFQRPP
FT                   EWCVYYELVLTAKEYMHQVTVIEPKWLSEVAPTFFRIADQNKISKRKASEKIEPLFDRF
FT                   AADKDDWRLSKQKKAARSSQTFG"
FT   gene            283840..285724
FT                   /locus_tag="CND00910"
FT   mRNA            join(283840..283861,283945..284183,284282..284303,
FT                   284368..284502,284567..284673,284736..284855,
FT                   284917..284990,285052..285165,285215..285273,
FT                   285324..285724)
FT                   /locus_tag="CND00910"
FT                   /product="expressed protein"
FT   CDS_pept        join(284037..284183,284282..284303,284368..284502,
FT                   284567..284673,284736..284855,284917..284990,
FT                   285052..285165,285215..285273,285324..285490)
FT                   /codon_start=1
FT                   /locus_tag="CND00910"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43015"
FT                   /db_xref="GOA:Q5KJ24"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ24"
FT                   /protein_id="AAW43015.1"
FT                   /translation="MSSSQTRKRSQRLKLPGGTATESARRQVQEVGAIAQDGLSSGAWI
FT                   YPLLGILYLFSHPTLIRPLLPIIFKGILMSAGVIAALFAFAYLPQVAILAVISGPLAFA
FT                   LAIPLILGEAFVVVMFLTRGILVAQATVDIFDAVLLQKGHSVLVENGRQVTNKGGKVKQ
FT                   LGTLMTKPLSRFNVDSVVRYLLTLPLNFIPLIGTIFFLGYNGYKAGPGFHARYFQLKNF
FT                   DKDRRQAFIKKRRGAYLMFGTMAMALNLIPIVSIVFSFTTAIGAALWAAELESKGKTPT
FT                   AVSQSDANNSTGQQEEIEVQLPERAVNDQKKEL"
FT   gene            286183..287021
FT                   /locus_tag="CND00920"
FT   mRNA            join(286183..286288,286380..286751,286820..287021)
FT                   /locus_tag="CND00920"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        286384..286749
FT                   /codon_start=1
FT                   /locus_tag="CND00920"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ23"
FT                   /protein_id="AAW43013.2"
FT                   /translation="MPPAPTVQQIQSLYSATVNASQRFTSYNFHKYFLRRADEVFKPVL
FT                   ASLAPPAGSAPSDPIDPSRLAQFYEQQKTQLEILERASEVNRMYEGPKLVVEHAQPITS
FT                   GGGAGMEASAGGGGQPE"
FT   gene            287029..288895
FT                   /locus_tag="CND00930"
FT   mRNA            join(287029..287593,287651..287762,287808..287944,
FT                   287988..288064,288140..288202,288269..288336,
FT                   288425..288895)
FT                   /locus_tag="CND00930"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(287131..287593,287651..287762,287808..287944,
FT                   287988..288064,288140..288202,288269..288336,
FT                   288425..288845)
FT                   /codon_start=1
FT                   /locus_tag="CND00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43011"
FT                   /db_xref="GOA:Q5KJ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ22"
FT                   /protein_id="AAW43011.2"
FT                   /translation="MSPIMRLFGKAQKDQERDRAWTALADEEVGAKRKGSKEKSNHQSA
FT                   GAQASYSSSKLQLKPDDANDLDTQPFVATIPEFSKGKLLLWRLSIILPFLTAGCLLYLL
FT                   TCSTSSWRANWSSIKIELPSTEFESLYASGSTITRESSNSTPSRRDYANKVSAKPIHNK
FT                   RVNNTDDALGGHLSLNMWGWCLKSTEQTTAIMCSSESMWFSMDDLVDSSSTRSRELTTD
FT                   TFNHFLVHALIVHGFAMLSTMLALIPIVLNTWRILRAQKPKINTSWFENISLSLASILC
FT                   LISWIVNRCLQASVSSKLPDYNVDAGIASIITGVSSILLAAIFLVSAVPCLYLHMRRQN
FT                   QLLKYWMNLEDYDEAVARQHSSEAEKGNNKNYDMGNKGRSTRRPRPRRGLRDHRLTKMI
FT                   FGGGYDDSEKRKDKGRRREEQASQRRGRRSRRRDRRKYGHRRRHSRR"
FT   gene            289133..292065
FT                   /locus_tag="CND00940"
FT   mRNA            join(289133..289236,289316..289352,289412..289441,
FT                   289501..289607,289670..289824,289883..290083,
FT                   290133..290235,290284..290414,290468..291255,
FT                   291313..291385,291436..291554,291611..291772,
FT                   291830..292065)
FT                   /locus_tag="CND00940"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(289199..289236,289316..289352,289412..289441,
FT                   289501..289607,289670..289824,289883..290083,
FT                   290133..290235,290284..290414,290468..291255,
FT                   291313..291385,291436..291554,291611..291772,
FT                   291830..291949)
FT                   /codon_start=1
FT                   /locus_tag="CND00940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43095"
FT                   /db_xref="GOA:Q5KJ21"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ21"
FT                   /protein_id="AAW43095.1"
FT                   /translation="MANFSSNDITAVNTIRTLAADVVAKANSGHPGAPMGMAPAAHVLF
FT                   TRFMRFNSKNPKWINRDRFVLSNGHACALQYILLHLAGYEVSMEDLKQFRQIDSITPGH
FT                   PEVGVTPGIEVTTGPLGQGIANAVGLAISQAHMGAVFNKENFSLIDNYTYCFLGDGCLQ
FT                   EGVASEACSLAGHLKLGNLVAIYDDNKITIDGDTAVSFTEDVEMRFKSYGWNVLHVEKG
FT                   DDDLAAIEKAITEAKKSKDAPTIINLKTTIGFGSLHAGGHDVHGSPLKKDDIVQLKKKF
FT                   GFNPEETFVVPKETSDLYHKVAESGAKAEAEWQALFKSYSEKYPKEAAELQRRVEGRLP
FT                   DGWEKALPTYTTSDAAVGSRKLSETTITKLVEVLPELVGGSADLTGSNLTRWKGAEDFQ
FT                   HPSTGLGSYAGRYFRFGVREHGMTAVCNGIAAYGGIIPFTATFLNFVSYAAGAVRLSAL
FT                   SHLRVLNVATHDSIGLGEDGPTHQPVETAAWLRAIPNLAFWRPADGNETSAAYLVAILS
FT                   QHTPSVFAFSRQNLPQLANSSIEKATKGGYVVEEVENADVTLVSTGSEVILCLQALEQL
FT                   KSKGIKARLVSLPCFEVFNNQPKDYKLSVLPSGAPILSVEAYSTFGWGTYSHDHFGLKA
FT                   WGASGPYNKVYEKFDITPEGIARRAEKVVDFYKKRGQPVFSPLISALDDISE"
FT   gene            292492..295266
FT                   /locus_tag="CND00950"
FT   mRNA            join(292492..292796,292863..292876,292944..293045,
FT                   293117..293185,293245..293357,293412..293531,
FT                   293586..293771,293828..293960,294018..294080,
FT                   294130..294170,294225..294348,294398..294453,
FT                   294505..294654,294720..295266)
FT                   /locus_tag="CND00950"
FT                   /product="Aromatic-L-amino-acid decarboxylase, putative"
FT   CDS_pept        join(292783..292796,292863..292876,292944..293045,
FT                   293117..293185,293245..293357,293412..293531,
FT                   293586..293771,293828..293960,294018..294080,
FT                   294130..294170,294225..294348,294398..294453,
FT                   294505..294654,294720..295082)
FT                   /codon_start=1
FT                   /locus_tag="CND00950"
FT                   /product="Aromatic-L-amino-acid decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43093"
FT                   /db_xref="GOA:Q5KJ20"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ20"
FT                   /protein_id="AAW43093.1"
FT                   /translation="MDIEEFRKAGYAAVDAICNYYEQLSQKPVKAEVEPGYLLEKLPSE
FT                   APVKGEPFEQITAAFQNDILPGITHWQSPNFFAYFPSNTTFEGMLADLYAASVSNPGFN
FT                   WICSPACTELEQVVVDWVAKILGLSSAFWTDSKVGGGVIMGSASEAALTAAMAARERVL
FT                   RILSKDANAVANEDIEIPEDVRQKYGQKLVIYGSTQTHSIGAKAAILLGLPFRAVPVTA
FT                   EDEYALRGDALRAAIETDVAAGLIPFLAIGTVGTTSSGAVDRIAEIGQVLKDYPTMFLH
FT                   IDAAWAGVAYALPECRDQLRLAEVNEYANSVSTNLHKWGLTTFDATLLFVKDRHDLTQT
FT                   FDVTPLYLRSKEADTGKVIDYRNWQIPLGRRFRSLKIWFILRSYGVEGFQRHLTRGIEQ
FT                   CQKLASIVRASPDFELVTEPALALLVFRLVPGHTTQLSAETLNNLNKRLYNRLDARKDV
FT                   FLTQTALKSSNGNSVTCIRFAMGGVHTKFEHVQKTWEVVKEEGCNTIDEWKKEEGNQ"
FT   gene            complement(295251..297537)
FT                   /locus_tag="CND00960"
FT   mRNA            complement(join(295251..296586,296651..297403,
FT                   297453..297537))
FT                   /locus_tag="CND00960"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(296686..297403,297453..297457))
FT                   /codon_start=1
FT                   /locus_tag="CND00960"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43009"
FT                   /db_xref="GOA:Q5KJ19"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ19"
FT                   /protein_id="AAW43009.1"
FT                   /translation="MEEFIYQNIVPWLPKDAQELLFSPPTFSDPSSFLPLFRLISPYVG
FT                   YFIIFVAFIIVWSTVSSIFGYFSRFLRISLRLAPLVGIAAWIMQASGQGSMGELMELAK
FT                   QWSGLAPADNGARGAQASPGIAYLSSLFSGNQDGSSTSKGKKKATPRSKYSTRSSTKDK
FT                   AFGQRGGASKPAPDSGADFISSLLSSAVGNGGEERAASSWQNMVQDYVKQSVLKASHLD
FT                   WLFTPSEKKDIKKQAGTR"
FT   gene            297650..299021
FT                   /locus_tag="CND00970"
FT   mRNA            join(297650..297749,297803..297901,297956..297969,
FT                   298022..298085,298167..298242,298299..298337,
FT                   298389..299021)
FT                   /locus_tag="CND00970"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(297676..297749,297803..297901,297956..297969,
FT                   298022..298085,298167..298242,298299..298337,
FT                   298389..298877)
FT                   /codon_start=1
FT                   /locus_tag="CND00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43376"
FT                   /db_xref="GOA:Q5KJ18"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032862"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ18"
FT                   /protein_id="AAW43376.2"
FT                   /translation="MSTSPPAPPALAQWQVNNVPPAAYYIPDFITEEEEQYLIKKIGQS
FT                   PQPKWKTVGTGRRLQYWGGTMSKTGVLLPEALPDFLTKFPDIISRIGKFLKLASPDGPR
FT                   LDINQVLVNEYNPGQGIAPHEDGPAFQPLVATISLGSHTVLDLHHYISSTSPSPPMVAT
FT                   VSSTDKDSGSCARAVAAVPLAHLLVLPRSLLILSSSLYTSHLHAIAAKTQDSVMAGGAD
FT                   DGDVVAVANAELLGDPAVMESLRNGGVWVKERGVRTSLTFRHAQKVIKGGALGKVMGNM
FT                   RRP"
FT   gene            complement(298118..299875)
FT                   /locus_tag="CND00980"
FT   mRNA            complement(join(298118..298872,298953..299875))
FT                   /locus_tag="CND00980"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(298956..299789)
FT                   /codon_start=1
FT                   /locus_tag="CND00980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND00980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ17"
FT                   /protein_id="AAW43383.1"
FT                   /translation="MPTPPLPLFHQLLTALHIPINPPSLAAIPPSLLLLTLETILNTRL
FT                   PLPHSTRLCQTSGDELVVIKCVLGVLADDILGMDLSVVDPVNVVRGREHEMAVMIMALV
FT                   VAARRRGVHITLPPPAKGDRRGDSRLGVEKVSSWLDDDEEDWEESASLRSALPPPILPD
FT                   ISLSSSETSVLDTSAGTSFTMQLPDDEFPYLKVTPDKRDYGRTQEGFVTPIMNRTGVSK
FT                   AHRLSSPSRQMITPSTGSKGNASARSPSLESSEEQGSGRTVLQYMLDELGLGLGG"
FT   gene            complement(300071..302766)
FT                   /locus_tag="CND00990"
FT   mRNA            complement(join(300071..300299,300356..300404,
FT                   300460..300650,300710..300865,300920..301020,
FT                   301082..301176,301225..301327,301380..301519,
FT                   301572..301635,301695..301793,301844..302550,
FT                   302606..302766))
FT                   /locus_tag="CND00990"
FT                   /product="phosphatidate cytidylyltransferase, putative"
FT   CDS_pept        complement(join(300177..300299,300356..300404,
FT                   300460..300650,300710..300865,300920..301020,
FT                   301082..301176,301225..301327,301380..301519,
FT                   301572..301635,301695..301793,301844..302550,
FT                   302606..302718))
FT                   /codon_start=1
FT                   /locus_tag="CND00990"
FT                   /product="phosphatidate cytidylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND00990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43117"
FT                   /db_xref="GOA:Q5KJ16"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ16"
FT                   /protein_id="AAW43117.1"
FT                   /translation="MSSHRGQPLFSGGMYELLNKGAAEHEEVEEEEEAPVETSPENPSG
FT                   SQSQTATLSKSARKRLARQASKGLDGKSKSNKQSGSETESPGTPSVPGAEEFPETNIEA
FT                   PIPQEAPKQQASSPAKTELEHSTTSPSQIPALEKQIPDIAPKKTKPVTAVPEKKEENKE
FT                   QKKETPKKADAARSSSPPSSNFSPSLPATLPQPTGNALPANRKRKTPQDFTPAGPGNVM
FT                   NSASPSKIAVKFEDGLAPGEGKEGEKTIAPKKNRNMIERTIWTFIMIGGFIVLLCMGHP
FT                   YMILLVMLCQTLVYNEVTALFDLRDHGGSKAATPGEQGDSWNKTINWYFFVVANYFLYG
FT                   ESIIYYFKHIVFVDAYFIPFARNHRFISFMLYVVGFVGFVANLQRQYLRQQFALFCWVH
FT                   ISLLLIVVSSHFIVNNILEGLVWFFVPASLVICNDVMAYVCGKLFGKTPLIKLSPKKTV
FT                   EGFVGAFICTLLFGIAWGTFWMRYPYMICPARDLGTNVFSQVTCRPNPVFMWHSFEFTG
FT                   VARQALQTILGHPPPSIPYAPFQIHCLVMATFASLVAPFGGFFASGFKRAFNIKDFGHS
FT                   IPGHGGMTDRMDCQFMMGLFSYVYYSSLIRIQNVTVGGIMQAVVTSLTQPEQIELLYDL
FT                   KRFLAGQGVKV"
FT   gene            304264..306782
FT                   /locus_tag="CND01000"
FT   mRNA            join(304264..304895,304950..305049,305105..305197,
FT                   305250..305343,305394..305508,305557..305699,
FT                   305761..305842,305901..306109,306159..306225,
FT                   306275..306389,306443..306554,306599..306782)
FT                   /locus_tag="CND01000"
FT                   /product="protein-vacuolar targeting protein, putative"
FT   CDS_pept        join(304307..304895,304950..305049,305105..305197,
FT                   305250..305343,305394..305508,305557..305699,
FT                   305761..305842,305901..306109,306159..306225,
FT                   306275..306389,306443..306554,306599..306739)
FT                   /codon_start=1
FT                   /locus_tag="CND01000"
FT                   /product="protein-vacuolar targeting protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43007"
FT                   /db_xref="GOA:P0CO82"
FT                   /db_xref="InterPro:IPR004353"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO82"
FT                   /protein_id="AAW43007.1"
FT                   /translation="MTSESEPNTSLPFSPIQQTLPATPSRSTSQVSMVSAEALLSHSSP
FT                   TKQLTPSHRSSLPSALPYNTLLNAPAGSPALRARASTASSSRAPSVLDDARVEHNDSET
FT                   QVLEITPPMDNYELDGGSDHTSLPSDASSIKGKEKQRSNDRNEIETVGAGGEMALPSGD
FT                   ARKGLKELVRRSTTADKGYGGHDHRRLSEKLSQNENLQILITQSDKMSYSPRLYYVLTN
FT                   AGKPVFCSHTRPSEDDVTNLMGVAQALISIFADDDDRLRYIIKGNHRVAFLLKAPLYLF
FT                   CVSDWGEPEHVLRLQLEYIHLQILSVVSSTQLLRLFQRRSNADLSTLLEGTEPFLSNLI
FT                   DCSQYDFSFLTSTLQPLRMAPALRDTSAAALMPPSKFKDLLYVLLIAGGHIVTVLRPRK
FT                   HSIHPSDLHLLLNTIASSSALRTTETWLPICFPKFNPSGFVHAYISYVLEDVGLVFVSA
FT                   DREAFEDLRVWKDMVLEKLEQDKTLSRIQEAIPLHPYTISSVGCPGLRHFIYKSRQHVQ
FT                   ITQPIWEAPYEDGSTNQKRLVTTYQKLHDAVHAKSGQASALKLVYISTEHEACLVWATK
FT                   PFELYITVSPQLSKSAVVAAANNVAKWVLAEEGRIFLKDAPVF"
FT   gene            307100..308287
FT                   /locus_tag="CND01010"
FT   mRNA            join(307100..307263,307358..307762,307817..307872,
FT                   307932..308027,308085..308287)
FT                   /locus_tag="CND01010"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(307226..307263,307358..307762,307817..307872,
FT                   307932..308027,308085..308140)
FT                   /codon_start=1
FT                   /locus_tag="CND01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43005"
FT                   /db_xref="InterPro:IPR019380"
FT                   /db_xref="InterPro:IPR039876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ14"
FT                   /protein_id="AAW43005.2"
FT                   /translation="MGRGGGVSSRGRGKFKVARGGGRHFSRDLDPRFNKPVSESSEEES
FT                   SEEESSEDETAQQNEQLAPEMAALNLKLGNTVALDDEDQEPGMSRAEKKAMKKAQGEKK
FT                   VTIQEPEDSGSESDEEEVMPAPVPKGKAKVAKKAEPVQMSRKEREAAEKKAAEQRYQNL
FT                   HAQGKTMEAKTDLARLQEVRARREAAAAQRKAEAEEKAQEAAAKKEKLLAKKI"
FT   gene            complement(307817..309213)
FT                   /locus_tag="CND01020"
FT   mRNA            complement(join(307817..308335,308390..308459,
FT                   308529..308844,308915..308960,309059..309213))
FT                   /locus_tag="CND01020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(308277..308335,308390..308459,
FT                   308529..308844,308915..308960,309059..309155))
FT                   /codon_start=1
FT                   /locus_tag="CND01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43344"
FT                   /db_xref="GOA:Q5KJ13"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ13"
FT                   /protein_id="AAW43344.2"
FT                   /translation="MSSSNRPVRPSYTLKLANTKNEVEACYDIRMEVFCVEQGFTVEDE
FT                   MDEYDPHSFHFLLTIPISSPPDVSTSSLPPTNDTPTTTEKPIGTIRFVPGKSKLTRLAI
FT                   LKDYRKFGFGRVLVEGMENFVRQNAVKESLGKIIEEQGEKWITIKCHSQIHAIPFYEKL
FT                   GYVAKGPQFDEDGAPHQLLVHRLQVDDDYKSE"
FT   gene            309444..311366
FT                   /locus_tag="CND01030"
FT   mRNA            309444..311366
FT                   /locus_tag="CND01030"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        310438..311094
FT                   /codon_start=1
FT                   /locus_tag="CND01030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43378"
FT                   /db_xref="GOA:Q5KJ12"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ12"
FT                   /protein_id="AAW43378.2"
FT                   /translation="MFHNAVIYYVPKGVKAILVKFGVSVCRVNEMGWWDEKLFEEESVG
FT                   SKDSFSILCAKVGQVDNFSETGLLEKGSMENIDVMTVASSISPHHLRVICTPALHNSGR
FT                   SLCQMDKTLWATWYLEYTLPNRSLWRCFFGGDTGYQAQPNGPVCPIFKGAYSARECSMQ
FT                   CDRPQADEAMNRDCAAVRPTRLGASSHRTRLGPPISLVHSSTHLWRFAPRFGSAL"
FT   gene            311655..313640
FT                   /locus_tag="CND01040"
FT   mRNA            join(311655..311881,311936..312885,312962..313640)
FT                   /locus_tag="CND01040"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(312203..312885,312962..313430)
FT                   /codon_start=1
FT                   /locus_tag="CND01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43003"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ11"
FT                   /protein_id="AAW43003.2"
FT                   /translation="MPSSRFDPLENEVYNTDSVLALHDVELAVDEEILERTKRVQAALP
FT                   RYASNRPRLYETPNPFVGIAHRLGSRRVRPIALELIQALGHLVDAVWLTTYPDRPCPWI
FT                   IGFDESPIQSSIKRLIMACQTADAYPSDVGWKSPMITAVQEGKRTGYVPTTIADSYLQF
FT                   CENEVAYAIGDVDQVVGVRKGAGYIFARALGAGEYGAPVRTNVLGVSGEGGGMARLLND
FT                   LEEAIWGDAPPRVTDLAYELPGDFDPYAIPDESELIVAAAAAGGGSSGHLTGHSSSLAD
FT                   FFSGEPNTGVAAGANGYSILASRRESSQETGDTYDSLPDFDMTPSLSDVTHISTPVETA
FT                   KNKLSGGLLPGIENIRGAEGMTLEELGRKRHQEWLANRAAIWE"
FT   gene            complement(313799..315699)
FT                   /locus_tag="CND01050"
FT   mRNA            complement(join(313799..313993,314053..314235,
FT                   314292..315094,315153..315501,315570..315699))
FT                   /locus_tag="CND01050"
FT                   /product="carbamoyl-phosphate synthase
FT                   (glutamine-hydrolyzing), putative"
FT   CDS_pept        complement(join(313871..313993,314053..314235,
FT                   314292..315094,315153..315384))
FT                   /codon_start=1
FT                   /locus_tag="CND01050"
FT                   /product="carbamoyl-phosphate synthase
FT                   (glutamine-hydrolyzing), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43115"
FT                   /db_xref="GOA:Q5KJ10"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ10"
FT                   /protein_id="AAW43115.1"
FT                   /translation="MSAIRALNMRKTASALKAPVAFKRTLATPVNSLYTSVLPAKIPAA
FT                   LHLKSGQSYFGSSFGSENSKFGETVFSTSITSYTDSMTDPSYLGQILVFTSPMIGNYGV
FT                   PSNTSSQFPGIPFLESEKIQCTGVVVSDVALKYSHYQAVESLHEWCKRYDVPGITGVDT
FT                   RAITSLLRDQGTTLGRLAVGDEAGKPAPQEAEYWDPSKENLVAQASTKKAYVLNEKGSG
FT                   PRIAVLDFGTKANILRSLIRRDAVVTVLPWDFDFNTVRDQFDGLFLSNGPGDPKMIMDS
FT                   AMRVRQTINEWNKPIFGICMGHQVLGLAAGLEAYRMTFGNRGHNQPVLALASSGSIKAG
FT                   RVYVTSQNHQYALRLTEDFPEGWAPFFINCNDSSVEGIISTPESGKRIWGVQFHPESAG
FT                   GPLDTIEMFTDFVNECDVSRKGFSGSAMIANEVKVDGHAAKAASVSA"
FT   gene            complement(315993..318193)
FT                   /locus_tag="CND01060"
FT   mRNA            complement(join(315993..316629,316677..316776,
FT                   316826..317051,317100..317180,317227..317280,
FT                   317330..317388,317439..317752,317800..317887,
FT                   317937..318053,318105..318193))
FT                   /locus_tag="CND01060"
FT                   /product="Golgi to vacuole transport-related protein,
FT                   putative"
FT   CDS_pept        complement(join(316047..316629,316677..316776,
FT                   316826..317051,317100..317180,317227..317280,
FT                   317330..317388,317439..317752,317800..317887,
FT                   317937..317988))
FT                   /codon_start=1
FT                   /locus_tag="CND01060"
FT                   /product="Golgi to vacuole transport-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43047"
FT                   /db_xref="GOA:Q5KJ09"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ09"
FT                   /protein_id="AAW43047.1"
FT                   /translation="MIPARPWSALSPVQALVEQTCDPTLPVPNDIANIELAELINRKKA
FT                   NSAREATTALLPHINSRNPNEALLALNVLDYLVKNCGYPIHLQISTKEFLNELVRRFPE
FT                   RPPMVIGRVMGKILDLIHEWKNTLCVTSKYKEDLVHIRDMHRLLSYKGYRFKQFDAARA
FT                   LASANPNENLKSPEELEEEDRAAKSAKLQELIRRGTPRDLAAAQELMKALAGAEPEKAV
FT                   DYTAQTLKELDKVQAKAILLNDMLNNATQGEKIGIEGDVYDQVAGACRGARPRIQKWIE
FT                   DDNGEREGMMDRLLLCNDLINTALERFEACKAGDWTKAQAVVERNNPNQKVADLISFDV
FT                   FDNEPASSSSGGVTLPADNIPSTSNVGMTTSGLPLDLFAPSPVATPSPAGSSTVGAAGQ
FT                   KQKQDPMAFFSTASPQPQATQQWGQAQAQPTSAFGGLGGLQQPTPNTNNNNFAFGGFQS
FT                   SQSSSPAVGYSLSPQPAALSSQQFIQPQQPQQSQPQQQPQQQQQQQTKKDAFADLVDLM
FT                   S"
FT   gene            318308..319934
FT                   /locus_tag="CND01070"
FT   mRNA            join(318308..318401,318447..318855,318908..319152,
FT                   319201..319693,319746..319934)
FT                   /locus_tag="CND01070"
FT                   /product="NADH dehydrogenase (ubiquinone), putative"
FT   CDS_pept        join(318383..318401,318447..318855,318908..319152,
FT                   319201..319693,319746..319815)
FT                   /codon_start=1
FT                   /locus_tag="CND01070"
FT                   /product="NADH dehydrogenase (ubiquinone), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43001"
FT                   /db_xref="GOA:Q5KJ08"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ08"
FT                   /protein_id="AAW43001.1"
FT                   /translation="MSILRVAPALRAKAVPRAVPLVSKRNANDLSITSPPNPSASVRPA
FT                   IRYGPPTGGRSSDSGRTVTVFGSTGFLARYLIQKLARQGTQVIVPYRDEDEKRRLRPCG
FT                   DLGQIVPLEWDARIPEQTAECVKHADVVYNLVGRDYETRNYSYDDVNVKVAQSIAEISA
FT                   DMNIPRLIHVSHINANPESPSEFYRTKYAGERAVRDAFPEATIVRPSQLFGHEDWLLNA
FT                   IARYPILCKLNNGNTKLFPVHVVDVAQALNLMFDAPVTSTASTFVLPGPELYNYAELER
FT                   LVSALTLRPISSAPSLPKPVAKFLANLVNRGLWWPTISPDEVERMFIDDAGAEAFQVHS
FT                   PGPDGWNAPPRPQIVGVNGEPVKSWADLDMQPDTIAEHAIKPLRRYRSTVNYDLPVETH
FT                   IIKAPKQYHVLP"
FT   gene            complement(319963..321108)
FT                   /locus_tag="CND01080"
FT   mRNA            complement(join(319963..320288,320354..320428,
FT                   320491..320764,320836..321108))
FT                   /locus_tag="CND01080"
FT                   /product="copper uptake transporter, putative"
FT   CDS_pept        complement(join(320153..320288,320354..320428,
FT                   320491..320764,320836..321100))
FT                   /codon_start=1
FT                   /locus_tag="CND01080"
FT                   /product="copper uptake transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43046"
FT                   /db_xref="GOA:Q5KJ07"
FT                   /db_xref="InterPro:IPR007274"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ07"
FT                   /protein_id="AAW43046.2"
FT                   /translation="MHTCLQPENYPTFVFSLISHNSDLPITLSEELLSTSTTTTSPIMD
FT                   MGGMNMSMGGMSGMGGMGMDSGHGHSHSHMGSGHGADSAPACRISMLLNFNTIDACFLS
FT                   PNWHIRSKGMFAGSIIGIFFLCVLIELIRRLGREFDRWLVKRAGATSCGGEVSSVAEYG
FT                   KDGGQGGLLNVRTAAARYVPSWPHQILRGFIYGSQFTAAFFVMLLGMYFNVIVLIFIFL
FT                   GQTVGYMLFGRDTCGGGFDYAAQGRCC"
FT   gene            complement(321785..323405)
FT                   /locus_tag="CND01090"
FT   mRNA            complement(join(321785..322051,322106..323405))
FT                   /locus_tag="CND01090"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(322121..323293)
FT                   /codon_start=1
FT                   /locus_tag="CND01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ06"
FT                   /protein_id="AAW42999.1"
FT                   /translation="MPPVPITFQFPIPAPSAAPRKRQTHKDGHRELTSIKPFSFTYDSS
FT                   SDTSPVTSHTIIGDDNVPNAKRSFARPTKRRKASVHVAPLASEQYVTVTPLYRPIINRC
FT                   LAYVTSDESHADVHALTGHPYSPESDWGNTRSFNPSDLEVARSEKPKKLNRRELKEKKE
FT                   KEARAKRLVRELKGEAVEDEEEIPIIIEQTPTPSVQEDAPAADQPEKSKDKGSDSISKL
FT                   SPPLSRAPLKRTRSFNALSQTGNGVHAASPLRAVIGANGHRNTDVQPAAKQPYNRRSSA
FT                   TSVIEALGDRESRRAFTHSPSGTNSMPLPEIARPPKSVPLPAGVLQPPRTRGGRSSSTA
FT                   LDAGTGEPTSMKNVASYGTIRSASVGLEGGLRERSRREVTLPNRLKDYEA"
FT   gene            complement(323601..324898)
FT                   /locus_tag="CND01100"
FT   mRNA            complement(join(323601..323913,323966..324234,
FT                   324282..324731,324783..324898))
FT                   /locus_tag="CND01100"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(323727..323913,323966..324234,
FT                   324282..324731,324783..324812))
FT                   /codon_start=1
FT                   /locus_tag="CND01100"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43045"
FT                   /db_xref="GOA:Q5KJ05"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ05"
FT                   /protein_id="AAW43045.1"
FT                   /translation="MSRRDAKPYSRPEVDGQWKHDLHQTAQSTLLDRIAPSPGQSLASR
FT                   LTGGKKELFPDSSSSPSSGRAAGRGSNAGVELLPAGGPAAGQASTGRTRGGPVRGVGVD
FT                   QKSRELLNDALGVGARRSTRPQQPRKSQVSIMGAAKTTVWVRVENLAPGTTAEDVISAF
FT                   APLPILNATQSNPINSPTVSIDLELENRNDAEELIKQYNGVVADGNTLKVSIVNNLKNR
FT                   LGGGSAVKVGANMDNVAGQELLSSAKSSKLYSDMVLATDPNAAIITVADEPEPSSFNAP
FT                   RGREGRGGRGRPVNALAARMGNGGARGWAR"
FT   gene            325029..329137
FT                   /locus_tag="CND01110"
FT   mRNA            join(325029..325690,325743..326225,326278..326929,
FT                   326981..327781,327840..328032,328085..328105,
FT                   328163..328178,328235..328274,328347..328570,
FT                   328628..328672,328726..328860,328919..329137)
FT                   /locus_tag="CND01110"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(325079..325690,325743..326225,326278..326929,
FT                   326981..327781,327840..328032,328085..328105,
FT                   328163..328178,328235..328274,328347..328570,
FT                   328628..328672,328726..328860,328919..329017)
FT                   /codon_start=1
FT                   /locus_tag="CND01110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43379"
FT                   /db_xref="GOA:Q5KJ04"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ04"
FT                   /protein_id="AAW43379.2"
FT                   /translation="MAPSVPPPQRHHSGDAHPLATPTRHSAHRPHAATISTSRPANALL
FT                   DTPRSSRPPLNRKPSATAKPWDHLESLAKDELSIVDTRFDLMSDDELYEYLQHVPVAPE
FT                   DPTPHVELSAPVFPANERTSSPAGPLYTAQLPPSGDKSPLFPPSPPSLQNNAQITDHPL
FT                   RVLSRAVRELREVIERLEDENARLRMNQVERKPASGRATDQISIHDDLNEAISTSLTST
FT                   PSLREIPSRTSALNIPQSELPSLSPTTSRFPAGFSPSSSNSIPFTSTPVDLPQPDADAA
FT                   SINENHDRKSSRQSWTSGLWVWGNKKNSVTKRSSMGSVASVNQPVPPSPNAIPRSTPEH
FT                   EDEDEAWRKGDGGSSPSYRAIFLATRILTPDPSSILVPTETPPKPLIAQLAHSLVSNAR
FT                   DEGIVAKEAVNRRRSRDLSRSRAISLGGQERSQTDEARNKDSKGYGDSALTATALLGRS
FT                   LLSSVTGATIRGSRSGASVVNEETRPSVLSRGSSGHGFPVAAAPSSPAISHSAAVGSPL
FT                   SEAAPLPSVELSSIVPDESRPPTVLLSRENLGSFFQSNRVNRAKMVTASRFESDKPPLT
FT                   DRYGFIYDIQHAKMLKDASVAGTPAPMSLNGTLFKNDDPEEEGWIAKHRRGSHGSQKSD
FT                   SKSIKNTGDVRENSQLASPRPSIDSTSSSTQAPSRSSDTPESVASPKTRSRSSSHADQH
FT                   RHRSSTLLSLNPSPARPVTGKDHLTVSARGSSSLHSGVSPSITSTTAPQPISASLSKPI
FT                   PPIETSTNVSRVTISSLLDQLTDLHDRQQKERVAEWDVFIKKRAKSRAADKGHGWTAGL
FT                   IGVSQMGLSGKGQEDWKTFSRLTRRGIPLKYRGDIWAECSGAKDLMVPGEYAEILIVHK
FT                   DDISPVMADIEKDVSRTFPGNVFFGGDGPGVEKLRRVLVAYSWYNPGVGYCQGMNMVAA
FT                   TLLLTHSDEEQAFWILICIIDRLLPPNYFSPSLVGSRADQLVLSQIVAQILPKLHAHFV
FT                   ALGVDLASITFGWFLSLFTDCLPVETLFRVWDLFFVEGHDSIFRVAVAILKINEIEICN
FT                   CKTVGDLFTFISAMTSRLWAADKLVSLQHNFKPIIRHTDITAKCEKASELLEKEAEGA"
FT   gene            complement(329097..330853)
FT                   /locus_tag="CND01120"
FT   mRNA            complement(join(329097..329336,329389..329451,
FT                   329508..329619,329677..329700,329767..329932,
FT                   329985..330182,330235..330853))
FT                   /locus_tag="CND01120"
FT                   /product="fatty acid beta-oxidation-related protein,
FT                   putative"
FT   CDS_pept        complement(join(329215..329336,329389..329451,
FT                   329508..329619,329677..329700,329767..329932,
FT                   329985..330182,330235..330467))
FT                   /codon_start=1
FT                   /locus_tag="CND01120"
FT                   /product="fatty acid beta-oxidation-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43044"
FT                   /db_xref="GOA:Q5KJ03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ03"
FT                   /protein_id="AAW43044.1"
FT                   /translation="MAPPSSVPKEYRPGYLPPSITEQAQKDLPGKQKPLDPTPFNDVMA
FT                   DGSKYKPAGKLEGKNAVVTGGDSGIGRAVAILYALEGANVLFTYHPKEEADAKDTVDDI
FT                   KKRVPKAKVEAVAVEIQTEKACFELADKIKKWSGNELHVLANNAGTQKEIPNIEDLPSE
FT                   QWRHVFDVNIHSMFYLIKSLIPIMPWGSSIINNASINPFVGHPKLLDYTATKGAIVGFS
FT                   RALSNQIVGEKGIRVNCVCPGPIWTPLIVATMGEESLKAFGPGTPIGRAGQPIEVATAF
FT                   VFLASIDSSYFTAQCFHVNGGSAY"
FT   gene            331046..331685
FT                   /locus_tag="CND01130"
FT   mRNA            join(331046..331335,331394..331472,331525..331685)
FT                   /locus_tag="CND01130"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(331167..331335,331394..331472,331525..331648)
FT                   /codon_start=1
FT                   /locus_tag="CND01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43380"
FT                   /db_xref="InterPro:IPR034543"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ02"
FT                   /protein_id="AAW43380.2"
FT                   /translation="MNFVLLAIFFFPLAFAQFGHFFQQGFPFGGGFQQQQQQQEQQAPG
FT                   RQHKGWTESERVHCRAGYVCPASLACVPTPADCPCPYPEDIKCVVPDNRPRDEGEGPPF
FT                   FCVRGDTGCAQVLEFSKPI"
FT   gene            complement(331662..333258)
FT                   /locus_tag="CND01140"
FT   mRNA            complement(join(331662..331899,331949..332048,
FT                   332099..332322,332377..332753,332807..332927,
FT                   332987..333079,333130..333258))
FT                   /locus_tag="CND01140"
FT                   /product="URM1 activating enzyme, putative"
FT   CDS_pept        complement(join(331688..331899,331949..332048,
FT                   332099..332322,332377..332753,332807..332927,
FT                   332987..333079,333130..333250))
FT                   /codon_start=1
FT                   /locus_tag="CND01140"
FT                   /product="URM1 activating enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43113"
FT                   /db_xref="GOA:Q5KJ01"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR028885"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ01"
FT                   /protein_id="AAW43113.1"
FT                   /translation="MQVNQEASSSRRTAVEGLPLDPDEYERYGRQMIMPDFGLPGQVNL
FT                   KNAKVAVVGAGGLGCPVLQYLAGAGVGTIGIIDHDTVSMSNLHRQILHTTDRVGMNKAE
FT                   SACQALRALNNKINLIPHPVPITPATALDILRPYSMILDCTDRPLTRYLLSDAAVRLDV
FT                   PLVSGAAISSAGQWAVYGGKTKSGKRRACYRCIWPSILPGSVGTCEEQGVWGVVTGMVG
FT                   VGMAGEAIKLIVGKEDPDPLLHLHHLGSNPLIRTIRIKPPSAKCITCGPNATITDDLDV
FT                   FGYESFCAGGPETNDETGLVAGQSGHRISVQELDELLQFDKSKVTVIDTRPEVEFGICS
FT                   VPGSINMPLPSILSGPTDIQLTPDIVFICRRGNDSQIAAASLRKALDAKEDVRVRDVRG
FT                   GLKAWGREVDLNFPVY"
FT   gene            333424..336150
FT                   /locus_tag="CND01150"
FT   mRNA            join(333424..333560,333625..333701,333761..334058,
FT                   334118..334276,334333..334440,334525..336150)
FT                   /locus_tag="CND01150"
FT                   /product="prefoldin subunit, putative"
FT   CDS_pept        join(333492..333560,333625..333701,333761..334058,
FT                   334118..334276,334333..334440)
FT                   /codon_start=1
FT                   /locus_tag="CND01150"
FT                   /product="prefoldin subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42997"
FT                   /db_xref="GOA:Q5KJ00"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KJ00"
FT                   /protein_id="AAW42997.1"
FT                   /translation="MATTSSSKQMEVNPRGIPRAPFVDNVDEYVGGKDAEVQTTIKKFE
FT                   ETTAKYRYMEISLQQRRKALLGKIPDITQTLQVVKYLHQRRQKTLGQPVEEEKLSDDED
FT                   DLDDLDDEEAKKEEQPMKTLFELNDTLYAEAEIVETGEVGLWLGANTMLMYPLEEAIDL
FT                   LSSKLAAAQKSQDETIEDLEWLREQITVMEVNFARVHNWDVKRRREKGQIGQQSGLLPS
FT                   RKGNDKDDSEDERD"
FT   gene            complement(335984..339401)
FT                   /locus_tag="CND01160"
FT   mRNA            complement(join(335984..336694,336742..338176,
FT                   338224..338334,338383..338532,338588..338740,
FT                   338793..339071,339127..339231,339288..339401))
FT                   /locus_tag="CND01160"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(336429..336694,336742..338176,
FT                   338224..338334,338383..338532,338588..338740,
FT                   338793..339071,339127..339231,339288..339386))
FT                   /codon_start=1
FT                   /locus_tag="CND01160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43111"
FT                   /db_xref="GOA:Q5KIZ9"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ9"
FT                   /protein_id="AAW43111.1"
FT                   /translation="MNAAQLLQDSLSSNQAARESATQQLEAAARDNFHGYLHTLATELA
FT                   NESQGLDVRYAAGLAFKNGIAARDAINQPVLSERWLALPESATNPLKHLSLSTLGSPQL
FT                   RAGAVAAQCVSAIAAIELPVGKWPELIPQLLEFVQNQDNTGLRVNTLQAVGYICEVIRP
FT                   DILAAKSNEILTAVVQGARKEEPSHEVQHAAIQALYNSLEFIRDNFEREGERNYIMQVV
FT                   CEATQSPSVPVQVGAFECLVQIMHLYYEKMDFYMERALFGLTIMGMKHAEEPVALQAIE
FT                   FWSTVCEEEIELTAQAQDALQYGDHPEIESKGFAKAALNDILPVLLELLSQQNEDDDED
FT                   DWTKSMAAAACLQLLAQNIGDEIVGPVVPFVEAGITRQDWQHREAAVMAFGSILDGPDP
FT                   MTLAPLVTQALGALISMMQSDPSLQVRDTVAWTLSKITETMLEVIDPSIHLRNFITALV
FT                   MGLNASPRTCNSCCAALNNLVMQISQPPELLTEEVQTTVMSEYYSGILKELMPIAERPS
FT                   NQSNSRSAAVQTIATFLSFSANDTLPVVQEVAVAFIARQEALMGMHNQLVGMDDRNNWN
FT                   DMQINNCVAIAAFIRRSPALAAPFADRIMTNLIQLISASGKQSGVLEEAFSTIGGLASA
FT                   LEAGFNKYMEAFAPYIITALGSHEDYSVAQAGVFITSDIARSVNEGLQPYAESLMSSLI
FT                   ELLRSPIVARQVKPHAISAIGEVALAIGSGFKPFLEATMAILSQAGSTSAPPGDEAMMD
FT                   FVQTMRESIVDAFIGIMNGFKDSEAGVMLPYAPGILSFLQTCWADEDRSEGFCSASLGL
FT                   IGDFASAFKNNIKDQITQNWIQEAITSGRSRSASKQSKTNAAYAQHAIKELLK"
FT   gene            339728..341174
FT                   /locus_tag="CND01170"
FT   mRNA            join(339728..339860,339913..340074,340124..340165,
FT                   340220..340276,340322..340371,340424..340697,
FT                   340751..340976,341030..341174)
FT                   /locus_tag="CND01170"
FT                   /product="ubiquitin-specific protease, putative"
FT   CDS_pept        join(339765..339860,339913..340074,340124..340165,
FT                   340220..340276,340322..340371,340424..340697,
FT                   340751..340976,341030..341106)
FT                   /codon_start=1
FT                   /locus_tag="CND01170"
FT                   /product="ubiquitin-specific protease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42987"
FT                   /db_xref="GOA:Q5KIZ8"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR017390"
FT                   /db_xref="InterPro:IPR036959"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041507"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ8"
FT                   /protein_id="AAW42987.1"
FT                   /translation="MADDPSGWSLTESDPQVFTQLLKDLGVNGLQVDDLYSLDAETLAT
FT                   LKPIHALIFLFKYVAPDAESAQESAGVEVDPLDNGVWFANQVINNSCGTLAALNAVMNI
FT                   KPQQSVHERESIKLGSELENLREFGAGMQSLDLGHVLSSSDHIREVHNSFSKSSPFAMD
FT                   PSAFPEREKEDAYHFVAYLPINDILYELDGLRRFPIMHAPVDGDWLDTARETIEQRIAT
FT                   YPPGSLMFNLLCVRSDAIPRLERLLNDPSTPAEQKFVIQDQLEHERNKSQKGAMENSLR
FT                   RHNLLPVVFQLFKSLGESGMAAKAVEDARTKGKERRERMQAKGEAE"
FT   gene            complement(341171..341969)
FT                   /locus_tag="CND01180"
FT   mRNA            complement(join(341171..341476,341584..341639,
FT                   341737..341794,341902..341969))
FT                   /locus_tag="CND01180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(341246..341476,341584..341639,
FT                   341737..341794,341902..341925))
FT                   /codon_start=1
FT                   /locus_tag="CND01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43109"
FT                   /db_xref="GOA:Q5KIZ7"
FT                   /db_xref="InterPro:IPR019711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ7"
FT                   /protein_id="AAW43109.1"
FT                   /translation="MASILRLSAQKAPVAFARSFSVSAVKMDLVQDLYVNQLKSYKPAA
FT                   KAADAHVGSVRSFAAPKAPSAPSLPTDLASELSKFDAEEPTIGGSAPKTSASSEGGESV
FT                   EEYLTFLEKDLPKADAHH"
FT   gene            342177..344058
FT                   /locus_tag="CND01190"
FT   mRNA            join(342177..342266,342323..342384,342444..342556,
FT                   342608..342710,342762..342935,342990..343193,
FT                   343244..343734,343793..344058)
FT                   /locus_tag="CND01190"
FT                   /product="flap endonuclease, putative"
FT   CDS_pept        join(342254..342266,342323..342384,342444..342556,
FT                   342608..342710,342762..342935,342990..343193,
FT                   343244..343734,343793..343994)
FT                   /codon_start=1
FT                   /locus_tag="CND01190"
FT                   /product="flap endonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43099"
FT                   /db_xref="GOA:P0CS60"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR019974"
FT                   /db_xref="InterPro:IPR023426"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS60"
FT                   /protein_id="AAW43099.1"
FT                   /translation="MGIKGLTGLLSENAPKCMKDHEMKTLFGRKVAIDASMSIYQFLIA
FT                   VRQQDGQMLMNESGDVTSHLMGFFYRTIRMVDHGIKPCYIFDGKPPELKGSVLAKRFAR
FT                   REEAKEGEEEAKETGTAEDVDKLARRQVRVTREHNEECKKLLSLMGIPVVTAPGEAEAQ
FT                   CAELARAGKVYAAGSEDMDTLTFNSPILLRHLTFSEAKKMPISEIHLDVALRDLEMSMD
FT                   QFIELCILLGCDYLEPCKGIGPKTALKLMREHGTLGKVVEHIRGKMAEKAEEIKAAADE
FT                   EAEAEAEAEKYDSDPESEEGGETMINSDGEEVPAPSKLKSPKKKAPAKKKKVASSGMQI
FT                   PEFWPWEEAKQLFMKPDVVNGDDLVLEWKQPDTEGLVEFLCRDKGFNEDRVRAGAAKLS
FT                   KMLAAKQQGRLDGFFTVKPKEPAAKDTGKGKGKATKGEKRKAEEKGSAKKKSKN"
FT   gene            344217..346414
FT                   /locus_tag="CND01200"
FT   mRNA            join(344217..344512,344604..344686,344744..344995,
FT                   345045..345298,345353..345411,345470..345627,
FT                   345682..345889,345944..346414)
FT                   /locus_tag="CND01200"
FT                   /product="homocitrate synthase, putative"
FT   CDS_pept        join(344303..344512,344604..344686,344744..344995,
FT                   345045..345298,345353..345411,345470..345627,
FT                   345682..345889,345944..346195)
FT                   /codon_start=1
FT                   /locus_tag="CND01200"
FT                   /product="homocitrate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43101"
FT                   /db_xref="GOA:Q5KIZ5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ5"
FT                   /protein_id="AAW43101.1"
FT                   /translation="MCPPADEPINAGADQDMVAIETNTPHISTSSANQVNGTTGTAEAQ
FT                   PPAVKTHKGLYGRASDFLSNTSNWKIIESTLREGEQFANAFFTLETKIKIAKMLDEFGV
FT                   EYIELTSPAASPESRAHCEAICNLGLKRTKILTHIRCHMDDARLAVETGVDGVDVVIGT
FT                   SSFLREHSHGKDMTWITKTAIEVIEFVKSKGIEIRFSSEDSFRSELVDLLSIYRTVDKI
FT                   GVNRVGVADTVGCADARQVYELVRTLRGVVSCDIETHFHNDTGCAIANAYAALEAGATH
FT                   VDTSILGIGERNGITPLGGLIARMMVADPEYVKSKYNLTMLRELENFVAEAVEVQVPFN
FT                   NYITGFCAFTHKAGIHAKAILANPSTYEILNPADFGMTRYVSIGHRLTGWNAVKSRVEQ
FT                   LNLKLNDEQVKDATAKIKELADVRTQSMEDVDMILRIYHTGIQSGDLKVGQSAVLDRLL
FT                   EKHMPSRDNSPSGRSSNADGTPAKRQRVGEPSA"
FT   gene            complement(346374..347378)
FT                   /locus_tag="CND01210"
FT   mRNA            complement(join(346374..346698,346745..346944,
FT                   347000..347378))
FT                   /locus_tag="CND01210"
FT                   /product="ubiquinone metabolism-related protein, putative"
FT   CDS_pept        complement(join(346461..346698,346745..346944,
FT                   347000..347317))
FT                   /codon_start=1
FT                   /locus_tag="CND01210"
FT                   /product="ubiquinone metabolism-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43107"
FT                   /db_xref="GOA:Q5KIZ4"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ4"
FT                   /protein_id="AAW43107.1"
FT                   /translation="MSSIKSDNIRRTVASRLPTYRTLVSHAYSPPPRSSSFKPPSDSEI
FT                   SQSSIEATTETPGNLTEEQKKLIERIIRVDHAGELGANWIYRGQKWAMDVKGDNKTARQ
FT                   VEEMWENERHHLKTLSLLSAQHRARPTLLYPLWQTMAFALGAGTGLMSKEAAMACTEAV
FT                   ETVIGEHYDDQLRELEPMLNPPKDGASSAQPHPSVPLMASILREFRDDELEHLDIAVEE
FT                   GAQKAPGHSLLSAVVGEGCKLAIKVCQKI"
FT   gene            complement(347633..348862)
FT                   /locus_tag="CND01220"
FT   mRNA            complement(join(347633..347727,347780..347825,
FT                   347879..347968,348031..348118,348179..348242,
FT                   348433..348492,348564..348619,348700..348705,
FT                   348765..348862))
FT                   /locus_tag="CND01220"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(347717..347727,347780..347825,
FT                   347879..347968,348031..348118,348179..348242,
FT                   348433..348492,348564..348619,348700..348705,
FT                   348765..348805))
FT                   /codon_start=1
FT                   /locus_tag="CND01220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43043"
FT                   /db_xref="GOA:Q5KIZ3"
FT                   /db_xref="InterPro:IPR004023"
FT                   /db_xref="InterPro:IPR036605"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ3"
FT                   /protein_id="AAW43043.2"
FT                   /translation="MSTEDLLKDKFYLRYYTGHQGAHGHEFLEFEYSYGRIRYANNSNY
FT                   RNDSLIRKEMFVSPAVVDELKRIVRESEITKEDDVAWPRKNVVGKQELEVRIDKEHISF
FT                   ETAKIGALAEVNDSSDPDGLRVFYYLIQDLKCFIFALIQMHFKIKPIQS"
FT   gene            complement(349137..351697)
FT                   /locus_tag="CND01230"
FT   mRNA            complement(join(349137..349995,350058..350167,
FT                   350225..350544,350630..351112,351172..351335,
FT                   351389..351519,351569..351697))
FT                   /locus_tag="CND01230"
FT                   /product="meiotic recombination-related protein, putative"
FT   CDS_pept        complement(join(349336..349995,350058..350167,
FT                   350225..350544,350630..351112,351172..351335,
FT                   351389..351519,351569..351650))
FT                   /codon_start=1
FT                   /locus_tag="CND01230"
FT                   /product="meiotic recombination-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43041"
FT                   /db_xref="InterPro:IPR018803"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ2"
FT                   /protein_id="AAW43041.1"
FT                   /translation="MRVTKTLLYTFLAVAATSDAKLFGKEKPAYEDWSLDKSVAFLKEQ
FT                   GVAIKDSATLPEIQKQVAAHADAAAKWGAGSAGAAQGYYEGVSEKLLSTWTESQLREWL
FT                   LEQGVVSPSSGREELLVKAKQHLSAASTAVYGHPTAQAASSVSSAANGYYNAAASQAVH
FT                   ASATVQKAFDDAKDYIFSTWDDNQLRTWLEEHNVVSTPEPTGRAALLNNVRVAYLKVTD
FT                   PFYEAWSTSRIHEWLVEHGIVHPEPTAREKLLELMKDNYYDAKDTAYSRWSDSQMRDWL
FT                   ISEGVISTEAAELKREKYEKLLDEHYTRAKSTVWSGWEDSEIRDYLVQHGYIKSDYEAK
FT                   RDDLINLISNKYHGATSAPYLAWPDARLRAQLRSYGIDDTKFSGRQSLLHEVRIHYVQS
FT                   QNKVEQILAAIRETISHGVEFAEDKLSNVLEILTASKLTAEEKLDRAYASVSSVYQAAI
FT                   TSASSAANAYASSASSAASVASVSAISSASSASAAAESAAYSISSSLYSQASAASKAAA
FT                   KSANSPALTSSASAASKSASSHAHYASSSAASVASSVSHAASLAAHSASLSASSASKAA
FT                   SLSAVSATNAAAESSASLSRSLSSAYTQASKSAFSASAVAASKASSASKSAASYSSSLS
FT                   SVSASASKSAKNEL"
FT   gene            352372..355261
FT                   /locus_tag="CND01240"
FT   mRNA            join(352372..352504,352583..352891,352952..353356,
FT                   353411..353594,353652..354554,354609..354936,
FT                   354998..355261)
FT                   /locus_tag="CND01240"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase, putative"
FT   CDS_pept        join(352421..352504,352583..352891,352952..353356,
FT                   353411..353594,353652..354554,354609..354936,
FT                   354998..355088)
FT                   /codon_start=1
FT                   /locus_tag="CND01240"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42985"
FT                   /db_xref="GOA:Q5KIZ1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR036300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ1"
FT                   /protein_id="AAW42985.1"
FT                   /translation="MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPYLRHEY
FT                   IISWSTATALTVVACIVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKML
FT                   NGLAAWFVGFDGNFGFDQIGDSYTEASVPYVGMRSFCAILGTLTIPVVYAIMRESGYPV
FT                   GIAAFSAALILFDNGHITQTRLILLDAHLVLFMALSLFCYVKFHQYRYQEFSRAWWGWL
FT                   LATGFWLACTLGCKMVGLFTFATVGAAVIWDLWEILDIKKGHSMSYWTRHFCYRAIGLV
FT                   IVPFFVYLSFFWVHFKILKFSGPGDSFMSPAFQETLEGNELLLNAQEIRYYDTISLRHK
FT                   DTKQYLHSHEERYPLRYDDGRISSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVR
FT                   HNDVIQLKHVNTQTLLLTHDVASPLMPTNQEFTTVSPDKEDKRNDTLFKMVLDDAHDGE
FT                   AWKTLSGHFRLIHVPTKVALWTHPKALPEWAFGQQEVNGNKNAAERSTLWFVNDIVEDG
FT                   QGFDFKNRTVHVEPKAVKKRAFIKKWFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSG
FT                   ISFWTRNEGQQQIYMIGNLLAWWICAVSVSVYVGVVAADMLARRRGIHPIEDGVRNRLY
FT                   RNTGFFLGAWAFHYFPFYLMNRQRFLHHYLPAHLASVLVAGSVMNFILIEAVNYPISIA
FT                   GPTTRLRPAVRAKLNKSAKMVIAGLLVVVIGVYLFLSPLTYGQSMTGEEVNRRKLLSTW
FT                   SLHFEAKKTHSMDE"
FT   gene            complement(352613..355840)
FT                   /locus_tag="CND01250"
FT   mRNA            complement(join(352613..353884,353937..354542,
FT                   354596..355312,355425..355446,355566..355656,
FT                   355713..355840))
FT                   /locus_tag="CND01250"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(355253..355312,355425..355446,
FT                   355566..355656,355713..355725))
FT                   /codon_start=1
FT                   /locus_tag="CND01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42984"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIZ0"
FT                   /protein_id="AAW42984.1"
FT                   /translation="MAGPGFHPHPPSLLHRGLAKALGASMWFFIFYRARQDGPALIGLR
FT                   HPWDGHGHGHGDEGHH"
FT   gene            355936..361287
FT                   /locus_tag="CND01260"
FT   mRNA            join(355936..356110,356160..356644,356705..359719,
FT                   359768..360275,360326..360432,360483..360523,
FT                   360580..361287)
FT                   /locus_tag="CND01260"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(356094..356110,356160..356644,356705..359719,
FT                   359768..360275,360326..360432,360483..360523,
FT                   360580..360990)
FT                   /codon_start=1
FT                   /locus_tag="CND01260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43069"
FT                   /db_xref="GOA:Q5KIY9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY9"
FT                   /protein_id="AAW43069.2"
FT                   /translation="MNSGHQWPQQDGYQHGLHQDHQRTSPPPATADSYTSTLPPLTTTT
FT                   PIPPVSQILRSSPPNKKLGPTWSVRSSPPSSRSSSLSNAAPFPPIQALPPPMSHQPLPQ
FT                   SLSPPRTSLVSPNPVYPSPNRPRWATRPPSPQPPPSSLDAMLQRGAGPHSQLSATRRLS
FT                   AAHPAQTFGLPEHPPLQPLHLHATEADREGPLPKANANDGTGSSERITTIPLRRESPEP
FT                   SSHMPPLDEPVEVSRPPTPPLPLPSPAHPPSDRPPTPPLPPNLASPPPTASPRPPTPPL
FT                   NPPPESVPPVNHLHPPDRPVNNPNRVELDAGTLTQAFSLENYDAGRFVSAIRAQRQAHH
FT                   PANPHKRKSNILASPESHTPEIKGIKSVPTSRPPKQKAKRSRIRQSLPSQDHPVPERVP
FT                   FPLPSRPFGYPEGAVPSGLDGPSAPSSSTAGPGPVASGSGVRRNRPNSLPPESVEGLSM
FT                   GSISDQSPATQTVTTLPNVGSALPPTIPVHPPVPVGRRVPFDPRIPSDPRIPAEPRVSC
FT                   DTLFPVDPRMPVGSRVVTDSRTSIKPRALFASRAPIDPDVPLDPRAPVDPRTRRPGSRP
FT                   VSRQSTPVSVINGKQEAINLPQGPTSMHRSESKGTSVIPPRKYHGNQPAQQIALSHPGV
FT                   AHVAANIQSASALQSLQGKPLSQSEAFLAARAEMEAKKFSGDPHNHISSNLSGSAEGRH
FT                   KSAGISAVGHKVQHDAQADDDNEPKHFRLPKHLLSLFKMNKGLTDSISESTASSDAEPP
FT                   KSAMAATVGSATVDAVTVEPATVESATVDAVAIEPATVESATADAVAIEPTPKTQPIDD
FT                   APVAESSRPSDPKPSSVPLLEEPREQPKVPLPLPSGVKSDSYPSAARKKLFASVHGSDP
FT                   PARPLKKRKGPATSRKRKQAPVPPEISLAHVPPARTSEPRAPRKIKKVINISSGLFPPA
FT                   VIEDIEGLPNQSTPLFDALDFGRQEEEPDDREMRADGDSSVDSKNLVARPRDRSSSVSS
FT                   QATRLLQPSFGQVREPLFLSKSPTLSPNSPAQTVKIEVDIKFDEPDPAVRADPGAGPSS
FT                   IGLRSAQVDENGVITVSDQWPDESRAVVGPSGADQADELLMRYQLTVDRESTPASLDIV
FT                   LSRSSTEERFTETWSSPEIPLASLKSKNLQAWSWRDKSHDSLDRLSVVLPISKARRRRL
FT                   IQRGIYNPSEDDASEDELKHPAGREKAHREPPPMAAPHGMADYQRSTQAATSRSSLRTL
FT                   YTVIPREGSPYNVRVRSPSPLASRLPPGVPPVPEMYQDVLNETLLDRCTARECRWDDCN
FT                   AVLGSENTLGMHVHRHLANEEGAKDTWKMQLGMSSWIFTGYKGGRMKTEAVPNEYLYKC
FT                   LWRKCDEPCFTTKEKLLQHMLSKHVSGKLICPYGWCRYACPSANTLARHITKIHAKTND
FT                   RPRPMLLPSSLRRLSPPTPLPLPMSVPSYLLQCTALPRPCRSVRELKRLREEIIDFCAT
FT                   PDHPVMAAWQENDDDVKMKHMLDASSPAKEPMTYIDNYEYSQEDDASEYEQGGGRTTSS
FT                   SEDSGDG"
FT   gene            361464..362768
FT                   /locus_tag="CND01270"
FT   mRNA            join(361464..361724,361783..361860,361925..362058,
FT                   362114..362768)
FT                   /locus_tag="CND01270"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(361524..361724,361783..361860,361925..362058,
FT                   362114..362612)
FT                   /codon_start=1
FT                   /locus_tag="CND01270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43334"
FT                   /db_xref="GOA:Q5KIY8"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY8"
FT                   /protein_id="AAW43334.2"
FT                   /translation="MFSDMPVYPGAAFIASVLGVHGYRKGSLSQSGAIAAFCVGYGHLA
FT                   NPVKLFGVTMIGMYLIGSRATKVKADVKAKLEDGPDPSKSGGNRTWIQVLASSLPGLVA
FT                   ALLYRFGPASQLDKANVVLSLHPLSRPLIYTSLGLNATILADTLASELGILSSLPPLHI
FT                   ITFQRVPPGTNGAISSLGTWASAFGGAAIGITQVIDLLIENPACRTSGWTWAGELVAVG
FT                   ASLGLLGSILDSLLGATLQSTYYNVEDKRVITDASPNYHTSTQRVEGVKRIGGGIDLLS
FT                   NSAVNFVCGCILAGTGWWYGSK"
FT   gene            complement(362738..367808)
FT                   /locus_tag="CND01280"
FT   mRNA            complement(join(362738..362919,362974..363200,
FT                   363252..363459,363508..363745,363797..363942,
FT                   363995..364317,364366..364603,364657..364789,
FT                   364848..365009,365061..365384,365431..365944,
FT                   365993..366238,366291..366614,366672..366742,
FT                   366794..366890,366953..367060,367130..367808))
FT                   /locus_tag="CND01280"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(362806..362919,362974..363200,
FT                   363252..363459,363508..363745,363797..363942,
FT                   363995..364317,364366..364603,364657..364789,
FT                   364848..365009,365061..365384,365431..365944,
FT                   365993..366238,366291..366614,366672..366742,
FT                   366794..366890,366953..367060,367130..367640))
FT                   /codon_start=1
FT                   /locus_tag="CND01280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43039"
FT                   /db_xref="GOA:Q5KIY7"
FT                   /db_xref="InterPro:IPR004870"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR042533"
FT                   /db_xref="InterPro:IPR042537"
FT                   /db_xref="InterPro:IPR042538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY7"
FT                   /protein_id="AAW43039.1"
FT                   /translation="MLSSLPSLSRLSHIADSSHSQQANQYSTQIMPSSNQVQPYLSGQV
FT                   GVPVQQGVYPQLPGTQPYPQTPYNPYGGTAPGMGTVGAPISQNQALSQPFAPGSGAVGQ
FT                   PYPSQPVAQWNRYITPLQAPQSLESVSKDEDPIYGPLGRASGKVERGLRGDVDISADLE
FT                   EKLGPSAQIQDPYAAPPSASAAYKCCSVTKRTPLPDALHQELNFKHLTAKMGLFEEIER
FT                   AWFTVDNKLFLWDYGDGRDFSRYDEQTDTIQAVGLVKARKDVFVDDITHVLVICTSTKA
FT                   TLLGLSRSLTSREILLYHTNLTVDTPTVMVDIKGTDEGRVFVLGANKDLYELDYSSDSS
FT                   WLFGSSTSVRLKNRTSGGVSNWVPSVVASKVKAGIESFAVDSQQKRLYTLHTGGEIEFY
FT                   DVSANRFDLRSKYNRLKHDLNRDPRGGAVTIVSISAIGGHESKRACLVAIASNGVRAYF
FT                   VSTPSFYPIILRAPPPLQLGLSVSDQSIYTSGTFIAVQYDPNAPLTQTHLTFAIPQSGR
FT                   QSALRENYETLEPPVFQEWTATEIVPSQVWAIVELSDANPKNSPASLRRSDGLALSALP
FT                   RQAEAGPRGFLVLAASGLFWVDQPRPVDILKANLEIEKDVAVNTIRMTFGKTQLAAMAL
FT                   LLGSTPETKHPDLISSLSTILLTSGEPVVKDSTGGKTITYSSRHDGLALAIARYLRPIW
FT                   SAKVTLPLVGGKQILGIKETVLSKVQANLESLRRYLEEHPFQSYQVEGEAKIAWAQEEM
FT                   SLHGLNILLKQAVEAISFVLLLSDYKITDIVAKCDPVTQSALASLTFESLITSLDGRAV
FT                   ARKLVTALIEQQIGQELGIDTLSEILQQRCGTFIQPGDVVQYKAEESMRRAEATRDPLE
FT                   KTESLAESLRLFIRAAGSIPIPRLQEVSERYRTLNYTLGAIELALRTASDLDPHKKAID
FT                   FVRDGEHPADPRKALFEARKECYAEVIKALKVADDRLDKAVAEGDAATATQNRNEAYAL
FT                   AIASDDELFHFYLYDWQVERGLQEQLLEFDTPFIEDYLKITISNVEDRRDLLWKFYARR
FT                   EQYLPAAEALSSLATRPSPMPLHDRLYYLAQALTSAKSAASLGSEDVEFTSRLQEQIDV
FT                   AQVQMEVARAVEVHPEMTGEEKLEVLASLNDGLLQLDELYQNYARPFRLYEPILLILKT
FT                   ADTRVDDVCEAVWRQLLGSAGKIGGAAGVSEVVKSLGRRYFPSEAAPMDIMIPVVYAEA
FT                   AGYPGSPGWASTTLLDAGVPLRDLWEAVTGLYENSDDEEREFYAEQISILAQRWMSQMD
FT                   EIPAAEIERFASAYILRTNGASDDSTRAIRDKLLAAKQAAVKY"
FT   gene            complement(367959..371317)
FT                   /locus_tag="CND01290"
FT   mRNA            complement(join(367959..368388,368443..368567,
FT                   368628..368909,368963..369179,369235..370049,
FT                   370103..371133,371179..371317))
FT                   /locus_tag="CND01290"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(368274..368388,368443..368567,
FT                   368628..368909,368963..369179,369235..370049,
FT                   370103..370426))
FT                   /codon_start=1
FT                   /locus_tag="CND01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42983"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY6"
FT                   /protein_id="AAW42983.2"
FT                   /translation="MIPQGFSFSHSVDSAYRSYYDHRPASYQARLPPLKYSTPHELRGA
FT                   PRRHRDGEPASLTSEMGACVRPIYPADYTESCYMEALQEEISGVLDRMESLHKIEGVAA
FT                   LSYLPPTPVDFPHSTSRESNSIIRCPEPIIHLSTPFTPLPNICFATPSSLEAKAIIQER
FT                   RPFPDEFHSYLSEIFFESNVTGLDLEGEGEDGVETTLRMPSGNNGKQEHLFSGHTSLLA
FT                   QGIFNDTVIPSSSSQEMMPQIIRRHSLATMDATVYEQSSSGASNPFSRSYDTQGDPFAP
FT                   SYVLARERAKLYKHASISSARRTSEPLVRASCKLEDIKPKSKPVKETTLEPSLPVKAKE
FT                   GYRSLTASLGVTSFDEMKSNNSPSIDSERKHFLSSNVYKLNPVTQSLGRGKALPLLTPR
FT                   RPVPDKVQLPTPTTTPKISLKLGKRAGHVKSTPKTAGVSEGKAMERDAKALYPTPPSCP
FT                   ASPFSMSGASRLKKASISAPTPTPLFESPTINKGKKRKRRLSSKLKAMEIGEDESDGNF
FT                   ASHKSKKLRTLKNTRHSEDVEVFKYTKEEDNIILSHWDGCPPLPANILSTIQKDLVSRG
FT                   FVARSLPALKFRVYNSLREQFEEKRLQMDRKRTKQESRRSRESRNSSRP"
FT   gene            371482..374173
FT                   /locus_tag="CND01310"
FT   mRNA            join(371482..372067,372122..372209,372261..372276,
FT                   372329..372534,372586..372993,373053..373085,
FT                   373141..373210,373266..373338,373390..373602,
FT                   373656..373680,373736..374173)
FT                   /locus_tag="CND01310"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(371907..372067,372122..372209,372261..372276,
FT                   372329..372534,372586..372993,373053..373085,
FT                   373141..373210,373266..373338,373390..373602,
FT                   373656..373680,373736..374032)
FT                   /codon_start=1
FT                   /locus_tag="CND01310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43071"
FT                   /db_xref="GOA:Q5KIY4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY4"
FT                   /protein_id="AAW43071.1"
FT                   /translation="MSNQPIAIPMDMEGTLEYTPSRHSQETHHKSQYVFKRQKKEMPLP
FT                   SKRMAITMLCVLFLVMFLAGWNDASQGPLLPSLQLYYNVDYLVISIIWIMNFVGFMIAG
FT                   LTNVLITDRFGFGIAAPFGASMQAVAYALICWGCPYPLFLIAYIFNGFGLGLQDAQVNS
FT                   LTSRLPNASTKMFLMHAWYGFGATVSPFVSTAFVQHVQQRVYLYFAVSLGLAIVTMIFL
FT                   ISVFRLRTDDQVVGKREETDQKSPASSDVPAAVNSEGQLSEKKPKQNSGSKMKRIMKTP
FT                   VVHCMAFYMVIYVGVEVTIGGWATSFLIDERGGDDNAGYVSAGYFGGLTLGRVALIPVS
FT                   NWLGPHISIWLYTVLSIVLSIVIWVTHSIVGNAICFSFIGVLLGPMYPLVMNVVVEVLP
FT                   GELQGGTIGWIASLGQAGSAIMPFITGAISEKHGVWILQPLIIAFMCASLLLWMFVVRA
FT                   SHPNRSFWCIPRAVTAQPDKEGVHHEVPLESRVEERRECEELCDGQDNGHIEDLKWRRS
FT                   IREAEATPTKGL"
FT   gene            complement(374111..376858)
FT                   /locus_tag="CND01320"
FT   mRNA            complement(join(374111..374292,374352..374563,
FT                   374621..374858,374910..376469,376528..376858))
FT                   /locus_tag="CND01320"
FT                   /product="electron transporter, putative"
FT   CDS_pept        complement(join(374266..374292,374352..374563,
FT                   374621..374858,374910..376469,376528..376716))
FT                   /codon_start=1
FT                   /locus_tag="CND01320"
FT                   /product="electron transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43037"
FT                   /db_xref="GOA:Q5KIY3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023208"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY3"
FT                   /protein_id="AAW43037.1"
FT                   /translation="MLSAIDIVIITLTIALPLLFFFRESLPFIGGKTRAAAPHAAIANK
FT                   ASVDEGDPSDFVGKMTRANKRCVIFYGSQTGTAEEYAIRLAKEAKSRYGLSSLVCDPEE
FT                   YDMNMLDQVPEDACVIFVMATYGEGEPTDNANAMMELLQEPEPEFSQGGSTLENLNYVI
FT                   FGLGNRTYEFYNEVAKKLDKRLTELGAKRIGERGEGDDDKSMEEDYLAWKDPMWTAFAE
FT                   RMGVEEGGAGDVPDFVVKELHDHSPEKVYHGELSSRALLASASGTNTPVGAYGVKNPYP
FT                   APVLSSKELFSVGGDRNCIHIEFDITGTGMTYQHGDHVGIWPSNSDVEVDRMLAVLGLA
FT                   ASGRRQAIVDIESLDPALAKVPFPTPATYDAIFRHYLDISAVASRQTIAFLARYAPSEA
FT                   AREKLTRWGTDKEAYANEIDGPALKLAEVLQSASSDSVEPPFESQTVWPIPFDRIVSSV
FT                   PRLQPRYYSISSSSKLHPNAIHVTAVVLKYQPTVSPPHHHEPRWVFGLSTNFILNVKMA
FT                   HSGENTPVEGDVSHVSMKKVPSYKLSGPRGHYVKENVYKVPIHVRRSTFRLPTSPKVPI
FT                   IMIGPGTGVAPFRGFVQERIALARKAIDKNGPDALKDWAPMYLFYGCRRADEDFLYREE
FT                   WPKYEQELKGVFRMKVAFSREMKKPDGGKVYVQDLIHDLASELAPLILEKRAYIYICGD
FT                   AKTMSKAVEERLMEMLGAAKGGSAAVEGAKELKMLKERNRLMSDVWS"
FT   gene            complement(377031..381028)
FT                   /locus_tag="CND01330"
FT   mRNA            complement(join(377031..377390,377443..378205,
FT                   378254..380164,380218..380635,380714..381028))
FT                   /locus_tag="CND01330"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(377119..377390,377443..378205,
FT                   378254..380164,380218..380277))
FT                   /codon_start=1
FT                   /locus_tag="CND01330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43035"
FT                   /db_xref="GOA:Q5KIY2"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY2"
FT                   /protein_id="AAW43035.2"
FT                   /translation="MSNSFLQHVPRSEFTEVVKQQSATPSSLFYTNSHFSWIPQRAAPQ
FT                   PPVITDLSLPPSTSPPPGGSSEPITSPQCSVENSPASACLCTPPQPDASRRSIRFSLHT
FT                   SPCTSQEQYSLSTGDEADADDGKESGKHGPFTDPGMFQVSQYPLAPTSKATSCDSKEGF
FT                   LPRISPDEAVDHFAPVIQPSQAPPRPPRRRLPLESQSTLLVTQAHLSASPTPSPSIHPS
FT                   DLLLPQAVRRRSLSPNSILTITPSTCTSKSPPNDETVQSVIGGDANKTLASSIEAGCSS
FT                   MGMDQKKRHSVQRRLGALRDLVCDLDFNQSWSTSHTPSEANELPLTSASECNSIVDFSI
FT                   ASRPWSKSEMNVSLISKPLPTRTRFARADRPKGIVEPDLDLSNIPCLISDHLVVPHDAD
FT                   ATLIDPEVCRIQPQKLSKPISQSSNRTDQSRLFSATPDPPRPALRARKEVFSVAWSGYG
FT                   RCLEPSSPITSTAPAAGKTWRYTLPSEAIYHQVVNEMGNDEVKRQEIIWEMCETEQGFV
FT                   DSMKMVMKLFASPLKTPHGKWIDGIPDQICSLFDSLQSIVNVHASLVKSQQSLKHNHII
FT                   DIFTFIGVFRAWVDQLSIHESFLLKFESVTRLIDENVKDPLSVFGEFVRMQMKAGVLGS
FT                   MSLPSMLLKPVQRLTKYPLFLKGLLDATPSSHPAQSCALSLLTKTESMISSVQAAKVRE
FT                   EDYQSLQVLESRILGLPEGFVLAMKGRKLLGHGRVASAVFGKDGPPPNDAGIIHSRARA
FT                   GSVHSLRSTRTSGYSTISSSTLSTSGLFTSFDFSASQAGSSRTSAFSVSSFGSSFHSPS
FT                   RSNSISTCQPSHPSQTLSRPPSVPSMFSIPRPSSSASMRSSKIRKKEDVSIMLVFDDIV
FT                   VLGQMEKGVAVYGKRRDKRLRVIEGGVGRVLEVKNLTGWGGYDDLLCLTLDPVYSDDAH
FT                   SPITHFLTTPGTQKITSSSFLRSKSAPLQVDLNTPTIVTFNGFLEILCQGLEVGVAVDA
FT                   PADGEEEEVLEV"
FT   gene            381623..382366
FT                   /locus_tag="CND01340"
FT   mRNA            join(381623..381877,381967..382025,382082..382104,
FT                   382170..382366)
FT                   /locus_tag="CND01340"
FT                   /product="glutathione transferase, putative"
FT   CDS_pept        join(381671..381877,381967..382025,382082..382104,
FT                   382170..382321)
FT                   /codon_start=1
FT                   /locus_tag="CND01340"
FT                   /product="glutathione transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43119"
FT                   /db_xref="GOA:Q5KIY1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY1"
FT                   /protein_id="AAW43119.2"
FT                   /translation="MSFTALHRLSTLSTHIIRAPISTRYFATTQTAKIGSSISTPNMTA
FT                   DVKSLVDKAIADNKVVVFSKTYCPYCKRAKSYLAEDTKDIEILELDEREDGAAIQAYLK
FT                   ELNGQGTVPHVYINKEFIGGSSDLLKLSHEQVKQKISAAASA"
FT   gene            382770..385230
FT                   /locus_tag="CND01350"
FT   mRNA            join(382770..383094,383166..383627,383690..385230)
FT                   /locus_tag="CND01350"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(382942..383094,383166..383627,383690..385066)
FT                   /codon_start=1
FT                   /locus_tag="CND01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIY0"
FT                   /protein_id="AAW42982.1"
FT                   /translation="MPSFPSKGGVPMLGQAGPSRQAYLIKLPEDIISALESSQGASVTV
FT                   GMDGSVTLNVPDQDPMPLDARPASTASEIHRLSSGPSPTLKLAALATTRLNIPFSSAST
FT                   ARAADKLRAQTDALEKQRKERALKVDGIKRHTDRVASGAMSAPMAVTTSAPGAVWGSGT
FT                   GTGSIPLKTRVMQYLAMGETTQEDLCRRMGGDEQNVMRVVKVVGRPSKTQPGSWSLQPN
FT                   QYSKIKLGAGQWPYTYAEQQQVIRLAYAAFDELGLPANSEERMEFEKKERDASNAFANR
FT                   SSDESEKNAPQLSNAANTSTLQSNAVTSVRERDKARTESPAPVTRQKVPTKRGPQSKIA
FT                   KERAKFVAERQRAGSGSLPNIKGPNGIASPRLGPTASPSVSPEKKDPNKFKDGEHKEKE
FT                   VAKGKERKDESRRREEKKEREREEEKSRETELSAISKTKRSKTTYDYSSNEDAASNQIE
FT                   VKTTKTKGVNNHKKKTEDSPREKLAPLAEIVRKKEKRARKVDYSDSSGEEGEIRGRPKA
FT                   RVTSDEAARSNKHKRRDSESRRKPSRDRNDSDKRDVEDRRIEDSLRTHSQQSKSSRETS
FT                   SHRSPPEMAVNLASRSGQPADPEALRDRYEELYPAYNLLANKLSKIHQMAESGKELGSS
FT                   EAEIKKMVGKWEKWHKELTEIRRWFGEV"
FT   gene            385302..387216
FT                   /locus_tag="CND01360"
FT   mRNA            join(385302..386060,386119..386503,386558..387216)
FT                   /locus_tag="CND01360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(385411..386060,386119..386503,386558..387109)
FT                   /codon_start=1
FT                   /locus_tag="CND01360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43073"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX9"
FT                   /protein_id="AAW43073.1"
FT                   /translation="MPSEDKPQGGYDATALSPSTSPTYTLRITFHKATNLPVADFGSQT
FT                   SDPFILAQATTSHKSRHSQDPYLRFRTNTVRKTLEPVWEAPWVIAGVPEDGLKLSVRVY
FT                   DEDPQDHDDRLGKFEIDTGPIDEKWQGLKQQSFKVKKTGADLRAYALRWTCVMLAGHDL
FT                   HAHAVISIEMLGRTKREMGKAYTINGFWWKHYSPMIGRLTGTKAKDDQGVERYNFQANE
FT                   IQLIGPVPNELYHRYVDFKPFVSGMFTAKGIRGKILNKTLHHQHERLYNYDRQTEYGVF
FT                   PETVEGKDPDQHVTKKFLDLVHHDQGARIFTFIITLDGLFRFTETGKEFGIDLLSKHTM
FT                   HADVNIYIAWSGEFMIRRLSDPSKSPSDPSQHTHPTEDVPGGPPKSSPPVDPAKYELII
FT                   DNDSGTYRPNKDLIPIFRKFLKRNFPGLKIVVMACDDDKLQKMKDEQRKAKLKEGDGIV
FT                   YGQGSVSSLASGSNASISSSDQEGLNERARIMQEERGDSAPSGGVLEKGVEALENPKDT
FT                   LTKAIGKEKQG"
FT   gene            complement(386492..389193)
FT                   /locus_tag="CND01370"
FT   mRNA            complement(join(386492..387469,387522..387764,
FT                   387814..387923,387982..388207,388264..388307,
FT                   388360..388615,388670..388681,388760..388780,
FT                   388830..389011,389085..389193))
FT                   /locus_tag="CND01370"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(387302..387469,387522..387764,
FT                   387814..387923,387982..388207,388264..388307,
FT                   388360..388615,388670..388681,388760..388780,
FT                   388830..388835))
FT                   /codon_start=1
FT                   /locus_tag="CND01370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43033"
FT                   /db_xref="GOA:Q5KIX8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX8"
FT                   /protein_id="AAW43033.1"
FT                   /translation="MPTAWSLAKFGYQMAAFKDVTVKNAKTLIPHVKPNFGADLPRKDL
FT                   KATWLGHACTLVEMPVASQVKGTNEGQRGVRVLFDPVLGPGMAFWGLGPSRESTPPCEI
FT                   EDIPEIDVIAISHNHYDHLDVPTLTTLLKTQRAKYSSSPVLLLPLNNRHIVSGLPIDKE
FT                   NIVELDWWEGREIEVEGVGKVRLVCTPCQHSTARYPWDRDRSLWSSWVIQDQSSSESTN
FT                   SASVWFGGDTGYCTVHMDVHAGTHPTITNPKALPQDVCPAFKEIGERLGPFTLGLIPIG
FT                   AYSPRLVMSPLHAAPVDSVRMFEDTKCKQAMAIHWGTFRMTNERFTGPPEKLKEAMEEA
FT                   GLETSLFSTCKLGESRSYKVG"
FT   gene            complement(389297..391761)
FT                   /locus_tag="CND01380"
FT   mRNA            complement(join(389297..390680,390727..391108,
FT                   391548..391761))
FT                   /locus_tag="CND01380"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(389621..390680,390727..391108,
FT                   391548..391554))
FT                   /codon_start=1
FT                   /locus_tag="CND01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43091"
FT                   /db_xref="GOA:Q5KIX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX7"
FT                   /protein_id="AAW43091.1"
FT                   /translation="MSDTGADTSDIITASAVQSDTSQASVSPSASPSASPSDVQSASPS
FT                   ASESVTASPSPSEQASSSPSPSASASPSASASPSASESPSQSAQQSQSASSSPSDTSSA
FT                   APSSSAAPTSNPSSVTESETSSQIPSSTTQSSGVESSTVSSSTSQSSSTREIVTFTGSS
FT                   TSTSSSSSSSSTGETTVSSALSITTTDSAGHTITTAPSMLTQQLTSTDAAGQVYTVTQI
FT                   VHNPSSTGTSSAADGDSGFFSNSGAVAGTFVAVGLVATAGIMAFVIFMLRRRRRQRLDR
FT                   DVSAAASAAAAAAAHSRSGYDDEDDQPSMAQYGGYYAATTPSNTDIHNQPQPEMGPYHD
FT                   YEDPAGGYDPYAVNMVNLAPSNERLSTSTEPGMAGFGATSAQANYAVQAPYAQDPNGQE
FT                   YMAEPHQPDFSMPVHEQQAANEGYYFDPSQAYAYAQEDAYGGFHDNTQDQYIPEQPAGG
FT                   HRRNGSDGSVSRPGGERGLKVTNF"
FT   gene            390773..391752
FT                   /pseudo
FT                   /locus_tag="CND01390"
FT   gene            392131..393435
FT                   /locus_tag="CND01400"
FT   mRNA            join(392131..392362,392419..392448,392512..392571,
FT                   392622..392989,393040..393435)
FT                   /locus_tag="CND01400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(392251..392362,392419..392448,392512..392571,
FT                   392622..392989,393040..393132)
FT                   /codon_start=1
FT                   /locus_tag="CND01400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43103"
FT                   /db_xref="GOA:Q5KIX6"
FT                   /db_xref="InterPro:IPR019560"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX6"
FT                   /protein_id="AAW43103.1"
FT                   /translation="MPSNRSAIQVAEDSTKGNAKSVEQASEDKLQGLVEENADSTESSI
FT                   RYAAYLRRARDVVRAGSRYTAYTSDVGEAFRPVVPPWLVTAAYGVSWAYLIGDVSFTTY
FT                   KSSQLGPSPIEAANMSERTRLAMVAVKRSVFQGVASMALPAFTIHTAVRYAGRAFAKSQ
FT                   NAILRRWGPTAVGIGIVPALPYMFDHPVEQATDALFEKVEESYFRKNVLESEPKREL"
FT   gene            complement(393082..394618)
FT                   /locus_tag="CND01410"
FT   mRNA            complement(join(393082..393485,393543..394393,
FT                   394454..394618))
FT                   /locus_tag="CND01410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(393675..394331)
FT                   /codon_start=1
FT                   /locus_tag="CND01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX5"
FT                   /protein_id="AAW43090.1"
FT                   /translation="MSTKTPRKRLLPPSPLALPASSLPSLLPEDESTSLGSPIDSKSYP
FT                   VPQQTPTKPPLSKSIPIPVTRRRSKSYVYTSSPHSPDSVLPLTPSSTKQQLSTTSRLST
FT                   STATEMSRLALETSSVKRHKLDANCDGSQQWGHKACCGRDMKQNDEGSGLSTGWSSSHA
FT                   SAEKTGATVEKSALTPNRSGSTEHSSSKKRLNERGRGHMVSHPENCQRTTDAARI"
FT   gene            395125..396201
FT                   /locus_tag="CND01420"
FT   mRNA            join(395125..395495,395553..395683,395742..396201)
FT                   /locus_tag="CND01420"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(395270..395495,395553..395683,395742..396140)
FT                   /codon_start=1
FT                   /locus_tag="CND01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42981"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX4"
FT                   /protein_id="AAW42981.2"
FT                   /translation="MAPLPFHLSTVLRPLSPSLATVRLKSNVFALVLFSLRNLFPPFRA
FT                   VRSLVLQACDAAQGRFGREKSFGEIGLGLGEALITLVLVWNIVEAIVALQYPSTYVPPQ
FT                   PKGMELTPSKVSSPLTRSYTPHPSTPPQPLSRQVYRPSPSSLNQPAQTAVQQTPSGPSH
FT                   AAARTALSNSTSTSLSSSTAKILNLPPTESPSSGLFYERGQGRSPQGTAGINGATNMGG
FT                   DFVLVDRDEKEWVDNVWKGVKGKGGRVGL"
FT   gene            complement(395774..397844)
FT                   /locus_tag="CND01430"
FT   mRNA            complement(join(395774..396307,396364..396796,
FT                   396842..396907,396958..397390,397438..397487,
FT                   397539..397844))
FT                   /locus_tag="CND01430"
FT                   /product="chromatin binding protein, putative"
FT   CDS_pept        complement(join(396227..396307,396364..396796,
FT                   396842..396907,396958..397390,397438..397487,
FT                   397539..397702))
FT                   /codon_start=1
FT                   /locus_tag="CND01430"
FT                   /product="chromatin binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43105"
FT                   /db_xref="GOA:Q5KIX3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX3"
FT                   /protein_id="AAW43105.1"
FT                   /translation="MAISTTAPPPTATRTPNYVPSSTLSAHSRAVTALRFSPDGTLLAS
FT                   AGADGWLHFWHPTSGEHIRGFRAHKAGINDITISPDSLYIATASDDHTSDIHLLHPTPG
FT                   VTFYPPPLEPSDASDTEDHPIAPVPPQSSVSSSSTVPAIRHLVSHTAPVLSVAFSPKSN
FT                   LLATGSFDESTIIWDVKRGKALRQLPAHADAVWCVAWDAEGEMVLTAGADGLIRLWDAS
FT                   TGQCLKTLDNDTNSPISYAAFTPSSVFLQASTLSSTLRIYNIHTGKVIKTIRAPGTFVS
FT                   ERWPCPAVIYEGLPPLFQGTESNGHLDPLKEEKMDVDCVDRDPEPAKPPVVVSNVKTKM
FT                   RDAWIISGSENGKLIIWDIQSKRVLQVLEGDLSHRCSVVALAVSPDGRTIASGSLEPEK
FT                   VIKLWRDAE"
FT   gene            398751..401205
FT                   /locus_tag="CND01440"
FT   mRNA            join(398751..400030,400092..401205)
FT                   /locus_tag="CND01440"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(398891..400030,400092..400313)
FT                   /codon_start=1
FT                   /locus_tag="CND01440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43092"
FT                   /db_xref="GOA:Q5KIX2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX2"
FT                   /protein_id="AAW43092.1"
FT                   /translation="MSLTSNFSFPQSFSVDTNHQSACSIPSPPSLSSGRTSPDFDFESF
FT                   THYSPNASSLVDEIDSADLHKESSSTPPSTDLVSPRSSIADISQIQPPTQVGELDTAEA
FT                   LSKHHLQRYLHYKTLAARAEADRAIVVHQQIQSHTPDDEFDALFSACDKSSVGLMPDGS
FT                   ANSTFFKDAAVSGDNHNNMLAYQSHMVQPTYYQMGQAVPNWQQSDGFYHPQPSQVALHN
FT                   AQAQAHLQAAEVARFQAEQHRMNMSNFYVPVSAAPRSSYDAPQNAPSFAGQSISNLTNQ
FT                   SPSYSSTTSYPVSNVVMDRTSSMSGLTTVAVSRRASEEGEEELAYSSEEDAKPNVASIP
FT                   VANVHGGGRGYVPGQTPDDPKKKHKCQVCGRGFARAFNLKSHIQTHNPLRAKPYQCPHA
FT                   TCKRGFSRLHDLERHRQGIHSDGPLVDAKRHGVTPAVARAQNRIQKRAESGSLI"
FT   gene            complement(401265..402573)
FT                   /locus_tag="CND01450"
FT   mRNA            complement(join(401265..401714,401767..402033,
FT                   402097..402573))
FT                   /locus_tag="CND01450"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        complement(join(401336..401714,401767..402033,
FT                   402097..402194))
FT                   /codon_start=1
FT                   /locus_tag="CND01450"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX1"
FT                   /protein_id="AAW43102.2"
FT                   /translation="MQKGGSVKTYVKHIERGVDELNADPKSLLVFSGGATRHPPSPPIP
FT                   EALSYYRLAMALSLIPSTSIADSPKTAPLPLNLRTATEEYALDSYQNLLFSIARFKEVT
FT                   GNWPRKITVVGYGMKRLRFENLHRAALRFPSSAFHYIGIDDAGDTSAHYAGELKYGYLP
FT                   FLSSPSGCHPPLSIKRLLRNPYARYHPYFTSCPELADLFEWCPAIQSIKGEETWEARNS
FT                   DVGMGYPGRVPWDDKEQVTWDRERD"
FT   gene            402693..407312
FT                   /locus_tag="CND01460"
FT   mRNA            join(402693..403035,403083..403425,403476..404426,
FT                   404474..405366,405422..406168,406248..406489,
FT                   406550..406648,406710..407312)
FT                   /locus_tag="CND01460"
FT                   /product="vacuolar membrane protein, putative"
FT   CDS_pept        join(402710..403035,403083..403425,403476..404426,
FT                   404474..405366,405422..406168,406248..406489,
FT                   406550..406648,406710..407269)
FT                   /codon_start=1
FT                   /locus_tag="CND01460"
FT                   /product="vacuolar membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43336"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIX0"
FT                   /protein_id="AAW43336.2"
FT                   /translation="MLSPANVPLPSSPAPTASRRSSSSSTPFQPSPLTALRPRSPAPRP
FT                   HDDDDPFSEGATVSVNQPVGSISISPSSRDVCLASRKGLYILDLANLNNAPRFVPQGGA
FT                   WQIADVQWSPHPATSSLILSTSSQKLLVWDLAAPRPLLTSFDAHSRAITDINWHALNPN
FT                   LMATVSMDAGIRGWDMRCFDRPVMRLCDWGAAGTQVKWNRRHDHLIATAHGNIVHVWDD
FT                   RKGSVPVTTIHAHDAKIYGIDWDRQYRHKLVTCSLDKTVKFWTVPELGGSSDSSMVYHS
FT                   SLPALSSPSYTISTHYPVWRARNLPFGRGVLALPQRGEKALEMFGMDDDAPVERFQGHE
FT                   NVVKDFVWRMRGGNDSSFDDREFQLVTWSKDRTLRIWPVSRELEERVGWQYGAPIKALV
FT                   SRRGAPDVTYTKDPFNTDIDAPRLPPPVVNHHPANPSNLTRQRSARPEAQPGMTRGGNK
FT                   VRRMDQLEWLTKVVKNAPSPESSLMSSRIASVSRTRRPASRAASRLDSRSASAEDRQEW
FT                   KNLKDEVVAVSRIYPRPKINFEKIDLAHRKLTISMQGPWANGDRQAFMRIHWSFPPNYP
FT                   YGPEIPTFELERNPTVSPITRQTIVMNIKEMRAHNKQCLIETTGYLLGLHERQGRRRGM
FT                   DEESDSESSVKGEEKRREDVVPELMLRKTCGATFGPNGQLVCFFPKQVTLPRTRNFSRS
FT                   PSVTRENPSPMLKAISALTRLQNPHQRAVLRYKPRTRRLDPISSPLPPPAGSTMTIHDV
FT                   SYLGQPNIHLAKMYGMSVEANMSYALEAKRLDHADVWATVRGILADPPPPYTQLPQLDE
FT                   KQDRVRRERLIWEKGMERKKKVVDRLFTNLMAQRDVQMLALLSCILLEYTRSMYIPPVA
FT                   ESVTSHSPMQDYFNLRFVPPRPTLNISPVRRRTGSSVIPVSPTNSSSFRTSGWSQILNP
FT                   SGISLRGALTPKEHTSFSDIPFSRTALSTSYEEQSSPNGLAVAIPTSKRSDSPKPIQGD
FT                   KSKVFPTSSMSPPPIVTPLRSSGPEKSLYSGGEPRSHKVSFGSASPITRGGRSQSSIGY
FT                   VGAGGLGSAVTTGPNTPDGERKAAVRDGGVKLDFPKDESSTPSLLPQDMLPLCEAWKLS
FT                   YADFLLRHHLLGVRMTLLSYRFITSSTSTAVDAASGKSSGIVRAGVGETEKMDEGQSVI
FT                   RVCVPCSGTPSGTCPSCNKQPQKAVCSYCRVPIKGISMGCTICAHKFHAKCFQRYFLSP
FT                   VTTPMTCPACSCSCLAHRGISTPLYTVAALPKQSPNITRGGFDRGKMPSENAPLARSRS
FT                   VPSQGRRGRNSPEEGKSRLTYASLVKLGAIRENFGLGFADGGSSGTASAMGFHADGDGD
FT                   EVSTDRDKTVREHRGDHRGDGLLARARWGGEGLLHWGSTTHHQ"
FT   gene            407516..414314
FT                   /locus_tag="CND01470"
FT   mRNA            join(407516..407803,407862..408989,409040..409326,
FT                   409385..409752,409808..409812,409878..409974,
FT                   410024..410080,410137..410713,410761..410838,
FT                   410879..411069,411110..411195,411254..411476,
FT                   411529..411683,411736..411783,411837..411895,
FT                   411950..412121,412159..412245,412297..412397,
FT                   412449..412679,412729..412792,412846..413108,
FT                   413160..413211,413266..413307,413364..413499,
FT                   413553..413629,413681..413732,413790..414314)
FT                   /locus_tag="CND01470"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(407674..407803,407862..408989,409040..409326,
FT                   409385..409752,409808..409812,409878..409974,
FT                   410024..410080,410137..410713,410761..410838,
FT                   410879..411069,411110..411195,411254..411476,
FT                   411529..411683,411736..411783,411837..411895,
FT                   411950..412121,412159..412245,412297..412397,
FT                   412449..412679,412729..412792,412846..413108,
FT                   413160..413211,413266..413307,413364..413499,
FT                   413553..413629,413681..413732,413790..413982)
FT                   /codon_start=1
FT                   /locus_tag="CND01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42980"
FT                   /db_xref="GOA:Q5KIW9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW9"
FT                   /protein_id="AAW42980.2"
FT                   /translation="MSDVWPATSSYMLELDHRKYDLSQLAKAVDIAAKDRDQSGDEYAV
FT                   ALPTPTCFHVHTNTVEATLLPPDAKIEYYGREPESNPAWEIFQTIGEQVASVVPSMERM
FT                   PLVPSTAKLIRQPPNPGNTTSSAVGACLYLPKHGDRYPLARLELPPIAEQKEWMPSATA
FT                   WDMQHWIHTIIALDPEANTTRKAIYRDDKKRVHMQTAIDICWVPDEGGEADRAEIKLLV
FT                   VSRIYLDISFLFDPLPEIGNDMLGFILHSIIPSPTATTYASESEARAAGLRNFYTCLKP
FT                   APDLPFNFPASRLQPREMLSKLLPFQVRTVRLLLEREGAQGVGKAAIRTKMDPDGLWKG
FT                   LDWGNNLGKLGYRRITGSMVPIDSLKSVNTDIEGKGKQKAYEEEEDYHYVSGITEEERQ
FT                   RLPTLLDLTGVRGTMLCEEMGLGKTVEAIALLSLHRHPLSTPRNIPSMAPLVSTGTSQS
FT                   SAHARIAKQPVPVINLLAGIPGLQDLEVKDWVEKENIAFAGCRAWDEHSQLEVTEVAAT
FT                   LIVTPPSLLKQWVAEIQRHAPTIRVCVYEGWKSLQQGVEKQRDARRKARARKELEEKKR
FT                   KAAAFRGQTRRKYAKGNNGLAIKEESDEENDQDDEEEGTLQLTQRQFVDYVRAHDVVVT
FT                   TYHDHLKFALPVPARSRRSTANYQLNDRPRSPLVMVEWWRVIMDEVQLHGDQTDAANMV
FT                   SLIPRKNSLAVSGTPARSDIKDLMGSLKFLRVPVLPNDNRLWHRLQQPSMRPAFEGLFR
FT                   SLAVRTTKKEVSGEFNLPHQSRYVVPIELSEIELHYYNDTLERARERLHLPANFREARP
FT                   DDWVLDRSMFQTVLRSLRQICTHIQVGQMQSGTGRGDQRLRLGRTLMTMSEALEKMRDD
FT                   HLQETSSEARQQMRMMIRQAQLTVMDDQNDLRHLQALALYERARAAAESHLEPAQKRLK
FT                   SLLDENDGNDEEEDEEFEDEMSEKQQTQQEKARALAIKTVKHTIRELDLIIHQCWFFEG
FT                   DVRHVQKDEEKEVYAYARADAIRKSILARPLKTANMSVDLLKGSLTRGPAVVQVNELQT
FT                   TDLKRKGGILTHDVISQANALLRIMNDNALLVFNWRTKIVDLLSSPIDVDPTDVPDGQG
FT                   QEVENPEAEYYAEALKAQGEVEAYLIAFAAAVADRREFMTETRSLLSTHDSRIAKQRNT
FT                   KAAMNALTDVEMPNVPDDIGEQATVLLKERQVFRDARMNEGCERPLKGLLMDLNAIIHG
FT                   QHRHEEIEIAKSMASMLKKYIAEQTELVEKLNKELDMFRATFNRRVVYFASLQEISDSV
FT                   TAPEFKDLGKDIHAAAKEVNELEVKLAKMAVKGRYLHYLGTKQHEEEDIREDCIICFGS
FT                   SDDNQAVLLQCGHYFCLSCYREYRKTPGGRKCPSCRIKISDKEIQRIKLNPARAEAADP
FT                   MGKQHQEFSVQTLAPAVSGSNEAEEDTTPEEQEQLRRAADLERLRMMDVERRRAVMMMD
FT                   MMGEYGSKINFLIKHLLYYKSTEPDTRHVIFSNWSDSLNIVMQALRLNGISFASFDQGK
FT                   KQKDVVDQFLRDESISVFLLHAERESSGLTLTSCHVVHLLEPVLRHSFELQAIGRVDRL
FT                   GQEKETSVFCYATMDTVESRILSQGVRNGTSIYLADDTADQVVAEMPNVASAAHKGGDV
FT                   AAGGNEEDLLGLIL"
FT   gene            complement(414050..416157)
FT                   /locus_tag="CND01480"
FT   mRNA            complement(join(414050..414922,414991..415250,
FT                   415310..415431,415634..415771,415885..416157))
FT                   /locus_tag="CND01480"
FT                   /product="eukaryotic translation initiation factor 2 gamma,
FT                   putative"
FT   CDS_pept        complement(join(414147..414922,414991..415250,
FT                   415310..415431,415634..415771,415885..416010))
FT                   /codon_start=1
FT                   /locus_tag="CND01480"
FT                   /product="eukaryotic translation initiation factor 2 gamma,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42979"
FT                   /db_xref="GOA:Q5KIW8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW8"
FT                   /protein_id="AAW42979.1"
FT                   /translation="MSAINDPIAAASSGPSEPVQEVQVDVTKLTALSPEVISKQATINI
FT                   GTIGHVAHGKSSTVRAISGVQTVRFKNELERNITIKLGYANAKIYKCQNPDCPPPSCFK
FT                   SYPSSKEAHPKCERPGCDGRMDLQRHVSFVDCPGHDILMATMLTGAAVMNGALLLIAGN
FT                   ESCPQPQTGEHLAALEIIGVDPKNIVILQNKMDLVRESEAMEHCESIKKFVEGTTARLA
FT                   PIIPVSAQLKFNIDAVVAAICNIAPPNYDFSADPRMVVIRSFDVNKPGAGVEELKGGVA
FT                   GGSILQGVFKIGQEVEIRPGLITRDANGICTCRPLRSRIVSLHAEQNHLQFAVPGGLIG
FT                   VGTLVDPALCRADRLLGMVMSSVGKGPSIYVEIRAEVFLLRRLLGVKTDDSKKAKVGKL
FT                   VVGETLFVNIGASQTGGRITAVKGGDVSIALTTPACCEKGEKIALSRRIDKHWRLIGWG
FT                   KVRSGGTLCEVVDPE"
FT   gene            complement(416658..417776)
FT                   /locus_tag="CND01490"
FT   mRNA            complement(join(416658..416794,416847..416991,
FT                   417042..417089,417144..417297,417359..417451,
FT                   417690..417776))
FT                   /locus_tag="CND01490"
FT                   /product="copper zinc superoxide dismutase"
FT   CDS_pept        complement(join(416779..416794,416847..416991,
FT                   417042..417089,417144..417297,417359..417451,
FT                   417690..417698))
FT                   /codon_start=1
FT                   /locus_tag="CND01490"
FT                   /product="copper zinc superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:CND01490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42978"
FT                   /db_xref="GOA:Q5KIW7"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW7"
FT                   /protein_id="AAW42978.1"
FT                   /translation="MVKAVAVLKGDSHVYGTITFTQDSEGAPVCVSGEIKNLDADAKRG
FT                   FHVHEFGDNTNGCTSAGPHYNPFHKNHGGPTAAERHVGDLGNVQTNGCGVAMVDISDKV
FT                   ISLFGPHSIIGRSMVVHAGTDDLGKGGNEESLKTGNAGARLACGVIGIAA"
FT   gene            complement(417978..419489)
FT                   /locus_tag="CND01500"
FT   mRNA            complement(join(417978..419149,419204..419489))
FT                   /locus_tag="CND01500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(418032..419149,419204..419255))
FT                   /codon_start=1
FT                   /locus_tag="CND01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42977"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW6"
FT                   /protein_id="AAW42977.1"
FT                   /translation="MSDSHTLTNGGGIGLRPAVEIPCSSEAAESSTSRSEAKFETPGSP
FT                   QTDSYLLSIRAAPVSPASSRPSSAAFSHSPSTPPSRTASPAASGRRRSESAASSPSRGK
FT                   AASNVRRRSLLGTNVALPGDDDEEEGSKEAADAGEGVPTIPEHSQLQTDDDGDSLGLEG
FT                   LPDGDGPKKVDQADDGKPVLSPYQAGLAATVRSIVVRDFAYHKTDDRYHGRNYEEEKWG
FT                   SPNDPETRWGEEKPLEEEKDDNAGGWGGFGFFGWRSRFGKQNEAEDGGAVNDQVDVVDG
FT                   DADEDYYSSPQPSEPDASGYAYKILPPLSPSLEPAGLYRAAYMFEGMGASEMSVDEGEL
FT                   LLLTGRGNGNPGWVIARRMRVEDGKVHRSEAVGLVPESYLERVEVLDAE"
FT   gene            419674..421077
FT                   /locus_tag="CND01510"
FT   mRNA            join(419674..420100,420202..420569,420625..421077)
FT                   /locus_tag="CND01510"
FT                   /product="ATP phosphoribosyltransferase, putative"
FT   CDS_pept        join(419793..420100,420202..420569,420625..421022)
FT                   /codon_start=1
FT                   /locus_tag="CND01510"
FT                   /product="ATP phosphoribosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42976"
FT                   /db_xref="GOA:Q5KIW5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW5"
FT                   /protein_id="AAW42976.1"
FT                   /translation="MSANSAPQPAQSESLESSTILLPPSGGDVSPSAGGGRASKSSFGY
FT                   ESTMSLLVDSLKDRLLFAVPKKGRLHEKCLELLNGADIKYNRAHRLDVALVQNMPIALV
FT                   FLPAADIPRFVALGSVALGITGQDVIAESTHAPLITELLPLGFGKCKLQVQVPVTGPIQ
FT                   TLEGLSGARIATSFEVLAGELFNGPNGVDAKVGKGKTSVEYVGGSVEAACALGMADGIV
FT                   DLVESGDTMRAAGLHAIHTLMSSEAVLITSATPHPNLTPSLASFIPLIKSRFAGVLASK
FT                   RYVYASYNIQRSNLAKALTITPGRRAPTVSPLDENGWVAVSAMVERKEVAKVMDELERT
FT                   GAEDILIMALDNCRVGV"
FT   gene            421333..423802
FT                   /locus_tag="CND01520"
FT   mRNA            join(421333..421464,421539..421677,421734..421857,
FT                   421918..422404,422451..422602,422661..423098,
FT                   423147..423636,423696..423802)
FT                   /locus_tag="CND01520"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(421419..421464,421539..421677,421734..421857,
FT                   421918..422404,422451..422602,422661..423098,
FT                   423147..423636,423696..423742)
FT                   /codon_start=1
FT                   /locus_tag="CND01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43094"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW4"
FT                   /protein_id="AAW43094.1"
FT                   /translation="MTSVPPPYSSRDHAQAQPGPQSSNVSSSSPTQEFSETTSVCLEWK
FT                   ITGLKSMYEGTRGEQKSKCVKSAVFGDVDTTWETLFYANSGASHQTAGDHVSLYLSCVP
FT                   TSQERNSKLAGQWTRKGLWWFKFEIRPAPTAANPKPDPIASKDASDHTFAVKTANWGWQ
FT                   AFAKRDLVFLHPSVMAADSFVIVCTIQAQPQPPAGFWLGVGLQPGQGVGVNTRGIGSGG
FT                   GLSAWSTEHGYGGVAGGTTAGGGARKVVPKELITSVGSLLDDPLYSDVEFIIPSRRGMP
FT                   PKKIYAIKKMLERWDYFEAMFNGGFGEEERAIAEDEDYNDDELDILSDSDMGDESGIFE
FT                   DEEAPESPELGGLTTTTSRASSTPPLNQHRHIASSDFTGKPEAGDDDGEKATIPGGLGN
FT                   PVELGNRQPEGNQEGKIDEEGTINKEVRDEGRTGKKKEVLGPKKTRIVIRDAAWCTWWA
FT                   LLYWIYTDVIYFAPLSSSFEHDPKNMGATAPDTDSEEPQTRLDWIHRWMAEHDIDLQPD
FT                   PSSSSAFSSSFYELHLGPRPVSAKSIYRLADKLGLLPLKLRAFQHICSQLTARNVPAEV
FT                   FSRFSSTFEDIRKVEVACFLKNWAEIKKSETMMQIWKNIRHGKHVGFEEVWPLIVGQLD
FT                   FKPAV"
FT   gene            423967..426581
FT                   /locus_tag="CND01530"
FT   mRNA            join(423967..424162,424263..424399,424455..425052,
FT                   425119..426071,426130..426581)
FT                   /locus_tag="CND01530"
FT                   /product="nuclear cohesin complex protein, putative"
FT   CDS_pept        join(424045..424162,424263..424399,424455..425052,
FT                   425119..426071,426130..426300)
FT                   /codon_start=1
FT                   /locus_tag="CND01530"
FT                   /product="nuclear cohesin complex protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43049"
FT                   /db_xref="GOA:Q5KIW3"
FT                   /db_xref="InterPro:IPR006909"
FT                   /db_xref="InterPro:IPR006910"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039781"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW3"
FT                   /protein_id="AAW43049.1"
FT                   /translation="MILNELIKSGPLAKIWLSAHQERKLSKTQAMGVDVGESVEAILTQ
FT                   DAALPLRSSGPLMLGVVRIYSRKVGYLFDDCKEARERISLAFRPGIVDLPEDQVRASHN
FT                   AITISSRADFDFNDWTWGPSNFLVPPQPSQAAVTTTVLPGGQAFGAFNFGVPRAPSIYG
FT                   GSETAASRHGSHDEFSSQLGSNEFSGIDLGLNLEGDETIEYGREVMTPISREGSAFAAR
FT                   ERSIRAGTLDLAGFGGEGIGDVLPPMAPMDDYDVEMAERMEPFEPMDLGLDFEQEIERA
FT                   RRATTELLTPPPPTPPQESISDLTPRTAAQISAHPAPPVKAAKKPRLVMPDHETELTQE
FT                   LYDRAAILGAEHFIPANLELLHLNEIVSDPASHFLPTLKIGGENWTAVAPLGLAPELTE
FT                   LFAFPSNVLRKGRGLEEAEEDRPAKRARREGEIEAEAEAEAEEDVEEQLRQAEEDVEVV
FT                   RRHEFDVGFNAAEEAFVPAFVGDDGDYGIGIGDEMPMEPMGASPPAFGISRGPSLAPSR
FT                   AESIAREIEYGGPEGDFTLAMFDTRSSRAAESQLSQVPSSPSRAESQKEGAPGRHTSMA
FT                   MGLLRRELEAIEEEDKVVSFEKLADKATKRAASAFFFELLSLGTRDCIKLEQPEPFQDI
FT                   KIRGKDKLWPFPSQTASQLGSEV"
FT   gene            complement(426455..427587)
FT                   /locus_tag="CND01540"
FT   mRNA            complement(join(426455..426704,426762..426849,
FT                   426901..426969,427021..427184,427234..427587))
FT                   /locus_tag="CND01540"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(426627..426704,426762..426849,
FT                   426901..426969,427021..427184,427234..427587))
FT                   /codon_start=1
FT                   /locus_tag="CND01540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42975"
FT                   /db_xref="GOA:Q5KIW2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW2"
FT                   /protein_id="AAW42975.2"
FT                   /translation="MAHATPHPPPGAAPPVPLSAAHLSLLDALPHSHVAHALKTVAVPA
FT                   NAPPDIAGKSFALVVCSLHDQQKCDQCAVDFSPVNFLHQFLRFAPAEAIPPPPNVAPPP
FT                   QRAQAVTNLKEAGNNAFKAQKFDVASQFYSKATDAALSRPPWEPAALGREEVAITLCNR
FT                   SASNAFSGKWAAALADAQTVINLKRPWTKGHFRKARALVGLERYEDAKQAVIDGLQYEP
FT                   NDKELNNFLQEIEEKIKEADAAFPDTIQ"
FT   gene            427757..429577
FT                   /locus_tag="CND01550"
FT   mRNA            join(427757..427853,427952..428140,428196..428387,
FT                   428442..428619,428686..429034,429101..429577)
FT                   /locus_tag="CND01550"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(427849..427853,427952..428140,428196..428387,
FT                   428442..428619,428686..429034,429101..429294)
FT                   /codon_start=1
FT                   /locus_tag="CND01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42974"
FT                   /db_xref="GOA:Q5KIW1"
FT                   /db_xref="InterPro:IPR038872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW1"
FT                   /protein_id="AAW42974.1"
FT                   /translation="MPVFSGSLLSKRKPELVEIGAALGLPTDDIRVTDLVKSIQAHLDA
FT                   NEAQLASDPTFKGLFYKKRSSHGNGGGNGSHTPERSSSPTTRAEIKKLESGASTARALT
FT                   NKASDRLQEVADAAKVPLPESPVALSRVSDATHAISESVQNALVPASVPSGEISSKLQD
FT                   IAQQLLQIQHRGQERVNIGIRHTRDVISTPQALTITALSAELLFLLGHVLPFYNYTYFF
FT                   PPIPGKSGTLSSLVHSLFSWSPTFSWTLRLPEASGLVSSELWGAIAWWVFSTVLPPLAL
FT                   STVVSFVPQKGVHRHNTPRTRYQETHLPQPTPDPLVFALSRLAILVLPLTSAAPTSLVD
FT                   ALEMSGNLQGRALGAALFAGLILAAKLA"
FT   gene            complement(429619..432488)
FT                   /locus_tag="CND01560"
FT   mRNA            complement(join(429619..429739,429796..430112,
FT                   430173..430251,430361..430427,430504..430620,
FT                   430711..431022,431099..431317,431377..431480,
FT                   431557..431986,432046..432488))
FT                   /locus_tag="CND01560"
FT                   /product="Gamma-glutamyltranspeptidase 1 precursor,
FT                   putative"
FT   CDS_pept        complement(join(429660..429739,429796..430112,
FT                   430173..430251,430361..430427,430504..430620,
FT                   430711..431022,431099..431317,431377..431480,
FT                   431557..431986,432046..432456))
FT                   /codon_start=1
FT                   /locus_tag="CND01560"
FT                   /product="Gamma-glutamyltranspeptidase 1 precursor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42973"
FT                   /db_xref="GOA:Q5KIW0"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIW0"
FT                   /protein_id="AAW42973.2"
FT                   /translation="MPPIAASPPNHDENAPLLASPSLEAGTTGPPTPSPPWQFWNRPPF
FT                   RRVHFADHDQFVSPASAHSESELSADGNGGYGTNPKYPRQPLQQEEKMGQWMMYCLLVL
FT                   VGMVFGALFSRNWSIKGDAGDMPMVPPVWTLPPPTGLPRNDAYLINATTAAVASEDVTC
FT                   SNLGLSIMQDKNGSAVDAAITTTLCIGLLNAFSSGIGGGGFMVVRVPETHEVKDQALRD
FT                   IGYDGELEESRVVALDFRETCPSNCEKDTYGTHKAGRMAAQVGGLAIGVPGELRGLEAA
FT                   HKLYGTLPWKDVVMPVAELAKGWRVSRELARRLRLFGDFMLSSPTWSAVYAPRGPLLVE
FT                   GDFIQRLNYGKTLKKIAEEGASAFYQGEIAESSVKTIAKAGGVMTLDDLQSFKALSYPA
FT                   IHSTFMSKEIYTTSAPSSGGIMLGLLNILEPLNITSNNGLKNPLNLHRFIEALKFAFGA
FT                   RSWVTDPAFAEDRKRLEEVYTKEWANEIREKITDNETHSADYYGLQYDTPIDHGTTHLS
FT                   VVDKWGGAASVTSTINLIWGSHVMDPKTGIIFNDEQDDFAVPGAPDAFGLWPSPWNYPA
FT                   PGKKPLSSTSASIILNPATGSSPSPSLYAVVGGSGGSRIFPSVAQVLLNLFSGLGISQS
FT                   IEAYRVHNQIVPDLTTMEVGPEGVDEEVVKGLKERGHKIGEFDVNIGISEVQAIVLEDG
FT                   HIFASSDSRKNGIAAGY"
FT   gene            432701..434859
FT                   /locus_tag="CND01570"
FT   mRNA            join(432701..432960,433018..433111,433164..433651,
FT                   433709..434158,434216..434323,434387..434595,
FT                   434653..434859)
FT                   /locus_tag="CND01570"
FT                   /product="succinate-semialdehyde dehydrogenase, putative"
FT   CDS_pept        join(432745..432960,433018..433111,433164..433651,
FT                   433709..434158,434216..434323,434387..434595,
FT                   434653..434773)
FT                   /codon_start=1
FT                   /locus_tag="CND01570"
FT                   /product="succinate-semialdehyde dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42972"
FT                   /db_xref="GOA:Q5KIV9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV9"
FT                   /protein_id="AAW42972.1"
FT                   /translation="MPIRSPTSLSLKRSSHFTTATRRLHTSTPTLIAAASLSKKLQRFS
FT                   PQLTPRLLAPNGSRTMSNWPKVTSENPLGLDDPSLFIQKGFINGQYVGTQSGKTFEVND
FT                   PASGKTIGTCPEMTVEDTRHAIEVAEKAFATFRNTSPVQRSNWLSELYRLYQASIKDIA
FT                   RLIVWENGKSWNDAMAEATYAGTFFSWFAGEALRTYGDVIPCSVPGTRNFSIKQPIGVV
FT                   ALLCPWNFPAAMIARKMGPALAVGCTSVIKTPSETPFTTLAIIELARRAGIPDGVINVI
FT                   TTDANLQDVGKELCTNPAVHKVSFTGSTRVGKILASQCSSTLKKMSLELGGNAPLIVFE
FT                   DADIPTAVAGTIASKFRGSGQTCVCANRIYVHEAIYDEFAKKLAEKVAEFKVGPGFGEG
FT                   VTHGPLIHSRQADKVEEHVQDAIKKGAKVLVGGKRGNGTEYIPTVLTNVSDECLIATEE
FT                   TFGPVAALFRFSSEEEVVARANRAEVGLAGYFFSRDSDRIWRVAEALETGMVGANTGMI
FT                   SQAVIPFGGIKESGYGKEGGRQGTEEYTITKLVAVGTSLHNMPK"
FT   gene            complement(434834..436032)
FT                   /locus_tag="CND01580"
FT   mRNA            complement(join(434834..435233,435296..435402,
FT                   435476..435628,435682..435937,435985..436032))
FT                   /locus_tag="CND01580"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(435008..435233,435296..435402,
FT                   435476..435628,435682..435937,435985..436016))
FT                   /codon_start=1
FT                   /locus_tag="CND01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43345"
FT                   /db_xref="GOA:Q5KIV8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV8"
FT                   /protein_id="AAW43345.2"
FT                   /translation="MATDPYTDLKREVEASLSTIHSLTQNHPDIFRKSSSPEIVQAQDE
FT                   LRGTLSMLETDVEDLEESVRVVEDMGERWGLGTNEVHKRRDFAQRVKREVESLRHKVYH
FT                   LGPSNSKGKGKDGASGRYRDEPADLERGYDEDEVRRWEAQEQEMLVKKQDDTLGIISGT
FT                   LHTLASQAGLIGHEVHEQNEMLDDLSTRVEHTDSKLRKVQRTMGDFIRRNEGESLEFQC
FT                   YRKDLLTARAETKSGWCILILIIVLMILLLLVIIT"
FT   gene            436206..437918
FT                   /locus_tag="CND01590"
FT   mRNA            join(436206..436459,436517..436976,437032..437565,
FT                   437615..437918)
FT                   /locus_tag="CND01590"
FT                   /product="regulation of amino acid metabolism-related
FT                   protein, putative"
FT   CDS_pept        join(436232..436459,436517..436976,437032..437565,
FT                   437615..437841)
FT                   /codon_start=1
FT                   /locus_tag="CND01590"
FT                   /product="regulation of amino acid metabolism-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42971"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV7"
FT                   /protein_id="AAW42971.2"
FT                   /translation="MLTRRARPFLTPFLQRPPIPFLHRHIASLRPSMAQYADSLADALA
FT                   SLKLPSGPEHLESQRRSAPEPLRDPHGTLLKSTPLTTQFIEHLLSEENFENDPNLAAIG
FT                   YELEALLSIYGDESVRLAFTSRPPSRSSQLADIPNSERRGSQQWTDAVWNAEIGFTPGE
FT                   RIRYEVSLPVWEEGDTLEGVDPTLMPHKAPIMRILVSLPPTYPNSSPPQLQLLGRYLGS
FT                   FAIDSGLFGNITRTYISSDGAPFNPGDVCVFEGLTHVQSLARTWYSQQLASGAAREAQR
FT                   NPQITVSVSNSPEASDNEDAGYSRRLSPRPMFSYTRTASDTPPTEAMLRIEAGKDHGLK
FT                   VWVSEEVVDRKSVFVGRAVKVTDERDVPLVVHELLGDKRVARAAHPAIYAYRIAKDVGG
FT                   TAGKVYNTDYDDDGESQAGGRLRHLLEILELENVMIIVTRWYGGHKLGADRFKHISKVA
FT                   RDALEIGGFLDEKKDSGKGRKGKK"
FT   gene            complement(437862..439312)
FT                   /locus_tag="CND01600"
FT   mRNA            complement(join(437862..438876,438957..439312))
FT                   /locus_tag="CND01600"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(438035..438876,438957..439113))
FT                   /codon_start=1
FT                   /locus_tag="CND01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV6"
FT                   /protein_id="AAW43346.1"
FT                   /translation="MNRSSVIVDDDDEDDEFAGIESITASQWVRDPIVNRHGGPSSSSK
FT                   HSSQDATERRQFQTPELSHFNTSDPVSLPVPQTPCSSPRQSHPSTPISWSPSPPPLPSR
FT                   IRKAFPGAIEDKENVPPSSGSTERASKGSLGKSKRRRMVIDSEDEEVITAQKQRNDKGK
FT                   GKEPEVIEILDESMPDERWIGHVDYNPTEDYYDPYDEPYDNYDPLPFNNQDPVSTSPRP
FT                   LGDIPHIDPIQHPPDGPVAATSVLGTMDYPLTMISDLDDRLQEFYTTHFRRGADKDINS
FT                   ALKNPRAAGDDDESGTRGGKAKKATSFRKKSWPRRGWNNTSSRSRSKAKKK"
FT   gene            439469..439576
FT                   /locus_tag="CND01610"
FT   tRNA            439469..439576
FT                   /locus_tag="CND01610"
FT                   /product="tRNA-Lys"
FT   gene            complement(439664..441260)
FT                   /locus_tag="CND01620"
FT   mRNA            complement(join(439664..440423,440475..440533,
FT                   440586..440806,440858..441260))
FT                   /locus_tag="CND01620"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(439836..440423,440475..440533,
FT                   440586..440806,440858..441213))
FT                   /codon_start=1
FT                   /locus_tag="CND01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42970"
FT                   /db_xref="GOA:Q5KIV5"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV5"
FT                   /protein_id="AAW42970.1"
FT                   /translation="MDPTTQARPADDFFKSTEPSHAVPAPVPTPADINNQRQQQQQQQQ
FT                   NSAPEATGIRQRVNKLSHSVEDAASHPAVQNAKQVAVNQTRGLRERLGKSPTIMKLERR
FT                   TGIDRVALVGGGVLLYILLIPVNIFHLALPTTQLLTVLPAAYLSAQVLDSSESSANDEK
FT                   VKSLLSFFVVLGCIQTLESLMAGFLEKRIPQYYTVKLLFLAYLLHPKTQGAKKIHESVF
FT                   RPLIKNRDSPLSPAKVYPSSTSKTDASATGSTNDSVPSRGEGTGTPPTSRSSNSNIASS
FT                   PIHSNNPFTSDDSSPKAVPQTTSATSPPDFDRNFGALSSTFASSSGSENVTGHQAPTLA
FT                   QLQATTGSAAADSSFPPPRVQAQQALAHAVQDSGVDTTEPIDPSRGDGNVTMADAEGQN
FT                   FRVVNELH"
FT   gene            442023..444560
FT                   /locus_tag="CND01630"
FT   mRNA            join(442023..442181,442237..443701,443791..444367,
FT                   444416..444560)
FT                   /locus_tag="CND01630"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(442273..443701,443791..444367,444416..444497)
FT                   /codon_start=1
FT                   /locus_tag="CND01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV4"
FT                   /protein_id="AAW43337.2"
FT                   /translation="MAKAKTPPPPSALHSYEPPTEVASHPPSQRHHHDHEHHHHHSHYV
FT                   RSVSPGETVKGTIEEKQVDELKEEKIVEAQVKVAPELVAPPVIASAKASTNAKSRAASV
FT                   EAPSAAATISHITRTKSILATTSAPAQVVEVVPAAPSASSIAAPPTTVVPSVKARPSKA
FT                   PSVKPVNRRPSVKVPSIIPPSLTSSHRSRYSHHHPEVIVNVTIPQAVAAPAPLSPPVIA
FT                   AVLPAPTVIEGTVKETTAEKSSPLVVPATVPPTTTQASTIVTSPAAPPSPSPSTRSRLF
FT                   RLHSTKPTTAPLPPVAPTAGEQGVEGEPEEEIVEETKVVTTTRTSKRRPASPPKVSETG
FT                   SRYVENILEEEAPAHPPPPPPPPSTKPKSVKSRPKSLASLSPLPSAPNTPVTMKCHFFG
FT                   SKSSPPPPKTRTVETTTVETVSYPLLPQSVEEADVDTAATTAGGPTTKGIRGARSVALT
FT                   ASSGRMSGTKAGIRPIPMVDYQALMKRSPAPSQKKSLSPPTVPAAPAPVPSTTVEVTTA
FT                   PAQAVAATELPPATTVAVTAAASSTGPPPNALPPSTAPPPSTLERTTVAMEATALTSPK
FT                   TIMTLSAQLDKDSHGNEHLHARWRDHTNVNEVDLNTGHDAGEHVETTESPGETDKERTR
FT                   REKREKKEREKRDKLANSAPYRPVGALPPPKSERYAYPPAPTEIGRQARERLSEKTGRG
FT                   G"
FT   gene            444643..446795
FT                   /locus_tag="CND01640"
FT   mRNA            join(444643..444886,445055..445085,445168..445274,
FT                   445338..445358,445426..445654,445886..446041,
FT                   446097..446795)
FT                   /locus_tag="CND01640"
FT                   /product="expressed protein"
FT   CDS_pept        join(444712..444886,445055..445085,445168..445274,
FT                   445338..445358,445426..445654,445886..446041,
FT                   446097..446652)
FT                   /codon_start=1
FT                   /locus_tag="CND01640"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43096"
FT                   /db_xref="InterPro:IPR028018"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV3"
FT                   /protein_id="AAW43096.2"
FT                   /translation="MFNPMMLNPMMSGYPMGTMGMPMGMGMPMAAPIPGIMPGMPGVGN
FT                   LPRGWFGRDQLGRDFAGPGGVGSSQPYRPPDPSALPPMPFGLPFIARPGQEGFDQYGRM
FT                   LPPTLPEGWDGWGRPIVAAGANPPAPAVQPLQEPPAPLAQPRTRAVPRTTQPSAIGGST
FT                   YGYPNQSGSQTSTLVSETATNRPDQPPCFDRPPAQHDSYYRYEPFEAFSFSAKLLNHPH
FT                   QLHLPPELVSRDVNEQDWMKFIEDFAREALHGASHSLTRQARGQHTGPDPILSEAVHSL
FT                   LASWAVAFFAPRGIRVYAAQNGKKVIPPPIGPSHSTRGYSHASEWSDSETASDDDFGYG
FT                   SEDEKERQARKGDMYLPKREREIRRSERIRMRKRERRRRMREFELKNGENREAWEIHFV
FT                   PATPTIWLPGARPRTYGEPVVRLKR"
FT   gene            complement(445879..448042)
FT                   /locus_tag="CND01650"
FT   mRNA            complement(join(445879..446747,446798..446846,
FT                   446908..447066,447140..447244,447306..447387,
FT                   447451..447633,447687..447755,447815..448042))
FT                   /locus_tag="CND01650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(447150..447244,447306..447387,
FT                   447451..447633,447687..447755,447815..447961))
FT                   /codon_start=1
FT                   /locus_tag="CND01650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43097"
FT                   /db_xref="GOA:Q5KIV2"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV2"
FT                   /protein_id="AAW43097.1"
FT                   /translation="MSSPSLLLPGQPLPAQLITPPLPKCGKGCYERNGQILASVVGRPR
FT                   RDGAVVSVIGREETVGTVDVDSIVIGVISRLTPQQAHMTLTTLSDRPLPESSEDFTGLI
FT                   RIADIRLTERDKVKMGECFRLGDIVKAKVLSLGDARSYYLSTAADELGVVYAKSEAGNP
FT                   LLPVSYQEMEDEVTGKKEKRKVAKPEGI"
FT   gene            448259..449576
FT                   /locus_tag="CND01660"
FT   mRNA            join(448259..448310,448405..448433,448489..448539,
FT                   448596..448722,448775..448899,448950..449252,
FT                   449305..449576)
FT                   /locus_tag="CND01660"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(448289..448310,448405..448433,448489..448539,
FT                   448596..448722,448775..448899,448950..449252,
FT                   449305..449517)
FT                   /codon_start=1
FT                   /locus_tag="CND01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42969"
FT                   /db_xref="GOA:Q5KIV1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV1"
FT                   /protein_id="AAW42969.1"
FT                   /translation="MSRSYDRALTVFSPDGHLFQVEYALEAVRRGTCAVGVRGKSCVVL
FT                   GVEKKSTLQLQDPRTVRKVAMLDDHVCVAFAGLTADGRILIDKARIECQSHRLTVEDPV
FT                   SIEYITKHIAGIQQRYTQSGGVRPFGISALIVGFDPHDTIPRLYSTEPSGIYSAWKACS
FT                   IGRASKTVREFLEKNYVEDLEREQAIKLTVKSLLEVVQTGAKNIEITVMESYGVVKALE
FT                   QSDIEKIVAEIDAEKEAEAERKRQRLAATQAGQASMAMGSSVPSGTETPAGRPQEHASA
FT                   PGGDSGVQ"
FT   gene            complement(449543..450912)
FT                   /locus_tag="CND01670"
FT   mRNA            complement(join(449543..449785,449830..449928,
FT                   449975..450333,450385..450501,450554..450704,
FT                   450784..450912))
FT                   /locus_tag="CND01670"
FT                   /product="geranylgeranyltransferase beta subunit, putative"
FT   CDS_pept        complement(join(449582..449785,449830..449928,
FT                   449975..450333,450385..450501,450554..450704,
FT                   450784..450855))
FT                   /codon_start=1
FT                   /locus_tag="CND01670"
FT                   /product="geranylgeranyltransferase beta subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42967"
FT                   /db_xref="GOA:Q5KIV0"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIV0"
FT                   /protein_id="AAW42967.1"
FT                   /translation="MSLAATSQPLNKSLHIKYIQDLDKKKDLAYYITSHLRLNGIYWGL
FT                   TALYMLGQPEALDREGVIEYVLSCWDDETGTFGPHPGHDGHILATLSGIQVLLMEDALD
FT                   RADIERIISFLLKLVNPDGSVSGDKWGESDTRFSYILLSCLSLLGRLSSLTDEQIEGIT
FT                   ENIRKCMNFDGGFGLSPGTESHSGQVWVCTAALTILDRLDLVDRDLLGAWLSERQLPNG
FT                   GLNGRPEKLEDVCYSWWCLASLSIIGKIHWVNADKLINFILSAQDLDDGGIGDRPGDWV
FT                   DVFHTIFGVAGLSLLGYPDLRDIDPVYCMPADLISRLGLRRPYSVLPRRSAQ"
FT   gene            451019..453980
FT                   /locus_tag="CND01680"
FT   mRNA            join(451019..451413,451462..451808,451861..451992,
FT                   452041..452056,452110..452235,452283..452401,
FT                   452454..453618,453676..453980)
FT                   /locus_tag="CND01680"
FT                   /product="mismatch repair-related protein, putative"
FT   CDS_pept        join(451116..451413,451462..451808,451861..451992,
FT                   452041..452056,452110..452235,452283..452401,
FT                   452454..453618,453676..453911)
FT                   /codon_start=1
FT                   /locus_tag="CND01680"
FT                   /product="mismatch repair-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42965"
FT                   /db_xref="GOA:Q5KIU9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR028830"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU9"
FT                   /protein_id="AAW42965.2"
FT                   /translation="MPNILPLPRPTSTTLRSSIILPSLAQIFSELLQNSLDAEATKIEC
FT                   YVNLAKGNETLRVEDNGTGISKNGLAKIGKRFRTSKEIHEGGLGPVGSYGFRGEALASI
FT                   ASLSLLDITTRRASFPVYTKILRHSKTLFEGPNPDRHIAGGQGTTVVVREIFRTIPVRR
FT                   EELAATSSTLLMSQLKKVVETLALGNPGVRWVLWEEKTTTTGGLKRIMSINASDSALDV
FT                   FKTLYGGALVQSVQKIKVTAGKRKVDGFISISGDVSKAHQHLYINNYPIDRGDVHTAIA
FT                   KKFASSKFANLASAGQHDEDEDYHPSGRRSPRRLERYPVYVLNVTLSAGELDVSYEPQK
FT                   GVLGYKDIESLKTMLLAVVDEFLRRNGFGPAHTPSSMSSPTKRPVSHVSQPVGRLASAL
FT                   GRPSPLSLSSLRTNTPVPRPMSLALPSKDSPKRVASHLSEEAPDSTKRRRLMSPEKTIT
FT                   PRISERGTRKSKWIDDLLAKLNTGVFPLSPHTFRTTDHEHDFTGDDVASMAGCSYEPTN
FT                   PVSLPSPFPFTTDVQISKSSLSNATVLGQVDRKFIAVVLSTNINLTTLALIDQHAADER
FT                   VAVEKVLLELCEGFAKDDLLVAELAKTRPMIILTQAEAQILSQPWVLSLFKRWGIRLTM
FT                   PPGLSHGEYIQVKVETVPLSLLSRLGRKEGSEMTRLVRGYLPIVAEHASEITVLVENLE
FT                   GKAMEDNEGGDTEGYGGDWGRLMRFMPREMLELANSKACRGAIMFEDRLSHDQCDRLIQ
FT                   QLSQTRFPFMCAHGRPSMVPLVILNEQQDKPVTKAKRKINWDNLRNKTYEGNMDGENDE
FT                   "
FT   gene            complement(453970..456531)
FT                   /locus_tag="CND01690"
FT   mRNA            complement(join(453970..456293,456346..456531))
FT                   /locus_tag="CND01690"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(454036..456293,456346..456466))
FT                   /codon_start=1
FT                   /locus_tag="CND01690"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42963"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU8"
FT                   /protein_id="AAW42963.1"
FT                   /translation="MPFRARCNPANLLQRRHAVLALRKARTPLLSSVQLIQEPIRNDVM
FT                   YQTRLSSTTSLLSPFTSFFSRVRKSQTPETAAEDFANALQTRSFEAMSKAYYMVVNDPI
FT                   PSNLLSEEQLLGAMKALAESTTKTPKALRLLRRIYEDFPTRFGYPVRRDHKHVVFQGLV
FT                   NCGMVREALEIALSMDKKDVNWRLMLRAAVDADIALSDIVIQRFRETTPLNQEDYILLL
FT                   RIIRSHPSQNKKRLEPLLAEMEQKGVTLNQNIQAEVMQVHIAYGELEKAKQIMEKWDFF
FT                   TLEGVGPRMWDAQVQYYIAVHDLSKLQTTVLSMRDAGLTVQQNAILALALEQLDQFIDS
FT                   KSKVLYSDVIAAIHAAEQMAGTEPGSKVWAEVIRHYLQNVKHREALEVAMHLYEECQGR
FT                   GVTLDVELTRTLIIPLCSSRKQTRLDDALRIYDQYMSLASSAELESENTRLRFAEVYEK
FT                   LLVACARTQPPPMASVIRLLDDMRTLSLDFTPTNLISLLILLMRASPDHISAYNVYSHF
FT                   HALNPNAIDRAGFSAILTTFLNLSWKHSPLTPPDLFISMMKDMDRAGYSPSPYILSSLL
FT                   KQYGQLATRARRGNTVESEESINGITKAIRDVHTLVKLDPLISPDIPLLTALMDAYGRV
FT                   GAFFEAFEVWDELVQRRAREPRETVQEVYGAAINVMLDTCGWSYSLGKARKSWGWARRW
FT                   GLVWEKKQWDGWIECLCRCGEVEEAGHVVLEEMGSGAIPPPDKETVRLLYKFGRKQRER
FT                   GRNVAGIDRLMVRVRERWPQWVEELSNERGSTRMNKSTE"
FT   gene            456678..462025
FT                   /locus_tag="CND01700"
FT   mRNA            join(456678..456887,456934..456991,457045..457181,
FT                   457229..457304,457356..457804,457854..458104,
FT                   458153..458457,458503..458660,458709..459121,
FT                   459184..461293,461351..462025)
FT                   /locus_tag="CND01700"
FT                   /product="translation repressor, putative"
FT   CDS_pept        join(456760..456887,456934..456991,457045..457181,
FT                   457229..457304,457356..457804,457854..458104,
FT                   458153..458457,458503..458660,458709..459121,
FT                   459184..461293,461351..461921)
FT                   /codon_start=1
FT                   /locus_tag="CND01700"
FT                   /product="translation repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43343"
FT                   /db_xref="GOA:Q5KIU7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU7"
FT                   /protein_id="AAW43343.2"
FT                   /translation="MATKNALKSIKAHLGEKNSESALYEATELLKSIGPDSPEADQVLV
FT                   FRGLALTQLQRLDEAEKSYLHAYKLNPNNPLASVGLRRLYHKNQSWEKLATFLEVQVQT
FT                   TFEKQDDEKLAEVLKELLEVREQHGPEEKLYRTLDLLLPSSPVAGLLQSVTPPQGTYIP
FT                   LAIPVYPSASDILPTLPSPLPHPVHLAGSLSLALVSLIRSEIEIKQKIDARVNNERKRL
FT                   GAGTEKDVRRKVDREILGTEGMRLVDLWKEIAGHPQVEEEIRREVEIREFEFWRRLVAA
FT                   LPVENKIASKESAGKASQAEMPANASNELVEPALFKAKQYVAPNRTEALSHVNALADGF
FT                   VLLDISAKGAEEGWRWVLEGKDEPTLFYDIDLLHKYSEAFPNSPMACFIEEYCRWFKRP
FT                   LPETEEDSSKTEAYERDEKAEGSVKHRKSHKGGRGALTKRQSRRAHLREIHVSEDVEKE
FT                   EREELFSSMTKLVDQLPMSIFAHRVMARIALEDEDWSSAISFAEKARKLLTGLEAERGI
FT                   TLSNVRADLDTVLGVALVPHYPPKHHVRAARILETVLKIHPTNNEARFARAQIYETAGQ
FT                   WSDARHHFEKIVQDGGSEKERLDSKEEVGWCLANEGKLEEGRDILEEVIEVRDTKTEKE
FT                   KEAEARERGRTWWRLGRTEWMIGDEESKQHAEEWFMASVRAHPDFAASYTSLGVCYSSA
FT                   TPPDNERALKCFQRAFELDATETDAAYRLANGYADEDEWARVRTIAVRVMEGEGGLEGV
FT                   AGGDVLNAKGRFAPQNGWAWKALGSSEMHYKKYAEAAAAYQIALRADDQDVSTWIMLGE
FT                   SYVKCGRHMAGLKTFDHALTLDPDNWRALYNIGQTQSQLGAFDKAIEAYQKVLEITQDE
FT                   DVGVIAALAEANLSLGRQTGTGGFRERSRGAFHRAIELAMKVLKSGKAHKAWGWKLIGD
FT                   ATYELSGQESNIEEAQDSFTVVQPVLIFLVEDDTDRRSTTPGVGHAANLLQDVVSTTTS
FT                   LRASIFAFAYRAHILKNEPRVIDPALYDYASALHTLAGKLIESDERKQCLKTAISAVRA
FT                   ALDRNAGDERLWNALGVICATAGPQVAQHAFVVSLELYSKDPVVWVNLGYLYLHLDDLD
FT                   LANQCFLKAQIIDPDSARAWYGQGLLADRHGDKEHAKALFSHSVTLSAQSLLEADLALA
FT                   AATFAQFFRPNASVDSSLLHQPAFALKHYCHQRPRDSTAAHLYALICERLGLVEEAALS
FT                   LENAAAVLEEEFERVESGEIENLYSVALCNLGRVRLSAGVYLESLDALNNCWELIASSS
FT                   EPSAVSLKPQCKLLQGLAFYWLGQIDESLEAFQASLDAATQNQDYDVKEKVAVLLSRTL
FT                   WGLGGNDAKETAKSNLMECLARERPSLGVISTLAAIALVSSDADLTNAAVSELLTRPIA
FT                   ERVQDPSGQANLVLYLQAISEGREEDAYNTLQSASQAAPASRSIRNRLVEALIKAGKSK
FT                   EALDVLAVKNVKEGTAEVKAKEERLLGIGELMEGDAKGMKGVVRSVMLAPWEDESWQAL
FT                   AWGKKVVEEAGLIETKDGAKDDAATKLDLTE"
FT   gene            463316..466304
FT                   /locus_tag="CND01720"
FT   mRNA            join(463316..463987,464038..464320,464372..464598,
FT                   464646..464956,465015..465288,465339..465526,
FT                   465579..466304)
FT                   /locus_tag="CND01720"
FT                   /product="carboxypeptidase D, putative"
FT   CDS_pept        join(463762..463987,464038..464320,464372..464598,
FT                   464646..464956,465015..465288,465339..465526,
FT                   465579..465701)
FT                   /codon_start=1
FT                   /locus_tag="CND01720"
FT                   /product="carboxypeptidase D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42959"
FT                   /db_xref="GOA:Q5KIU5"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU5"
FT                   /protein_id="AAW42959.1"
FT                   /translation="MWCKLLTTALLAFALGSVVGTARYTHGLRGRRPAALASMREAKRE
FT                   ALARETSRMEESRALLERHPKRKFYNNRTSEFFIKYLPDVQFDLGEVYSGLIPIDYNNQ
FT                   SEALFFVFQPKLGKDSKDLTIWLNGGPGCSSLEGWFQENGLWIWQPGTYAPVINPYSWV
FT                   NLTNMLWVEQPIGTGFSIGTPKATTEEEIAQDFIKWFKNFQDIFGIKNYKIYVTGESYA
FT                   GRYVPYISAAMLDAQDKTYYNLSGALMYDPTIGETINVQEEILTYSFVEANANLFNFNK
FT                   TTMAELKQLHEVCGYKEYIDRYFKFPPTENQPPLFFDYNDPVDIMCDIFGMVNDLALQI
FT                   NPCFNIYGVNLMCPLPWDVLGMPTQLNYAPGGVYFNRSEVKAAIHAPKHIEWAGCAASP
FT                   VFVGGEGGPQSNGDLSVDPIQKVLPRVIEATNRVLVSNGDFDMVIITNGTLLAIQNMTW
FT                   NGHLGFQSPPSEYIVIDINDTQWSSVFESNGLHGYPGTQGVMGIQHYERGLMWAETFQS
FT                   GHMQPQYQPRSAYRHLQWLLGHVDRL"
FT   gene            466963..468194
FT                   /locus_tag="CND01730"
FT   mRNA            join(466963..467104,467279..467366,467426..467441,
FT                   467509..467602,467655..467725,467780..468194)
FT                   /locus_tag="CND01730"
FT                   /product="expressed protein"
FT   CDS_pept        join(467093..467104,467279..467366,467426..467441,
FT                   467509..467602,467655..467725,467780..468002)
FT                   /codon_start=1
FT                   /locus_tag="CND01730"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42957"
FT                   /db_xref="GOA:Q5KIU4"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU4"
FT                   /protein_id="AAW42957.1"
FT                   /translation="MVDVSTHIRRGHPAFMGALLLFAIIEGCITAYLVAQFNDDDTYPS
FT                   HSYRDRLKFLVFTSWWTVVFAAAYMAAFLAAAGSFVSSIASHLAIWTVTWIFWLAAAAS
FT                   YTAALGGGMRCSVSDVAHCSSLVAAEAFAWIEWIIMTIFFIFLLTIAGAALRRGDRLSA
FT                   ELAV"
FT   gene            468519..470072
FT                   /locus_tag="CND01740"
FT   mRNA            join(468519..468831,468886..468916,468967..469317,
FT                   469379..469632,469686..469748,469803..470072)
FT                   /locus_tag="CND01740"
FT                   /product="ceramidase, putative"
FT   CDS_pept        join(468786..468831,468886..468916,468967..469317,
FT                   469379..469632,469686..469748,469803..469951)
FT                   /codon_start=1
FT                   /locus_tag="CND01740"
FT                   /product="ceramidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42955"
FT                   /db_xref="GOA:Q5KIU3"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU3"
FT                   /protein_id="AAW42955.1"
FT                   /translation="MGAFDKLRGDQVSSGFWGEHTSTIDWCETNYSHSPYIAEFVNTLS
FT                   NLPSFLIGLYGCYSVLKNGLRKRYALCYLGLSLIGVGSFGFHASLRWEWQLMDELPMIY
FT                   VVSYAAYLVLDTLPGFEPRFGTIGPLILLAWDAFVTVSYICLPNPVYHQVAFAAILITA
FT                   TLRTIALMFDLPAGHPARRTIGIMMAWGIVTFATGFGIWNIDNIFCGQLRAIRSMIGPF
FT                   GVLVEGHAYWHYMTGYGAYLIFTASILLHCLIKDDIKGYHIDGRWLPTVNHRPQVASKP
FT                   ESKDWKGTITPPEKLD"
FT   gene            470281..472984
FT                   /locus_tag="CND01750"
FT   mRNA            join(470281..470495,470551..470580,470641..470731,
FT                   470777..470872,470937..471108,471161..471287,
FT                   471342..471514,471570..471711,471766..471858,
FT                   471913..472480,472534..472743,472801..472984)
FT                   /locus_tag="CND01750"
FT                   /product="expressed protein"
FT   CDS_pept        join(470424..470495,470551..470580,470641..470731,
FT                   470777..470872,470937..471108,471161..471287,
FT                   471342..471514,471570..471711,471766..471858,
FT                   471913..472480,472534..472743,472801..472910)
FT                   /codon_start=1
FT                   /locus_tag="CND01750"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43098"
FT                   /db_xref="GOA:Q5KIU2"
FT                   /db_xref="InterPro:IPR019049"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU2"
FT                   /protein_id="AAW43098.2"
FT                   /translation="MPVLQPRPLPSGGAAVAPSKPATTPLQKIERQYRKFLAKRYMTLM
FT                   SRVALWIAVLLSLFSAFVSGDISKVPFAVLSSFPVFLSLAFLLRVRKSFITQPYRPSPR
FT                   SSLIGLIVSSFWNQRVITLLFSYAVFSITITNVWFTLLGREDMTLFNSTPRHPWQLNES
FT                   RFILTASNACLFLVAAARDILNDNLKADWPRERKPFAQAVKIALFDNVWGSSRIGFTFL
FT                   WSISTPFAYCWLGLRSFIWQWVNWRLWGVAVRPFLGSFARSTSKTPGPWALLGPMLTLN
FT                   MLTLLALQFPVKGLAAYTTQPIHFDEFYKKSPLSLEIYLITALKSQDPYYLQFTLMELL
FT                   RVVSIPRHRKIFFDDISKSPSLISQLCQELLLQFGKVHNVLVNRGVTIQPQNTKSSPVA
FT                   ASGISTAHDERKISIRQADIFRPLAKPKSTFNLKSILDGPIQATAPSPVVKLGQAGTLA
FT                   IKHVESVQDRVVGRIEGNPVGGAIVSEAKGARKGVNEWAGKEWGRRSVRSVLGEVLVAQ
FT                   RVIEILVILSIASIEEDTYGNVQQVLPAILEAIVRFREAIFALEVQLLAQTRLLGPAQS
FT                   GAMDEVKKDLYVAIGSCDKAVKRIADTFGQSLSSFRFPPSVAYGLGEICKG"
FT   gene            473622..475313
FT                   /locus_tag="CND01760"
FT   mRNA            join(473622..475074,475131..475313)
FT                   /locus_tag="CND01760"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        473647..474828
FT                   /codon_start=1
FT                   /locus_tag="CND01760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43100"
FT                   /db_xref="GOA:Q5KIU1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU1"
FT                   /protein_id="AAW43100.1"
FT                   /translation="MAYVPLPSRPNQRVVIVGAGIVGSCVAAILSERLGSNIVLVDRDI
FT                   RELPGSTGHAPGLVGQYNELPVLTELAKRSVKYYQNIDGGFDQSGGLEVGQGLEKRFEG
FT                   AQKEGLEAKVLNKEEILQIAGAFVRDDISDGHAGVFFPSDGTANTITIAYHQQHKAASN
FT                   GATLLNADVKSVIESSNGNGRILQTSRGRIDCHTVILCTGIWASQLFSGFTQTVVPVAH
FT                   PYSYSLPNNHQSKTPFVRWPSKHVYARDHGRMDGLGSYAHAPIHVHSDQIGETAYGQWE
FT                   PSFDDVLKEGYSLLPQETAERFKGGQKFNGLFSVTPDGLPLVGKLEDGLWCAVAVWVSH
FT                   AAGCAGLLADMFLGTADEKDAGLRKALDPKRFEGEGLESKALAKYNDIYNKIS"
FT   gene            complement(474933..476158)
FT                   /locus_tag="CND01770"
FT   mRNA            complement(join(474933..475063,475117..475352,
FT                   475425..476158))
FT                   /locus_tag="CND01770"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(474983..475063,475117..475352,
FT                   475425..475485))
FT                   /codon_start=1
FT                   /locus_tag="CND01770"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIU0"
FT                   /protein_id="AAW42953.1"
FT                   /translation="MYIPNVQNVIAAGLALTGAYTSTVSSGKILDYAVEKCIDKEGNHR
FT                   CSKPFPVTKSTCYEIKWTTDGKISHTTAEVRDAGSNEIVFYRDTNGEWTPEKNELVYVD
FT                   FKPKVWGQGNNTVEYEVITCK"
FT   gene            complement(476673..482055)
FT                   /locus_tag="CND01780"
FT   mRNA            complement(join(476673..476860,476925..478307,
FT                   478365..478721,478777..478845,478896..479003,
FT                   479058..479450,479502..479621,479669..480187,
FT                   480241..480295,480340..480420,480477..481270,
FT                   481328..481378,481439..481698,481917..482055))
FT                   /locus_tag="CND01780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(477060..478307,478365..478721,
FT                   478777..478845,478896..479003,479058..479450,
FT                   479502..479621,479669..480187,480241..480295,
FT                   480340..480420,480477..481270,481328..481378,
FT                   481439..481489))
FT                   /codon_start=1
FT                   /locus_tag="CND01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42951"
FT                   /db_xref="GOA:Q5KIT9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT9"
FT                   /protein_id="AAW42951.2"
FT                   /translation="MSTGREMDYKQKNRSRKVPHIVSKSDQKIVQVMTETNNAHHSGIK
FT                   GGVLANHTEPTTECEAPNEMSNRGILHHLEDSQPAPNSAGKSALEFPSLKSARAIPPSR
FT                   HQLHPSLVMTPQNENTSIAMCHSAINGMPNSKKDGRLSPLNKYMGSCSRTKNEENIDPT
FT                   SATTPVSACNIDRVSSSQPRVSSQKLPYTKSSILTIKSVSDPQTWEDEKNKTFSAQISG
FT                   RKKHETPITEIPFASVSRPSVSVTTGSTSVLCDNPDAPDTGSLSQIKSPESRRKDWWRR
FT                   DPHPMFSPKYAAQRLLVEFPSAINVIHAKPILESHFSKYGKIHSVYHYDQNGDRCCKGF
FT                   VVFIDPMSIQKVLTDPYSNICANALDPEAPRDMSIAIRPSSASDLERTVFIRITGSRSE
FT                   EEACERHHEYQLLCEREMEAKNMPNDDHDLFGITHDMRGMAKSDGLSLFHKALLPEKVI
FT                   LDQVPMRGKTPGKYYSTVCVRNLNTPWFDFVRQVRERCGKDPAQIGEIALRGPNISERN
FT                   FVPQLCDHLAEICNVRPPNENSCGWLVSVSGSRDGRHMMHELQKIPGFFVRWADEGDGL
FT                   FDDAEPALEMSPPNCAGSFEDSSSPTETDDVRSLSTPQTNNHVLSALLHPSPTHPHLRR
FT                   TLIHTYRGRPLIEDNSTGETKFLDESAIFVGRLNKRMETYATLYKRFEKYGKICNMEFN
FT                   PKAVPSHVNNATARIMYQGQESAARAIARENGSISFGTAIKVELRRVIHSDVHTRRVYV
FT                   DLTGRIIRPPTLSNLACEPAIKRVTESQSAIEARMRQPQFSSGLNMPSAAYLPMSSQQP
FT                   GFLQPDVGIGMPTATFPPRFSLSPPAFSTGHGFQHLSMLGGQGHLSPTYDHIMPIVNSF
FT                   VHVGQLSNGMMTADRFLYPLSEAFQSPQSLTGKSSSMAYPPAEEVHFQPPLDEQFFAGQ
FT                   SHAIPATVQYPVSALDEPSSRTPGVSSHPELPTIAPIGDEGISSNMKLKPVAYKEENGT
FT                   VKAIYDDNELKAYCVQNNLPYPPKPEKTIKKGSDETFTVTQDWRKSLLPVQTGGHDSSL
FT                   PSPLRRGSLAFSEAQELSSLSRLRLRRSQSDYSLPTNRKPQDCCRVVDERVNVANASTT
FT                   SHCKENSYCSSPRLAKPPLLNHDPMPDYRNQLIQAQANNFPDTHGNLKQPPFNLPFRQP
FT                   LSPPNVQFDPENLEERMCHLDIHGQNSLSTFTSSAQAQGSQGWYSTSFDALTYQLQNQQ
FT                   PATKHIPPDGNSWIANESPVVQGPKCDRVRSKARGRGSRRKTFFGRFSGEQHLSKQ"
FT   gene            483000..483665
FT                   /locus_tag="CND01790"
FT   mRNA            join(483000..483153,483207..483222,483280..483322,
FT                   483372..483426,483483..483665)
FT                   /locus_tag="CND01790"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(483116..483153,483207..483222,483280..483322,
FT                   483372..483426,483483..483525)
FT                   /codon_start=1
FT                   /locus_tag="CND01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42949"
FT                   /db_xref="GOA:Q5KIT8"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT8"
FT                   /protein_id="AAW42949.1"
FT                   /translation="MHLMYTLDERGNRVYTLKKVTAAGKPTKSAHPARFSPDDKFSRHR
FT                   VTIKKRFGILPTQLPCKPL"
FT   gene            complement(483548..485575)
FT                   /locus_tag="CND01800"
FT   mRNA            complement(join(483548..484000,484054..484234,
FT                   484297..484440,484495..484510,484569..484672,
FT                   484747..484921,484984..485575))
FT                   /locus_tag="CND01800"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(483795..484000,484054..484234,
FT                   484297..484440,484495..484510,484569..484672,
FT                   484747..484921,484984..485417))
FT                   /codon_start=1
FT                   /locus_tag="CND01800"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42947"
FT                   /db_xref="GOA:Q5KIT7"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT7"
FT                   /protein_id="AAW42947.1"
FT                   /translation="MASPAKAYPSRRSFLHFIQNPHHLVRPSIRLKTTLYSLSLVIIIL
FT                   LVLALNAATTPPTHAPDIAKSPSPDTPADSGEGKDIAQGKDAHLVDGDIQRSFEEPDYA
FT                   LLSGRQPHEIGCDIPLEGDGKGVLVFLGIFSTAQNKGRRDLYRETIIPDFPPELVTVKF
FT                   ILGTPPYPEQSSISERSKRTKLLKDVSKEMKEHGDMVMLPMIDNIDLGKTHEYFKWVAH
FT                   EYAGEGRVKGRPRFVMKADDDTILVMPNMISAFKDLDCATNVYWGTSAGRSHYFGDYFR
FT                   GLAYAMSWPLVSWIGSANMTHAHITKIEDARTGQWLRHLDPITDPIKRIDMGWTMGDWN
FT                   QLDVDTKTVALHWCKLDDWVREQHRRLLQVWSDAGREYTAENGVPPRESIAKGKITPQE
FT                   AAKEHQRQKELGWDVQGNLE"
FT   gene            485776..490517
FT                   /locus_tag="CND01810"
FT   mRNA            join(485776..485946,485995..486124,486172..486844,
FT                   486895..487134,487190..487292,487346..487804,
FT                   487852..488421,488478..488647,488699..488798,
FT                   488849..488969,489020..489251,489299..489432,
FT                   489492..489563,489618..489777,489835..490517)
FT                   /locus_tag="CND01810"
FT                   /product="Dynactin, putative"
FT   CDS_pept        join(485828..485946,485995..486124,486172..486844,
FT                   486895..487134,487190..487292,487346..487804,
FT                   487852..488421,488478..488647,488699..488798,
FT                   488849..488969,489020..489251,489299..489432,
FT                   489492..489563,489618..489777,489835..490376)
FT                   /codon_start=1
FT                   /locus_tag="CND01810"
FT                   /product="Dynactin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42945"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR022157"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT6"
FT                   /protein_id="AAW42945.2"
FT                   /translation="MTSQEVPIDAKVQVSAGIGYVRWTGANPGFAAGKWVGVELFEAGG
FT                   KNDGSVKGERYFECKPNHGVFVRPSQVRILEAPMPTETPRPQSTRPSATPSAHRLTSAS
FT                   SARAASPQKQPTTRSTAPPTPSQTLRVVSGSSSIEDVVPSTAPMTRRVSNSSSSRPSQG
FT                   IFKRPPSVLDARALTIATEDIEHVAAHSIVSPPPGRISSPTRRVVSPTPSISQQSRTRS
FT                   ISSAFVAPPDPAALEQASTQPQSLSRPPSPDEEHTLSAQKRELEELRIKIRILESKKHE
FT                   DQEKIRDLETRVGEADSLKAARVRLQAKFQEIQSSLLTAQRQARDLQSENSILETRAAE
FT                   ALDQLEMAALDREVAEEKAEAAEADIVKLGEKVAELEMEVAVLKEENAEYEKPVGGIEG
FT                   ERTSLAFVQLEKHNERLKEALIRLRDVSAEAERDHKVKITELEKVLTSQEDLISQLEFA
FT                   EAKLANAESQVEDLKQQLDDALGAEDMLEQLTDRNLQMGERIEEMRLTIEDLEAIKDLN
FT                   DELEEGHVEAEKQLNEEIEALTAQLRQERVRSGELDALVLDMETTINQFRDLVASLQSE
FT                   LETIRLQQITRESNITSTSKESQALMNLNLKLQSTAAKAQSKTIDLDLKKLEAYQLAEH
FT                   LRIVQAYLPEAYHKTEEDSTTMFLFFNRVAAKVDLLINVISQIHGLPASLHGASSEALV
FT                   GICELIGKLHHFSTLNRRFAAIMRRGTSEEWMGYGKFIGDVGGVESRVDVWLNGLKADE
FT                   FNEGDCARDLGSLIAQFDHFAETTFNHPVLDTGEQQLGLAHLFDCDLDNFAAAVGFARQ
FT                   AIAALTSEGDIEVEVGDSSLEEGVYEPVQRILDLVRSVKIPSSKMVLQVKEIVQTSSAF
FT                   QPEIELMLRDLTTSVSNVVDLAVQLAQRIGQHVSTLRNTKEPLRLSDIESFLQDVTAQS
FT                   AIAGSNAHPWELIAMFVSKLGEDLNGTLPKIKEAAKDGKIVSLESTPPWLGRVASIKEA
FT                   ASHNADVEKQVVKLTEEVKDMLREIKIRDQSLQESGVKVETLERRLEASRKQADIIIEL
FT                   ENDVAKARKQEKVYEDAIEQLQAEQDALEVENARLRKGQVQSTDRQGNGVSATPGFGGE
FT                   PIIIGNGAGLESSQLAEQVESLKSAVRFLRSENALLKSRELYNDIHSLSALRYRSEPQM
FT                   PELISSNAPTSPSSSESSLPTTPTHSPIRSLPMTKHIIGVESRILLHQMAKFQASTKIV
FT                   DISNLGGKEGWRSRKNAPELQYREWKKKEKRLEKKLEGLVGRSKGLSGL"
FT   gene            491096..492869
FT                   /locus_tag="CND01820"
FT   mRNA            join(491096..491490,491544..491801,491857..492153,
FT                   492207..492390,492451..492584,492643..492869)
FT                   /locus_tag="CND01820"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(491260..491490,491544..491801,491857..492153,
FT                   492207..492390,492451..492584,492643..492810)
FT                   /codon_start=1
FT                   /locus_tag="CND01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT5"
FT                   /protein_id="AAW42943.1"
FT                   /translation="MRSHNGHVFIRRSIETTNNGKYHCMPRYIKASHSSLPPPLLRSQY
FT                   FLPTQHTTTTTVMFRQTSIRLASTATPARAVLRPKAAIRPSQPRYNGLRSVRRTYATDV
FT                   PPPSQPSGGNGGSNGPMFLVLAAIVGLGAGGYYYLKPVRDVATITNQSINSMKDNASSL
FT                   SDLAGYAKSMLPPGAFALYSHLSKQEGGINGFLSSLKDKDLKEVLEELKKAGGDDIKRI
FT                   VEKVQKKVDEAKGNVEKVDWKGLAQDLKDELPESSQRVVDMMIGRIPDKAELENLVKKA
FT                   KSIGDDQLKQFEEAANKVWQKVEQAKKDGKGQADALLTGLKEAAPADVDSLIKQLKDVA
FT                   KKAGLPADTTEAWLKSKVEDGKVDADGLAKQVEGKLKTAAKFIPGEPKDLVQQIEQVSP
FT                   SLAKLVSQALQQAGVSDEKGNKKV"
FT   gene            493129..494094
FT                   /locus_tag="CND01830"
FT   mRNA            493129..494094
FT                   /locus_tag="CND01830"
FT                   /product="hypothetical protein"
FT   CDS_pept        493299..493778
FT                   /codon_start=1
FT                   /locus_tag="CND01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42941"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT4"
FT                   /protein_id="AAW42941.2"
FT                   /translation="MTTTSHTSSSIADQAIDLIPQLSAATGKDFGTTLAQFSQYAFELS
FT                   TASEAEKIYATSVLKEAWSQLNLDKVTDHQVPEIVKVWARRKPQEGEVIRAQVKSAISK
FT                   AKETLESFKGSSISDGRLRDGLSDLVNKFCFDALSDCNNTATATNYVSHFFFFLY"
FT   gene            complement(494075..498998)
FT                   /locus_tag="CND01840"
FT   mRNA            complement(join(494075..494313,494369..494684,
FT                   494738..494900,494951..495113,495163..495344,
FT                   495395..495600,495653..498248,498305..498998))
FT                   /locus_tag="CND01840"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(494122..494313,494369..494684,
FT                   494738..494900,494951..495113,495163..495344,
FT                   495395..495600,495653..498248,498305..498926))
FT                   /codon_start=1
FT                   /locus_tag="CND01840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42939"
FT                   /db_xref="GOA:Q5KIT3"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR021717"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT3"
FT                   /protein_id="AAW42939.1"
FT                   /translation="MATYIPHHLVHVHLPAPPSIPASIPELRVPVDEPIPIPDEAYEEP
FT                   LHPDHAVSVVHDTANNILARNIFNGYVLELRPFGPTIAKQRQNIETGSEIVRIFFPEPL
FT                   RALSPGLIRLSNEEDRLFIIVISQANVIYRLNFPLGTFRQGTDDRFIFTTQGEEWLEDW
FT                   EVPEHLIGACGGVGATTVLNGDTVVLGGGDGGIVIVTRSGNYSPDSGHWEATHYRASSK
FT                   FRLPSLFSRSANSAEQIVSFSEFVKEGHVKIIYTLSRDRKLRAWNAETGACLRTVDVRS
FT                   SSQAVTLRGSDNAAFNSEDGSVSMIRVVQHPFASSRYSHLVVTFFSTQHSASSAGSFVV
FT                   FRASTNSYGVSDLSFAGEKPCSPASAGSELRGLEILAPVKLHGVDSGWRLWAVWDRDGS
FT                   PVCEVVTIDDVFQFTTYIEANNSPLLSDWQVVVAPYNVERFDAAYFDNLLPPTPPNPAE
FT                   PEDNGDIPATFIQHLFHPGRFSTLTLQTALEDYTYQLSRKSNRAQVSGPISSLSKRFGA
FT                   TVGSQLEIEVNPDTGAPVVDVYRKQLKLEWLGIWASVRDLDRQSRWPVSTSTIGQSLFV
FT                   LTREGVSVPVPEEAAGVVGRLGKSEIEANEFLNLPEGALCRVYPSLGWSDARIAVLSVT
FT                   MSGEYIAGLLKSREAQSDDSDVPSTGSLLDVLIRNINDTLSAGLQGPPELVAGSFWDDF
FT                   LDPVLTEEERMNIRRILSETSSVNRGLVQCVEILEDTSFALYSSEANSGPSSSFSGLGN
FT                   ALLSSTLSQIIESRYGLAQNILFTSLFYLADSFDPLDDSEKSEELIEILARVMVAYHRY
FT                   RVLKWVAGQTGEEAGERKQAAKVQKASRSKRKLGDDGLIDVSGGLKIKEMEDNEQDTDR
FT                   FTTEYSLLHCLTARSLAPEVPGSDMSISVLLQAAMNVLDQIHLLSSNQVDIAAQSPDVV
FT                   LGNKIFIDGHPLLAGAYSDLYPLSSGIAYLKGRAYLEAGVLEGAMEYLQKAAAGCKDGS
FT                   LTSILPSASGPNSLSSYYSEVCDAFKAHGISRAAASFGQLAIDTAPTNAPPSRDLWTKV
FT                   FMANLELSLYEEAYAVLTSLPFMDMKRDFLGHLISEMCEKNEVGRLNSLGFIGFQTDVE
FT                   ELLRFKARNSDPLRRPNYYKVLYSWHVTRGDYKSAGEVMYLQGRRFAEGSGSKYPTFEL
FT                   SAMQARSYLAAINALSLVEKRNAWFSVPGAPTKSLKGLKRRKMSSYIPEEEFTKGKSPV
FT                   DIITLEDIEMEYTVVLSQLRISSHIPDIYDHGVAVSPQEIVGLFVQRGMYDIAQSAASS
FT                   LKVDMTDLFQSLATRCVELSRLQEHAGDISAAAFLQTSPITSRLQGPPATLALHYLRVA
FT                   LQRHDSLKTNWRYREAVADTLFELNKDKRQGWNMPAWLVQWEMERSPEGWIGRALRWGW
FT                   VSEALDWSIENLRQATPPELLPKEKSGAVYIPYNLFDRVLAAAGQGDEIEEALVQQKSK
FT                   ILREEVSRRLKGLESLRM"
FT   gene            499208..500663
FT                   /locus_tag="CND01850"
FT   mRNA            join(499208..499871,499918..499949,500004..500290,
FT                   500340..500458,500513..500663)
FT                   /locus_tag="CND01850"
FT                   /product="phosphoprotein phosphatase, putative"
FT   CDS_pept        join(499281..499871,499918..499949,500004..500290,
FT                   500340..500458,500513..500614)
FT                   /codon_start=1
FT                   /locus_tag="CND01850"
FT                   /product="phosphoprotein phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42937"
FT                   /db_xref="GOA:P0CR76"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR76"
FT                   /protein_id="AAW42937.2"
FT                   /translation="MDPRRRHNQRPPPPSSSLPPNPATYNAPPNSYGGSYPDTRQYQGH
FT                   NGAHSTPQGYRSAPPPQPPYGAFSGEQRAFPPSNMPNYPPSGPPDPRMRPSQDPRSRLS
FT                   GPQGSYNTPTPPSGHTPPSLPNYGTPPISAPTIPLPSQQSHQQFYTPPSGPTPSLPGAM
FT                   PAGVISEPANGFVDKDVPQGRRRPLFCVVCASNNNRSMEAHYVLNKNSFRVVSAGTGSA
FT                   VRLPGPAIDKPNVYRFGTPYDDIYRDLESQDPQLYTRNGILPMLDRNRKVKKAPEKWQE
FT                   LKSVLADVVITCEERCYDAVCDDLLTRSGEYNRPIHIINIEIKDNPEEAHIAGQSILEL
FT                   ARAIEASDDLDSDIDAILNAHGDKHPHTLLHTVGFY"
FT   gene            complement(500578..503411)
FT                   /locus_tag="CND01860"
FT   mRNA            complement(join(500578..500920,500971..501203,
FT                   501263..501342,501403..501418,501490..501553,
FT                   501614..501729,501783..501883,501935..502017,
FT                   502075..502285,502349..502441,502501..502532,
FT                   502592..502692,502767..502938,502990..503012,
FT                   503087..503099,503162..503288,503344..503411))
FT                   /locus_tag="CND01860"
FT                   /product="phospholipid transporter, putative"
FT   CDS_pept        complement(join(500809..500920,500971..501203,
FT                   501263..501342,501403..501418,501490..501553,
FT                   501614..501729,501783..501883,501935..502017,
FT                   502075..502285,502349..502441,502501..502532,
FT                   502592..502692,502767..502938,502990..503012,
FT                   503087..503099,503162..503271))
FT                   /codon_start=1
FT                   /locus_tag="CND01860"
FT                   /product="phospholipid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42935"
FT                   /db_xref="GOA:Q5KIT1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT1"
FT                   /protein_id="AAW42935.1"
FT                   /translation="MRLPWVKKNVDLEPKTGDEPHDSNFIEKKLGLSKKGAIFAAGASL
FT                   FSDGYANASIGPATTIIKTYVYPDLFESRPVNSRLLPAIAFAGIIVGQLSFGWISDKVG
FT                   RKFGMLLCTGIVFVFSALQAASKGVGGAQGTINALIAYRFLVGIGIGGEYPTGSVAAAE
FT                   NTEDPDIPKASQQRLFVLATNSMIDAAFVISYFVCLVLLWIFGMNHLNAVWRMTLGLGC
FT                   VPPLFLFYFRLKMKEPESYEKYSMKHTRIPYWLILKRYWVKLAAVSITWFLYDWITYPF
FT                   GLYATPITDAADPNGTLYTSIGWGCLINFFYLPGTLFGAFIVDYLGPKYCMIFGLCMQA
FT                   IFGFVLSGCYNLLTQPHRIAGFAILYGFFLSFGEVGPGNNLGLLASKAIGPTAARGQLY
FT                   GIAAAVGKVGAFIGTYTFPQIQASFGKHGQYAEDTGVFYLGSALALVSALITLIFIPNI
FT                   QPDAMHDEDIAFREYLEANGFDTSKMGLKDTASDVEVGDGSRDEKENKTPNESIETHAL
FT                   AI"
FT   gene            complement(504288..505924)
FT                   /locus_tag="CND01870"
FT   mRNA            complement(join(504288..505469,505524..505639,
FT                   505698..505716,505795..505924))
FT                   /locus_tag="CND01870"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(505394..505469,505524..505639,
FT                   505698..505716,505795..505838))
FT                   /codon_start=1
FT                   /locus_tag="CND01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43356"
FT                   /db_xref="InterPro:IPR018824"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIT0"
FT                   /protein_id="AAW43356.2"
FT                   /translation="MSEEHEHHVIGGYKATLANPKTSEEAKAHARRAIEEYEKKHKSGG
FT                   GSTEHDHRVAGGYKAALHNPKVSPEAKQHAKEVLKEHDV"
FT   gene            complement(506781..509349)
FT                   /locus_tag="CND01880"
FT   mRNA            complement(join(506781..507071,507121..507367,
FT                   507420..507511,507565..507721,507773..507872,
FT                   507925..507989,508041..508119,508183..508257,
FT                   508316..508405,508462..508533,508587..508689,
FT                   508751..508829,508880..508967,509021..509038,
FT                   509100..509349))
FT                   /locus_tag="CND01880"
FT                   /product="endopeptidase, putative"
FT   CDS_pept        complement(join(506924..507071,507121..507367,
FT                   507420..507511,507565..507721,507773..507872,
FT                   507925..507989,508041..508119,508183..508257,
FT                   508316..508405,508462..508533,508587..508689,
FT                   508751..508829,508880..508967,509021..509038,
FT                   509100..509126))
FT                   /codon_start=1
FT                   /locus_tag="CND01880"
FT                   /product="endopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42933"
FT                   /db_xref="GOA:Q5KIS9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037750"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS9"
FT                   /protein_id="AAW42933.1"
FT                   /translation="MSDDEFMMDDIADDEEYDFDYDDDDDDVEEGAVGDVENQYYKAKA
FT                   LKEDDAQGALKAFRTIVDDQPEKGEWGFKALKQMTKMNYLRLHEPEKALETYRELLGYT
FT                   KSNVTRNYAEKTINNILDYVGGEGKHAAKAPKVPLDTLEKFYEVTRVACDEAKNERLST
FT                   KCNLKLAKLWLDRKEYTRLHPILQSLHATCAPAANSVSSDDQSKGSLLLEVYAMEIQMY
FT                   SNLKETRKLKAIYNAAMQVRNAIPHPRIMGVIKECGGKMWMQEKAWGKASEDLFESFRQ
FT                   YDESGSAQRIQVLKYLVLNTMLMGSDINPFDSQETKPYKNDPQIVAMTNLVSAYQRRDV
FT                   QEAESILKANQATITNDPFIDHFVGDLLTSLRTQYIVDIIKPYTRLELDSLADKLNIHR
FT                   SEVESLVVSLILDDKIKGKIDQANGILVLDRFGMAQRKRYQALGTMAAELDILAGKVES
FT                   EKLGVKDGGARAWVGSQAIFG"
FT   gene            509485..510724
FT                   /locus_tag="CND01890"
FT   mRNA            join(509485..509589,509634..510258,510312..510724)
FT                   /locus_tag="CND01890"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(509577..509589,509634..510258,510312..510696)
FT                   /codon_start=1
FT                   /locus_tag="CND01890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42931"
FT                   /db_xref="GOA:Q5KIS8"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016818"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS8"
FT                   /protein_id="AAW42931.1"
FT                   /translation="MTRSHAKNNTTQSTLTHYERSLLRKDGAARRIGGDSFKPLDACYL
FT                   CLSQVTDPVACSRGHIYCRECCLSNLISQKASIEAQKREMERWEERERTEREEAKAKAR
FT                   ERVVQDFEKGMALGSTGGRGIVRNEEAEKKGENGVGSKFKLDESIVEKVAREAEEKAMK
FT                   VLEEEQTEARKAKLAAFWLPSLTPEAKMGPMKDIKLQTLCHVGAQPHPISRKTLLPVIL
FT                   TYPPNSKVKPICPSCSKELSNANTSFLLSSRSPLASTDIGGEDGRKKKKQKKDREDPLV
FT                   CGHVICQTCTDTIVKPQGRCSVCEAKVEEEGRIPLGKEGTGFAAAGGAEVRKSVTAFRV
FT                   "
FT   gene            complement(510696..512565)
FT                   /locus_tag="CND01900"
FT   mRNA            complement(join(510696..510985,511041..511232,
FT                   511286..511545,511601..511775,511831..512294,
FT                   512358..512371,512443..512565))
FT                   /locus_tag="CND01900"
FT                   /product="vacuolar membrane protein, putative"
FT   CDS_pept        complement(join(510767..510985,511041..511232,
FT                   511286..511545,511601..511775,511831..512294,
FT                   512358..512371,512443..512486))
FT                   /codon_start=1
FT                   /locus_tag="CND01900"
FT                   /product="vacuolar membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42929"
FT                   /db_xref="GOA:Q5KIS7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS7"
FT                   /protein_id="AAW42929.1"
FT                   /translation="MPSNSPYLPILWACISSWYYGFHLSELNFPALSLTCTSPSSSSLI
FT                   PQCLYLSESLYAFTTAIFTVGGLLGSLSNPWIVSKYGLKGGISLTGWINLFGATAMTLA
FT                   PHWIILAAGRFVTGVSSGLAISLVPPYLSIIAKSSKELVHRSGQIGTMNQMAIVLGICS
FT                   AQAAGLLLTGEKGDVPGSWRYVVSISGFISVLQILASQTISVSSEEHSRPTQSSAFDPE
FT                   SESRPQLHDEAASPLLPSSQQTVQLNLRQILSNPSLRGPSLLCAAIMALQQLSGVNAVM
FT                   FYSTPVLRPLLPTSVGLVGIGITIVNAIMTVPAMLLMDYLGRKVLILASIIGMAATSIL
FT                   LAIGLNGHHQIMSAISIIAFVASFSIGLGPVPFLLISELVPPPAVAALSSLAVSTNWVT
FT                   NFFVALFFLPLRDLLSSPPDPRSPESGREGEGRVFYMFTAVLLMGGIMIGRGLRTN"
FT   gene            512770..514490
FT                   /locus_tag="CND01910"
FT   mRNA            join(512770..512826,513290..513446,513500..513645,
FT                   513693..513805,513860..514007,514061..514136,
FT                   514189..514224,514310..514490)
FT                   /locus_tag="CND01910"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(512770..512826,513290..513446,513500..513645,
FT                   513693..513805,513860..514007,514061..514136,
FT                   514189..514224,514331..514490)
FT                   /locus_tag="CND01910"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(512808..512826,513290..513446,513500..513645,
FT                   513693..513805,513860..514007,514061..514136,
FT                   514189..514224,514310..514397)
FT                   /codon_start=1
FT                   /locus_tag="CND01910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIH9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIH9"
FT                   /protein_id="ALO60515.1"
FT                   /translation="MSDPNDVWKDSSATNGAPVDSYARESSPRRETRGDDARSPRRDRS
FT                   RSPARAPERADRGRGDGPNTVNQGNNLHVSGLSRAVTERQLEDLFSQIGKVAKVQIMVD
FT                   PHSQESRGFGFVMMESPEEAQAAIDQLSGQNVEGKSITVAHARRGRARTPTPGRYHGVK
FT                   ADSRPQHSSYDRPYQPRSYDSRYYDRPPPRAYDERDRYDRRDRYDDRRYDDRYARDRYD
FT                   DYYRSSGGAPDSYYYRSERDSRYERREERPRYDERPRY"
FT   CDS_pept        join(512808..512826,513290..513446,513500..513645,
FT                   513693..513805,513860..514007,514061..514136,
FT                   514189..514224,514331..514397)
FT                   /codon_start=1
FT                   /locus_tag="CND01910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43118"
FT                   /db_xref="GOA:Q5KIS6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS6"
FT                   /protein_id="AAW43118.1"
FT                   /translation="MSDPNDVWKDSSATNGAPVDSYARESSPRRETRGDDARSPRRDRS
FT                   RSPARAPERADRGRGDGPNTVNQGNNLHVSGLSRAVTERQLEDLFSQIGKVAKVQIMVD
FT                   PHSQESRGFGFVMMESPEEAQAAIDQLSGQNVEGKSITVAHARRGRARTPTPGRYHGVK
FT                   ADSRPQHSSYDRPYQPRSYDSRYYDRPPPRAYDERDRYDRRDRYDDRRYDDRYARDRYD
FT                   DYYRSSGGAPERDSRYERREERPRYDERPRY"
FT   gene            complement(514482..518137)
FT                   /locus_tag="CND01920"
FT   mRNA            complement(join(514482..516713,516765..516838,
FT                   516895..517089,517158..517311,517374..517526,
FT                   517611..518137))
FT                   /locus_tag="CND01920"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(514611..516713,516765..516838,
FT                   516895..517089,517158..517311,517374..517526,
FT                   517611..517769))
FT                   /codon_start=1
FT                   /locus_tag="CND01920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43158"
FT                   /db_xref="GOA:Q5KIS5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS5"
FT                   /protein_id="AAW43158.1"
FT                   /translation="MPRTEETQYPGAGTLYVYSASPHRGISPSRSNKRRQSPSAWATIP
FT                   TKWEDIVTIKEEPVTMATPDSLLQNGIAEFTYLPYSSEGVLGRGKFSTVYKVTGSDGNY
FT                   HALKHTPLYPHHPLISARLLREPTLLAELPRHPCLIGVEGWVRTEGHFYLVEEYATNHV
FT                   PLPTHPLPITPSRAAYILDQLVSCVRDTLHEKGRVCHRDLKGDNILVDADSGDIIILDL
FT                   GLATRFSMSQPKLSTCCGSPAFHSPEIVMALSRPPGEITYYGPELDIWCIALTLLSLLL
FT                   QVRFPLGPKHTSPYVMRERAMDRLQELDELYPRHSPWRPRPLSRSARMNGYDRANTQDT
FT                   DVDFEKHEWRRVRKAMDDFLDIDGVRRMEKFRAYEIGDKTRQKVASYEVKEVEKKFKLI
FT                   NFIPTEVKYTLPIFLEEEEIIKKKTGVISFSNPLGESERRVKSYIKYLLRSAGILYHVL
FT                   PPQQISNSATMPTPPQSSDPSSSPSFILQIVVPLPNQPSSTASSTAPLSPSSLTGWFPS
FT                   IFSFRQGLNKPSGASPAGRSVSVPPIKKSHSPSPVLLGDKAGSNRRDKLLRCYIKVEFE
FT                   NNQRSPLSDRDRRSRASSETFISLREGLDLTTLHQVSLSSTNSTSTSATPAQSNSTVHT
FT                   TPRPAHPQRSASACRHPQARPHPRRAASLAPASKDALSTHRTNAAVGMMNMTVPPSPLS
FT                   RNVSLGSSPSDSETPASRIFNRPPSRASSISRKASGARPSLLLSHAHSSFTLPNQYPAR
FT                   LSSIESKIHIHLSDQRAYSVLVKALDIKHDGALGMHHGVGDPALSPMSVRRPSLAPSVT
FT                   EGVEIPNGGLEEELELEPERGRARSKDDGSSLLFGYRNGNVPSPLSPISTSTKLPLATT
FT                   TIIDALTPVDIRLEGNANRGHRPRDHFEKRAPRDTSRGRGLLNMLFGKSGDIKVSRSSS
FT                   VPPLASGEIMTPPLW"
FT   gene            complement(518453..522883)
FT                   /locus_tag="CND01930"
FT   mRNA            complement(join(518453..519275,519326..519622,
FT                   519673..519763,519812..521681,521734..522363,
FT                   522707..522883))
FT                   /locus_tag="CND01930"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(518635..519275,519326..519622,
FT                   519673..519763,519812..521681,521734..522344))
FT                   /codon_start=1
FT                   /locus_tag="CND01930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43156"
FT                   /db_xref="GOA:Q5KIS4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS4"
FT                   /protein_id="AAW43156.1"
FT                   /translation="MVVTVIAPHDLHRNSPSNAADALSSGLSPISFDQRDRGHNTGYKL
FT                   SPESSAVISSPPQPTHMSLPRRSDTFPPSLESDELDHAGPSHATSRPIPPPPNPRRHRS
FT                   GILMSRVRAASGSSIKMKSAVSGSKSHGDLMSVVERIDDDLVEDDEMEELDEEADFDKD
FT                   ESLRRRRLRGRSNDGWKRIVSEGGRHESTDEGGEASFWDNSARYYHHLHSHPSSRTGSI
FT                   TASPEPSPVASHSASPIIVPRSLSLPQHGIGPPLQGTSKSLSPNQQFLQSRLPPTFPNC
FT                   PNGTVQETNFQEHFCPAAMVFTPTTQEWKDFQAMPEWKTLHESKEETSFSGGSSEDAAQ
FT                   NQHSRHASLESDSDKFLSARPALRSTISAEYLGPEDYHTPDPGSPSGKSGEIDDSAKPS
FT                   FKPNIISASPIIYPTDRMASSVVPFDFSSTAEESQLPDGRIMSHGALGLENTAPTLSSN
FT                   DHVVRNSDHPPPPVRWNSIGNRDSLRAVHGPEAPTLPRTKTKRELEREKLLKMVDEELE
FT                   AENQLSKNDGWGGGVQQIGNGLGLDHVKSNSTGNIQSVKLVEEEKGPIPDVRIDPDALE
FT                   RPSSADPLENSKLGMQPPNPFDSGFGQAQSKLNQKASLSPTHPFKPSPLNAEPIVAEDA
FT                   HSIPSTTSVTPHDTTPTGEIPPPIFPEPPATSLDSIRDYARGLAPPGSPRTGDAVPPKS
FT                   PRSTRKRDTNRVSLVAGRVVQPFTLPASTSLPASSKPPESPSLQAFSPFRSPALSRPSS
FT                   ATLQHHSFSRLDSTLSIAPSTGVPSECGTPTEEKAGGMGGRGIDDYVILKEAGKGAYGL
FT                   VMRAKLKGPKGEPVGDEVIIKYIIKARILADCWKKHKVLGPIPVEIHVMDQLRHLLYTP
FT                   PKQMNPWDPARSRSGATKPDGASRSDNEVVSTLETPGSPGSGSENGRLYTSTQKHIAEE
FT                   IKSSPQRGHPNICKLVDFFEDKEFYYLVMPCFGNGMDLFDRVESQPSGLESFEVRSLIG
FT                   QLSDAVQFLHANGIVHRDIKDENVVLDGSGHCQLIDFGSAAHWRPGKKWDTFSGTLHYA
FT                   SPEILRGEMYGGKEQDIWALGVVTYVLLVGETPFSELPDEVLHGLAPDSKAYAALMDRC
FT                   GAGHEEEGEESDGGGKLRDAADFVMRCMEPEVGDRPSAEVLLEHRYLRGRDGWVGKKGW
FT                   IKV"
FT   gene            complement(523007..529366)
FT                   /locus_tag="CND01940"
FT   mRNA            complement(join(523007..523668,523715..524124,
FT                   524246..524423,524472..524594,524645..524865,
FT                   524917..525125,525175..525299,525353..525470,
FT                   525527..525635,525686..528362,528412..528466,
FT                   528521..528665,528727..528776,528826..529008,
FT                   529078..529366))
FT                   /locus_tag="CND01940"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(524035..524124,524246..524423,
FT                   524472..524594,524645..524865,524917..525125,
FT                   525175..525299,525353..525470,525527..525635,
FT                   525686..528362,528412..528466,528521..528665,
FT                   528727..528776,528826..529008,529078..529318))
FT                   /codon_start=1
FT                   /locus_tag="CND01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43154"
FT                   /db_xref="GOA:Q5KIS3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS3"
FT                   /protein_id="AAW43154.1"
FT                   /translation="MTQYGETPSLPYARDESSTSQVQSAYPAYPAEAYEHQEAFVDEED
FT                   DFSADVDVGAALQYWTALRHMGGKGKQKEESEEDRTSKSPWRLRSKLKTVTAGLFICLN
FT                   LGVDPPDIVKTNPCAKTECWIDPTQLPAPKAIDAIGRNLHQQFETLNPKVKYKAFLDPS
FT                   IEDTKKNCISMRKTTKDERVVFYYNGHGVPRPTPSGEIWVFNKNYTQYIPVSLYDLQEW
FT                   LGSPCIYIWECSAAGNILNNFIKSAERRDTEARHAAAQAGHEDLPRTSYTEALHLAACK
FT                   ANQILPMSPDLPADLFTCCLTSPIETALRHFVLQDPLRRNTGLSPDDPRSRITVDLAMR
FT                   IPGDLKDRRTPLGELSWIFTAVTDTIAWLSFPRDMFNKLFRQDLLVAALFRNFLLAQRI
FT                   MSAYHCTPTSIPEIPDTHNHPLWESWDLAVDACLAQLPGIFDQLGEPEPGKPLTIPPGM
FT                   YKPSTFFAQHLQAFEVWLQHGATVSNKRSGRNRNDVVPRSPPEQLPIVLQVLLSQSHRL
FT                   RALILISRFVDLGPWAVHLSLSIGIFPYVQKLLASPAIELKPVLIYIWARILAIDQSCQ
FT                   IDLLRDSGFTYFTQILAAYPQQGSLVIPNANEHRAMSSFILSILCRDFRQGQTACLNTH
FT                   VFDACVARLHEDDWLLKTWCLLCIGQLWADYDEAKALFWQSQRQGELLSALRSTSVEVR
FT                   AAALYAFGTLLGASAISIETPAKGGGGTGAQIGLSDVQQLELEAGVAFACMMSVKEDAS
FT                   PLVRKELVVVISCVVREWRGWLVCAAWVYYEQEAALVAAEDDKPMPKDVVSDTLEQWTM
FT                   NEDKHPEEHQHNLTLLSSFKVLFETLLDLSVDPHTEVALTASTVVDYIIALLMDSPFVR
FT                   VEGSAIRSIIRQHSRPRNATRQSSTTQLERSKLSHLNGVPPNLTRTSTDLDKSAADSTS
FT                   SLKRNSSVANALRSLASITGFSAPETQSEEPLSTEPRQEIPTAPDLSTSAYISPYPEAG
FT                   HERVQPDSHPASTSSTGRNPSSLKYLNTHMSTRSSLGILPSRLDQTPVEAYQVLEALTE
FT                   EDMERLRMRRMRGREAGGDMDGRYGNNGLARSTDLGLGMVAKEVKDDVLPLRSGYFDWA
FT                   MDYFKTPQMKAPDADEPGSQTYNEQAWKHQRNEQMVERSRANEEFAATHSWNMEAGTLH
FT                   NDAWPLQLAFHSYDPVLAVTDDTDKICLWDWQNKVKLNKFSNQNIGGSSISSIHFVNEM
FT                   ASSLMLTASTEGSIRIFRDYETPGETALASTFRAVSETYPVAHSSGLLTAWEQQKGHLL
FT                   VGGDMKVVRLWDATVERHLRDIATQAGSNLTAISSDEPDGNVFVAGFGDGVVRLFDKRA
FT                   EDAGEVVLRTWRQHKIWIQSVHLQKGSMRELVSGSMDGEVRVWDVRKPDEPLYTLPRRN
FT                   EGLMALAVHTGAPVLARTTAITPYSTKQDLEITGFKNPLQPRRLAKISIPVPPAYNTPR
FT                   HRAVDFLPSSASLVFHPVEMVVAAGGFDTSGTVKLYRCPAPDLPLG"
FT   gene            529756..531588
FT                   /locus_tag="CND01950"
FT   mRNA            join(529756..529877,529946..530095,530239..530345,
FT                   530406..531057,531113..531588)
FT                   /locus_tag="CND01950"
FT                   /product="expressed protein"
FT   CDS_pept        join(529833..529877,529946..530095,530239..530345,
FT                   530406..530745)
FT                   /codon_start=1
FT                   /locus_tag="CND01950"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43120"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS2"
FT                   /protein_id="AAW43120.2"
FT                   /translation="MFGLKKKLSAIIPSEARAHLQNILTVEWEDGNKTVLVDVPDADHP
FT                   SEVEMSGMGGTYGRLADDDEDDISSRPAQRTRKSFHKSSSYTTKSKTLPRIPQQPNLAR
FT                   PNTNPFGGDCQPSPQTPCNSTHTASPYSLTSPQFTSSTFIHPDTYGQNSSYDQGQSSKG
FT                   KEGNSRTARRMDNADDLLSGGDFSGIDFPASSSRTRDPGSSVQRGTNPFR"
FT   gene            complement(530875..532849)
FT                   /locus_tag="CND01960"
FT   mRNA            complement(join(530875..531219,531274..531614,
FT                   531667..531677,531729..531860,531909..532313,
FT                   532369..532439,532491..532849))
FT                   /locus_tag="CND01960"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(530956..531219,531274..531614,
FT                   531667..531677,531729..531860,531909..532313,
FT                   532369..532439,532491..532700))
FT                   /codon_start=1
FT                   /locus_tag="CND01960"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43152"
FT                   /db_xref="GOA:Q5KIS1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS1"
FT                   /protein_id="AAW43152.2"
FT                   /translation="MRRVIIHPLLRPLIALPILLLIMHALKAQWYRLGKGKGKSMSKTS
FT                   DTGVQNEETEYPNPNGQRIVVGHFMLGNTYPFQPEDWERVFSLAQDTSLDGLALNIGPE
FT                   EWQLSQAQVAYNILSSRPTPSNARPLKLFLSLDMNVLSPSPSELSTLIIKVISSGRDSQ
FT                   MRWDGKVLLSTFSGHSLGDDGWIDVLRLVERGLGEEVTFWPAFFMPPEDFLGKSYVDGA
FT                   FAWNNAWPMGNHTINLEEDRPFLESKIPYMAAVSPLFFTHYGTEGEFGWNKNWIYRSDD
FT                   LLLPSRFLSLLSLPNSRSPSIVQLISMNDYGESHNLFPVMGAQPGSDSWTSGMDHEGLR
FT                   WISKYFLQRWRDGKGEVEGIDEVKLVLWYRTKPAVMETEDSVGRPRNADWAQDLINLFI
FT                   IIPSSSPSSRYMLQIRNGPHLHRRHLSCEKLNLLTVPFVPGQVTYEILENEKMIIQGEG
FT                   KAIEAEGAWNFNMWSGGVF"
FT   gene            533056..538284
FT                   /locus_tag="CND01980"
FT   mRNA            join(533056..533732,533785..534828,534901..534928,
FT                   534981..535127,535305..535412,535459..535563,
FT                   535614..536259,536307..536379,536461..536557,
FT                   536605..536695,536748..536892,536957..538284)
FT                   /locus_tag="CND01980"
FT                   /product="expressed protein"
FT   CDS_pept        join(535334..535412,535459..535563,535614..536259,
FT                   536307..536379,536461..536557,536605..536695,
FT                   536748..536820)
FT                   /codon_start=1
FT                   /locus_tag="CND01980"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND01980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43121"
FT                   /db_xref="GOA:Q5KIS0"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIS0"
FT                   /protein_id="AAW43121.2"
FT                   /translation="MPNIDFNLKTHDNAFENDDVFDSSFSFMNIDTSMDYYLASPPEGA
FT                   KSPGTSGNQPHEGAKEPSDDRFSLSPLTMNDQAMQPLDISNTVYSYPPYALTYQHQQAI
FT                   GITGANIGSHHPVIYQPYRPGTSGDFTKRPLRSPESPSLSSSPHGSIESSRLSFSAPNA
FT                   ASPSLVSPGSLSGSIPDPSPTHSYAGYHAPFYSSAPSVGMPGTGMSRGNISPTGPGLSM
FT                   VAGFPYPTSMVSQQQGSETGPMRSQRSRTRGKKVKEEDVDDDDDDHSSKGLGLTNEHED
FT                   RVPVSNKREDVRRARIESEQRRRDELREGFKRLKDALPITNQRSSKSSLLDRSVAHIQA
FT                   IEGANRYLLAQLEEQQKECAKLREILHGEVMQRNVSDSPDQPGQRHH"
FT   gene            complement(538300..539351)
FT                   /locus_tag="CND01990"
FT   mRNA            complement(join(538300..538468,538526..538694,
FT                   538763..538842,538918..539011,539072..539090,
FT                   539146..539351))
FT                   /locus_tag="CND01990"
FT                   /product="vacuole protein, putative"
FT   CDS_pept        complement(join(538457..538468,538526..538694,
FT                   538763..538842,538918..539011,539072..539090,
FT                   539146..539314))
FT                   /codon_start=1
FT                   /locus_tag="CND01990"
FT                   /product="vacuole protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND01990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42927"
FT                   /db_xref="GOA:P0CP28"
FT                   /db_xref="InterPro:IPR003172"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR033917"
FT                   /db_xref="InterPro:IPR039670"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP28"
FT                   /protein_id="AAW42927.1"
FT                   /translation="MKLAPFLIPFIATTVTASLAGEALSWAGQLVGGGRGALATGDGPV
FT                   RTENSWSYVDCGLATDAIQLKSIKVHPDPPVPGKNLTVTVEGDVLETIEEGAYVDVTVK
FT                   LGLIKLLQKEFDVCDEARHANASVQCPVQPGPYTVTETVELPQEIPKAKFSVLVRGYTV
FT                   DDEDMVCLDLFVDFMKK"
FT   gene            539510..541075
FT                   /locus_tag="CND02000"
FT   mRNA            join(539510..539940,539991..541075)
FT                   /locus_tag="CND02000"
FT                   /product="expressed protein"
FT   CDS_pept        join(539536..539940,539991..540257)
FT                   /codon_start=1
FT                   /locus_tag="CND02000"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42925"
FT                   /db_xref="GOA:Q5KIR8"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR8"
FT                   /protein_id="AAW42925.1"
FT                   /translation="MARPTAGNLQATRTLRHLYRPGVASQSCYGARYQSTPSPPRRPSP
FT                   YRLLQPHAFLAEFAPLHVNGWRVDALQSAEKLLEADKVEEVLDGAETVEKSGDLQGRRL
FT                   VRVFELGEGKEGWRKLIKFVGHVGQVVEDQDHHPTIHISPLSDYNPPSPSLLSLQTQSQ
FT                   SQTGYIVELSTHTHTPLPPYPLPSKGSKMKPGVTGKDIKLAQKVEEVYEEVIGRVEVKK
FT                   E"
FT   gene            complement(540394..543565)
FT                   /locus_tag="CND02010"
FT   mRNA            complement(join(540394..540803,540864..541058,
FT                   541102..541379,541434..541780,541828..541879,
FT                   541933..542137,542199..542301,542363..542416,
FT                   542455..542492,542540..542781,542836..542935,
FT                   542988..543118,543166..543287,543327..543342,
FT                   543390..543565))
FT                   /locus_tag="CND02010"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(540463..540803,540864..541058,
FT                   541102..541379,541434..541780,541828..541879,
FT                   541933..542137,542199..542301,542363..542416,
FT                   542455..542492,542540..542781,542836..542935,
FT                   542988..543118,543166..543287,543327..543342,
FT                   543390..543535))
FT                   /codon_start=1
FT                   /locus_tag="CND02010"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42923"
FT                   /db_xref="GOA:Q5KIR7"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR7"
FT                   /protein_id="AAW42923.2"
FT                   /translation="MSVTSTHSQNSISPGAVPDAPGAHSAQPQTEAAGVDLRVRFARAC
FT                   DRCRHRKIKCDNEHPCGKCAAAGVTCTSGMSRATGVSRRRASRTSFSDTRNHHEAFIEK
FT                   EGSPSNREHRSNNKGRKRRRDSEETDKIGATGNSKTSNVLDHLDTAHFFLSQEGMTRFA
FT                   GSTSGLPVLEATRRMLQKIPDPVNDAQSPMGEPNWSWLSSLLEDGEGSSKSGRESFLRR
FT                   QERDEPEYFPGRDHASEQGGEDIFARISEIIPPDLMASLVQTYFAVVHPVWPIIHIQSF
FT                   FADFYKWTSYSFAALVVSMCMLATRYTNDPRVLAEPDISASAGFQYFELFRQLRAQAST
FT                   EDNVIQAIQSLFFAAQYHCVDNVPHQVAQGLFAEAAARLLDGGLHREISDIALGDSLEK
FT                   ETRTRTAWACYSWDKQLAAICGKPPLLRIWDYDVSLPEVFEETQSAFAELPENQDEKLS
FT                   AIFIQQILLSVVLEKTLTSCTHHPEFDNCEMLNRWARSMRPEVEDMKALDDSMRLLNEW
FT                   REALPPAMSDRSIAGRLASPMYSVEYEQIAVIEQTIEMLIAGRKLQLATLAKTRENTST
FT                   TRLESARDAILEAGKHTLASAVKMGSAKMLGKCDILLAYRILMAGRFLLASLLSARADC
FT                   KAEQEEEATRAVRAAIVLLRHFSDVFPISLGSAEVLEETCRVCRVDISLPTAATPGHPR
FT                   HNLYAWHRPLRLRDKHSNEKDGCRSQVRSPTNVMSGDAAADAIASMFSPVDAAFGLGSL
FT                   PLPFPEIGTEGERQPDFSWLPPGGSVPYYFPSHPSE"
FT   gene            complement(544228..546745)
FT                   /locus_tag="CND02020"
FT   mRNA            complement(join(544228..544663,544716..544826,
FT                   544891..544960,545013..545169,545220..545666,
FT                   545738..545795,545882..545942,546004..546076,
FT                   546139..546196,546262..546642,546701..546745))
FT                   /locus_tag="CND02020"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(544435..544663,544716..544826,
FT                   544891..544960,545013..545169,545220..545666,
FT                   545738..545795,545882..545942,546004..546076,
FT                   546139..546196,546262..546443))
FT                   /codon_start=1
FT                   /locus_tag="CND02020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42921"
FT                   /db_xref="GOA:Q5KIR6"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR6"
FT                   /protein_id="AAW42921.1"
FT                   /translation="MSQDPYTTKASDVNMDDNTSTDKNVSLSRVVTALEPEQVQVVDGV
FT                   WGTLDESAPNYRSLGWIRASVLMIKVQIGLGVLAIPAVLHTFGLIPAILIIFAVAVATT
FT                   WADYVVGVFKQNHPEVYTLADVGYIMWGPIGREVFGAVYWIQLTAVAGAGLLSISVALN
FT                   AMSGHGTCTIVFVVAAAIINILVSSIQTLDRISWIGWIGLVGIMSSVIALAIAVSVQDR
FT                   PSAAPATGDWSPDIVLVGNPSFSAAIGALSNIIFSFAGAPNFFNIVAEMKNPRDFNKAL
FT                   ISCQTFVTAAYLIIGCVVYHYCGQYITSPALGSAGILMKKVCYGLAFPGLVVGCVLNTH
FT                   LPAKYIFVRLMRNSKHLSANTIQHRVIWISCVVFNCTVSFVIAEGIPIFNDLIGLIGAL
FT                   FATPNAIIFECMMYIWDVYYCADKYPSQHTWKQRSIQAFNVIIMLLSIFAMVAGTYAAA
FT                   VTIRDDVASNATSKPFSCDDNSG"
FT   gene            complement(547579..549763)
FT                   /locus_tag="CND02030"
FT   mRNA            complement(join(547579..547811,547872..548052,
FT                   548107..548283,548330..548525,548565..548848,
FT                   548902..549105,549152..549202,549265..549523,
FT                   549574..549763))
FT                   /locus_tag="CND02030"
FT                   /product="Methylmalonate-semialdehyde dehydrogenase
FT                   [acylating], putative"
FT   CDS_pept        complement(join(547635..547811,547872..548052,
FT                   548107..548283,548330..548525,548565..548848,
FT                   548902..549105,549152..549202,549265..549523,
FT                   549574..549640))
FT                   /codon_start=1
FT                   /locus_tag="CND02030"
FT                   /product="Methylmalonate-semialdehyde dehydrogenase
FT                   [acylating], putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42918"
FT                   /db_xref="GOA:Q5KIR5"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR5"
FT                   /protein_id="AAW42918.1"
FT                   /translation="MLSRQLTRNLFNKRAASTLAADINAAQDNGRWKGTSTLGGDAKLL
FT                   IGGSWESSKTDKWSEVHDPSTQHLISKVPHATSAEMKRIVDVAENKFYEWSESSVLTRQ
FT                   RIMLDLQGLIRKYHKDIARNIVLEQGKTFADAMGDVTRGLQVVQMATNIPTELLGRNIE
FT                   VSRDMDTLTRIEPLGVGAAICPFNFPAMIPLWSVAMAIATGNTLILKPSERDPGASAII
FT                   AELCEMAGLPSGVLNILHGGVDAVNFICDEPRIKAISFVGGDKAGKHIYDRAGALGKRV
FT                   QAQLGAKNHAIILPDANKSALKAVAGAAFGAAGQRCMALSVLVTVGDADWLPGLVEEAN
FT                   ALKMGNGFDEAADLGPVISPQARERIEQLIESCEKQGGNIVLDGRGATVKDYPNGNWVG
FT                   PTILEATTDMDCYKNEIFGPALVVVKTRDLDEAIELVNRNPYGNGAAIFTQSAVSSRKF
FT                   EKKIEAGQVGVNVPIPVPLPMFSWSGNKASVLGNASLYGPLGLNFWTKTKTITSLWRED
FT                   AKEDKAAVAMPVHH"
FT   gene            549963..552078
FT                   /locus_tag="CND02040"
FT   mRNA            join(549963..550260,550315..550451,550490..550673,
FT                   550712..550832,550889..550987,551035..551475,
FT                   551514..551668,551727..551777,551827..551904,
FT                   551958..552078)
FT                   /locus_tag="CND02040"
FT                   /product="4-aminobutyrate transaminase, putative"
FT   CDS_pept        join(550121..550260,550315..550451,550490..550673,
FT                   550712..550832,550889..550987,551035..551475,
FT                   551514..551668,551727..551777,551827..551904,
FT                   551958..552018)
FT                   /codon_start=1
FT                   /locus_tag="CND02040"
FT                   /product="4-aminobutyrate transaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42916"
FT                   /db_xref="GOA:Q5KIR4"
FT                   /db_xref="InterPro:IPR004631"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR4"
FT                   /protein_id="AAW42916.1"
FT                   /translation="MLTRSLHTTIRISGRRQYATAIAAARLVPSQPQKPNVVTNTIPGP
FT                   KGKELSAAIGKFQDPRAHTLVADYNKSCGNYLVDADGNVLLDMFAQIASIAIGYNHPDL
FT                   IKLAKTDKFASAAMSRPALGSYPPVDWADTVNEGILKVAPKGLNQVFTTQDGSSATEGA
FT                   LKASFLSYQAKRRGNRPFSDEEIESVLENQSPGSPELSVLSFKGGFHGRNLGSLSLTRS
FT                   KPIHKLDMPAFEWPACQFPDIKYPLAENTEHNQKAEAAALAHVEETIRVWSNKKPIVAM
FT                   IIEPIQSEGGDRHASADYFRKLRQIAKKHDIYFIVDEVQTGVGATGSFWAHDKWELEEP
FT                   ADFVTFSKKTQASGFYHNLSTRAPFAYQAYNTWMGDPIRALQAREMFKVIERDGLIENV
FT                   ARVGDYIYKNLEHYEASGNILNLRGKGQGTFIAFDLPSPKERDQFISQMRLQGVNLGAC
FT                   GSQSVRLRPMLVFEQSHADLFLEKLRNVLK"
FT   gene            complement(552391..553276)
FT                   /locus_tag="CND02050"
FT   mRNA            complement(join(552391..552486,552544..552701,
FT                   552751..552924,553003..553276))
FT                   /locus_tag="CND02050"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(552466..552486,552544..552701,
FT                   552751..552924,553003..553051))
FT                   /codon_start=1
FT                   /locus_tag="CND02050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43150"
FT                   /db_xref="GOA:Q5KIR3"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR3"
FT                   /protein_id="AAW43150.1"
FT                   /translation="MSKASKVSIVDPSGPAPSKFASNMIVSGKTVYLAGAVGTDKSGQF
FT                   IPGTIQDRTRQALRNAEERLQYLGLDLSDVVSVTIFLSKYEKDFASMNEAYIASFPTDA
FT                   PLPVRTCVGVAALPAGTDIEMTLIAAKRD"
FT   gene            553525..555592
FT                   /locus_tag="CND02060"
FT   mRNA            join(553525..553747,553804..554047,554095..554176,
FT                   554229..554279,554332..554436,554501..554760,
FT                   554817..555193,555251..555343,555393..555592)
FT                   /locus_tag="CND02060"
FT                   /product="Aldehyde dehydrogenase (ALDDH), putative"
FT   CDS_pept        join(553625..553747,553804..554047,554095..554176,
FT                   554229..554279,554332..554436,554501..554760,
FT                   554817..555193,555251..555343,555393..555545)
FT                   /codon_start=1
FT                   /locus_tag="CND02060"
FT                   /product="Aldehyde dehydrogenase (ALDDH), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42914"
FT                   /db_xref="GOA:Q5KIR2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR2"
FT                   /protein_id="AAW42914.1"
FT                   /translation="MSATVAEVTFNTGLYINGLWKNGRGEPLLSVNPATEEVIAEVQTA
FT                   SKEDVDEAVKAARHCFETAWGTEVSSQLRGQLLFKLADGMEAAMEELAKLEYLDSGKPL
FT                   AWCKADIEDSVACLRYYAGSADKIQGSMIELDDKHKHALARKEPIGVCAQIVPWNYPLL
FT                   MMIWKIAPALAAGCTIVFKPAEQTPLSTLKFAELFELAGYPAGVFNLVNGLGRTTGDAL
FT                   SRHMDVDKIAFTGSTITGRRIAIAAAESNLKSVTLELGGKSANIVFDDANLQEAAKWAA
FT                   FGVYENMGQSCSAGSRVLVQESIYDQFITHFKAAAEAFKVGDPADPDTFQGPQVNEAQF
FT                   RKVLDYIESGKRSGAKLLTGGSRHGSRGYFIQPTVFGDVTMDMKIAREEIFGPVASVIR
FT                   FKDEADAISIANNTEYGLAAAVHSQNYARVQRVTRKLKAGTVWINQYVALSHQVPFGGY
FT                   KQSGWGRELGLEGLEPYLITKSVHHYYGGDFEWPIKI"
FT   gene            complement(555857..557221)
FT                   /locus_tag="CND02070"
FT   mRNA            complement(join(555857..556106,556160..556276,
FT                   556340..556559,556620..556748,556815..556920,
FT                   556976..557221))
FT                   /locus_tag="CND02070"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(555985..556106,556160..556276,
FT                   556340..556559,556620..556748,556815..556920,
FT                   556976..557043))
FT                   /codon_start=1
FT                   /locus_tag="CND02070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43148"
FT                   /db_xref="GOA:Q5KIR1"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR1"
FT                   /protein_id="AAW43148.1"
FT                   /translation="MDKRTYLRNDLLAGKPGIGMWLTLPGSALAKTVATIPGFNWILID
FT                   AEHGQITDRDYFDLTNHITTEGVSPIIRIPSDEPWLIKRALDSGAHGLMIPMCHNPDVA
FT                   KKVVSSSKYAARGTRGCGSPFTQIIFGVPESQYEATCNDNLMVIVQIESAEGVKNVESI
FT                   AAVQGVDVLFVGPFDLAKSMDIEFGGEEHEAAIARTLKACKDNGKKAAIFCMSGAQSRK
FT                   RLQQGFDMVSIATDTDSIIREFSRQLEDMKA"
FT   gene            557396..559190
FT                   /locus_tag="CND02080"
FT   mRNA            join(557396..557495,557553..557725,557778..557880,
FT                   557933..558170,558211..558378,558431..558505,
FT                   558555..558885,558941..559190)
FT                   /locus_tag="CND02080"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(557604..557725,557778..557880,557933..558170,
FT                   558211..558378,558431..558505,558555..558885,
FT                   558941..559016)
FT                   /codon_start=1
FT                   /locus_tag="CND02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42912"
FT                   /db_xref="GOA:Q5KIR0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIR0"
FT                   /protein_id="AAW42912.1"
FT                   /translation="MNRQVLNNGVYMLSDLEEESKKTLPQMVHEFYNGGAMDMITCREN
FT                   VEAFNQYRIRPRILVDVGNIDMSVEVFGQKVAAPLGFSPTAFQKLAHPDGEIATSMAAS
FT                   KAGIPMCLSTYSTTSIEDVVTAGQGAIPYVMQLSVMKSRDANLEIIRRAEKAGCKALFV
FT                   TVDCAVLGRRLNEARNNFTLPDHIELPHMPADCDWRNLVVEDDRLKYDASCTWKTLVDW
FT                   ARSHTKMQIWLKGVYTAEDVALAIEYGIDGVVVSNHGGRQLDSVTATLDALPEVVEAAA
FT                   GRIPVHIDSGIRRGTDIFKALALGADHVWIGRAVIWGLAHDGEAGVSLAVNLLLDELRT
FT                   TMVLAGCANVKQITRAHLARKGLDGRLHKL"
FT   gene            559648..561258
FT                   /locus_tag="CND02090"
FT   mRNA            join(559648..559788,559852..560037,560103..560348,
FT                   560398..560603,560656..560782,560841..560953,
FT                   561001..561258)
FT                   /locus_tag="CND02090"
FT                   /product="expressed protein"
FT   CDS_pept        join(559761..559788,559852..560037,560103..560348,
FT                   560398..560603,560656..560782,560841..560953,
FT                   561001..561036)
FT                   /codon_start=1
FT                   /locus_tag="CND02090"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42910"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ9"
FT                   /protein_id="AAW42910.1"
FT                   /translation="MKVIVLGASGFIGHRVALAFVQAGHFVWGQTRSESIAASTLSPNE
FT                   ILPIVCDPHSPEGQKKWGDLAKDVDIVVDCIAASGPDNALASFKTFLSAVKDRQKWGPK
FT                   PTYIYTAGHWVFSRGAGGLDKWTDERRPAKAALNSPTIWRNQVMEPVLSNENVNGIVIA
FT                   PTCLYGRSGSYFAYYHFDAALAAMEKGQEEFETIAKDDSRLLTIHHDDLADLYVRVGER
FT                   SPACKGQVFIAANPSPESLKEILNSVVRVTGLKGYKAKEATDAYEKFWVSTLLAKPSLG
FT                   TALTGWRPKRLPLTDGMDIYWHSYVASKKREE"
FT   gene            562010..566541
FT                   /locus_tag="CND02100"
FT   mRNA            join(562010..562276,562638..562886,562935..565493,
FT                   565540..566541)
FT                   /locus_tag="CND02100"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(562219..562276,562638..562886,562935..565493,
FT                   565540..566354)
FT                   /codon_start=1
FT                   /locus_tag="CND02100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43122"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ8"
FT                   /protein_id="AAW43122.1"
FT                   /translation="MRSPSKRGDLEAKYDVVLDFPNLELHSAAASGNVGLVHYALTHGQ
FT                   PVNSVLHGVLPLHAACSGGSLSVVRMLIEQGADVNAPRLPRRYSDGKKGTAPSVGTAGS
FT                   TPLHFAAANGHAPIVQMLLACGADPSKPDKNGHTPEDLARLSSHENVVRVLHAFQRLQT
FT                   LDAESRSSKSEVTEPLSPRESHTNLEQAEQASAVVGSRKGKERAFSLSSVKSDGSSAVR
FT                   MKKSVEALWKRGSKTSMTSATEQTHTHHHRAPPPPRLCLPGEFSTPLDKLSSPFEIDTP
FT                   TSPSPQKGDHNPLCNSAPPSTNGSDGSPKSLNRQLSNDSQSNLSSIALHSPPARTPSTP
FT                   RSRHNSLSSHRPSLPSIIEKAAHPGQTFRAAMKGHQDKDDGLHTALSGGSKSRGRFSHG
FT                   DLKKSTKHQAHHHVHGLKNFFRLGTNRERSPSPPAKNEFAKPIAGEELDLGMERLKRAS
FT                   LDLERRDIPTLDDRSQGSTSAPPTKSKFFEEESSTFDSSLTSSSTSSSQLPAVFQPPRL
FT                   PPRRNSPPASVTPVINVVPSLRPRTGSEVIAPSPLANEWADNDSDGQRDTFKGIRRART
FT                   EVIRQPLSSPRPNSPTEKYSPTSPGKPRAYTLPGLSTPISNSKPSVNGIGKTDDLDLRK
FT                   MAAEGSIRECEKKKDQEEKGGDAEDEEGDGEEWHDALTTGDDEERALQEGHDEIIRLTA
FT                   SDNADIRSASLRSRASKSGRIRSGSIGSVTTDASHISSPPSTFRISNISDDPDPLRRPK
FT                   PAPLPQPSLRADSRVRGFSISSNSSGASAAAHSNLQTVSTPSTSLTLPSALSVTQPVSG
FT                   VVVSGGSGGFPPVPEHEAVSHPSIRRRLTSRTISSQAEAQEAMKQSENEILQLAQLPPS
FT                   LDSSRDLAAVLAAYGESHEMVKKFAEEERKEQEDQDEAFNVRTTVEGDQESFHTADSGR
FT                   TKTSKISLDSKGATSPDRGSVGKQLPSPLTPLIGVDVPRNNSHLSSIYDKRAAAYRERM
FT                   TALTSAPLPSLASVSHHQRPPSVSRTSRQRASSAHETWLDVGPKSRLRSASGNLPMGHS
FT                   IHGGGFRDRSNPTSATTSEIGDEKAEGEEGEERYPHISGPVPVMSNVQPGQRTRRGSNA
FT                   STASHKAHNYTLPPSIHPQPSRKGLSAGTRKYTPAANSGGTAIGLGPLAPTPYASLFSH
FT                   RFSGQPLNDDESDDEEQENGDFTVIENDWRGGRVISLDEVGAGTEKKKWNGLKKLGRHH
FT                   K"
FT   gene            complement(566618..568714)
FT                   /locus_tag="CND02110"
FT   mRNA            complement(join(566618..567036,567087..567303,
FT                   567353..567465,567515..567649,567706..567811,
FT                   567863..568022,568081..568171,568223..568549,
FT                   568599..568714))
FT                   /locus_tag="CND02110"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(566728..567036,567087..567303,
FT                   567353..567465,567515..567649,567706..567811,
FT                   567863..568022,568081..568171,568223..568549,
FT                   568599..568682))
FT                   /codon_start=1
FT                   /locus_tag="CND02110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43146"
FT                   /db_xref="GOA:Q5KIQ7"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR035297"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="InterPro:IPR040896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ7"
FT                   /protein_id="AAW43146.1"
FT                   /translation="MSLNTRKQERDFTAEVEALQAEAEQLAKNGKLEEAIEKITVLEKQ
FT                   TRNASDMSSTSTLLVLIARLCWEANNLDQLNNQLALMSKKHGQLKEPVVRMVDEAMAWL
FT                   PALKEQKEQGNFRSGKDRWLELVKTLRDITEGKIFLELQRARLTVMLSAYHEALAETAP
FT                   KEAPPTPETSPSTKPEDKDKSKAEPVTAKEHLDVAADLLSDLQVETYSTMDKREKTEFI
FT                   LEQMRLESMRGNWVRVRVGSRKINRVYLKDKDTQDIKLRYYDLMVQLALQDDEYLEACQ
FT                   AYQEVWDTEEVKNDSAKELSVIENIMIYVVLASYNNEQSDMLHKLYANTALQKAPLHFD
FT                   LLKCFVTKELMRWSGIEGIYGPALRQSPIFAPGSTLGKKIGVTEKSQKDAEKFDNPGDA
FT                   RWDQLHKRIIEHNIRVIASYYTRITIQRLTELLDLPLLTTERTLCKLVTDKSVYARIDR
FT                   PAGIVDFRKKRNVNDVLNAWSGDVSKVLDLVEKTSHLVSKEYAMHEAVKGKKISA"
FT   gene            complement(569300..570614)
FT                   /locus_tag="CND02120"
FT   mRNA            complement(join(569300..569769,569826..569995,
FT                   570047..570054,570102..570172,570220..570614))
FT                   /locus_tag="CND02120"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(569448..569769,569826..569995,
FT                   570047..570054,570102..570172,570220..570431))
FT                   /codon_start=1
FT                   /locus_tag="CND02120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43144"
FT                   /db_xref="GOA:Q5KIQ6"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ6"
FT                   /protein_id="AAW43144.1"
FT                   /translation="MAPTRPPNVEMATKRIKKEIADLAKEDLGSIILAPEETNILHWKA
FT                   RIPGPVGSPYEGGVFDVDIRVPHDYPFSPPHLQFMTKVYHCNVASNGAICLDLLKTAWS
FT                   PALSLYKVILSLSSLLTDPNPADPLVPPIASEYRNNRRKHDATAREWVRKFALPKSNPP
FT                   PAQLKPKLQPPALRRTISRSLPDSTSPAPPPQLAGQRRVILEVGDSDDEGDIQVLGDSS
FT                   RGNSSQPAAVTTNGAGRQKRARTSGQGGSAGDAIVIDE"
FT   gene            complement(570712..572146)
FT                   /locus_tag="CND02125"
FT   mRNA            complement(join(570712..571303,571351..571675,
FT                   571731..571893,571948..572146))
FT                   /locus_tag="CND02125"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(571027..571303,571351..571675,
FT                   571731..571893,571948..572097))
FT                   /codon_start=1
FT                   /locus_tag="CND02125"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIG9"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIG9"
FT                   /protein_id="ALO60516.1"
FT                   /translation="MSYQYSNPYRGYYGQSEPPPQPYENHVPVKEQFKVLFTGLPAGLT
FT                   SQDLYEALTKPPLRLPRTTRVFNMHQPDGHFLGIAVVSVDTQVDAERLRVEYNGKVIDH
FT                   NYRLSVHHILPLGHKYPSFNAAGSSSANPSQGLQHTRPRASSSARKANRALTENAEMPS
FT                   SNANQSGSKGKQKARVSVPNKKENGKPLGLKLLDRIGKANKPSNQMDQIALLERQRANL
FT                   QKSHLGGPGKAFAMRIQPPVPSKDTTKKHRRSKADKAAAKSNLGAASKVSRAKKKLNDS
FT                   AMDVDEDLTFENTANHGQGYWRK"
FT   gene            572311..573912
FT                   /locus_tag="CND02130"
FT   mRNA            join(572311..572466,572558..572742,572794..573667,
FT                   573721..573912)
FT                   /locus_tag="CND02130"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(572370..572466,572558..572742,572794..573667,
FT                   573721..573749)
FT                   /codon_start=1
FT                   /locus_tag="CND02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42907"
FT                   /db_xref="GOA:Q5KIQ5"
FT                   /db_xref="InterPro:IPR019194"
FT                   /db_xref="InterPro:IPR027093"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ5"
FT                   /protein_id="AAW42907.1"
FT                   /translation="MSAKTAPSVPHGTYSLDLSSLNHPEDELIAMRYAFKPASVTHTTP
FT                   GTYYPSQGSSTSQPAQVVFDVKNGSQVFDVREETMKGRECVMIFNEENNTFELHPLSTT
FT                   LHLTVNRNASHTYATSTSSTSSSSSLPLAAKLHTAQEDPPEISSQAEDEEAGKGMPRPT
FT                   KRAKTTVAEKSERDKGTSPPHEDLKNLKGNRGVGKGGKSLPRNKPLESAPIPVIGSART
FT                   RSITTNVKNKGGKGKTTGAKSKAKGKKAETTPRSKVKSAEYIEDSDEEIGASEEVQLPP
FT                   SSARKPRARGKETREQAEEEEEEEDDMDEFANLLGQSLAEGGDYNDADAEGEDEFEEVL
FT                   TQQLQQQYAQSDAGLGYDDEDDEESESEDEDDELGGARLVVRQSGVMDDGSEWI"
FT   gene            complement(574301..576761)
FT                   /locus_tag="CND02140"
FT   mRNA            complement(join(574301..575288,575343..575482,
FT                   575551..576250,576304..576586,576632..576761))
FT                   /locus_tag="CND02140"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(574473..575288,575343..575482,
FT                   575551..576250,576304..576586,576632..576675))
FT                   /codon_start=1
FT                   /locus_tag="CND02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42905"
FT                   /db_xref="GOA:Q5KIQ4"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ4"
FT                   /protein_id="AAW42905.1"
FT                   /translation="MSQMGSVSGWYTNAYAGTFRSSRLRAPSLLPNRQIPAPIQQTLVI
FT                   DAAHNVHTGADVQGENGKSKVKRRETVFGPDVGEDDEPGWTDGAKEEISVDVVKKWVEK
FT                   TKADEGLHPTTTLQALVNLKRPTLLLQQVEQSEPVEETNKHDGITPIAYEHQKGEREET
FT                   NFAPPLHTLKFSYDATTPSVRISLLLYPTPQPPIEGKESILEDHEPRLLYDGLHPGGFG
FT                   QVFELPKKFAIDLRSAIQVPTEEKEEEGDDGKKDTLVADGNPAEQVHQLDVGTQGQQEN
FT                   QGRRRFGLLRSNRADSGGLEESQIEMTNQGEGQKEGEAKEEKKPIEQGMRVLIRIDGVG
FT                   PQGESLKRRNAQLTHILITGTWVNDPNGSENPQGGKRVWVVKVARREAVIGTHTFLLKE
FT                   IFGLSQASSSPAYPPTSDDPYASTPNECIVCLTSPRDVVLLPCRHLVVCRECAVGMVEF
FT                   GAGNRVARREEMDSAETGQNGDASGENGTGGGASSGGNVPQVAGGTTATGRERRKKKVK
FT                   GWYCPVCRQPYTSLLRLALPEASNVPARPSSRASVRTTRTTKSLAPTLPDGAERMLERL
FT                   RPEGAGDSDEDADAANEAQIDEPERPRFVLGEDKEEIEHHENLEKSPDPAMVSTAVPVS
FT                   TPASVSDGEHSVGEGGPKGWREVAA"
FT   gene            complement(577068..579233)
FT                   /locus_tag="CND02150"
FT   mRNA            complement(join(577068..577566,577618..577878,
FT                   577929..578443,578509..578598,578656..578675,
FT                   578750..578810,578879..578927,578995..579233))
FT                   /locus_tag="CND02150"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(577240..577566,577618..577878,
FT                   577929..578443,578509..578598,578656..578675,
FT                   578750..578810,578879..578927,578995..579096))
FT                   /codon_start=1
FT                   /locus_tag="CND02150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43142"
FT                   /db_xref="GOA:Q5KIQ3"
FT                   /db_xref="InterPro:IPR005018"
FT                   /db_xref="InterPro:IPR006593"
FT                   /db_xref="InterPro:IPR015920"
FT                   /db_xref="InterPro:IPR038697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ3"
FT                   /protein_id="AAW43142.1"
FT                   /translation="MLATFNFWWMAAFLIPFTALEVEAVVTGEKWCNSYLCVTGKHDSS
FT                   QKLDQYTLEPPQGKSITRDDFGWIAIGFGSTMANTPMVITWPNSDGTITLSQREASSNV
FT                   MPTVVLSPSRKATLKSSLSYSNSSSTSITFTVPSNSSITNQTSLIWAYSRKNPGNSAVN
FT                   AMIKQHTASGNTKLNLLSTLMNSTNTTINSGADSESPSDTTSRQALIAHVACGAVATMA
FT                   LFPAGILVPRIARGLTEKRWWFPVHGAVNGLLGFGLVVAAFGIAKANFSGGYNSTHRKL
FT                   GLALFVLCIFQTLLGLFTHFYQRVHRLQTTAGRGPTNFIHMVLGLVIVAVGWSTVWEGL
FT                   DAEWGMYSGTGKPGIGWKAGWGLIVALASIAYLGGLYLLPRQSSFEHQRRLWASSLGHP
FT                   PPSVQKSSSTIRQSTRTNGESMNMAYLLSDNGYGDLPDNRPPPPPPPRLLPPPPTHLMR
FT                   LPPPPIPPNRPAVAQY"
FT   gene            579388..580112
FT                   /locus_tag="CND02160"
FT   mRNA            join(579388..579555,579611..579835,579885..580112)
FT                   /locus_tag="CND02160"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(579471..579555,579611..579835,579885..580012)
FT                   /codon_start=1
FT                   /locus_tag="CND02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42903"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ2"
FT                   /protein_id="AAW42903.2"
FT                   /translation="MTKFPAALKPAARSAYREVLRAARITFQGDSTRHHALLTALRATF
FT                   SSPTLTPPPSASSPPVIPISEESIGVDDVAKRITEWKELARFLKRNVVQGVRSDDGAWK
FT                   LRVTEHTELGDNASVKNPPKLPTTPFPNRNRRKCSDAAPAS"
FT   gene            complement(581520..585226)
FT                   /locus_tag="CND02170"
FT   mRNA            complement(join(581520..581626,581676..582284,
FT                   582337..582550,582596..583033,583084..583346,
FT                   583395..583589,583640..583919,583969..584345,
FT                   584395..584533,584579..584978,585028..585226))
FT                   /locus_tag="CND02170"
FT                   /product="116 kda u5 small nuclear ribonucleoprotein
FT                   component, putative"
FT   CDS_pept        complement(join(581579..581626,581676..582284,
FT                   582337..582550,582596..583033,583084..583346,
FT                   583395..583589,583640..583919,583969..584345,
FT                   584395..584533,584579..584978,585028..585049))
FT                   /codon_start=1
FT                   /locus_tag="CND02170"
FT                   /product="116 kda u5 small nuclear ribonucleoprotein
FT                   component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42901"
FT                   /db_xref="GOA:Q5KIQ1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031950"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035655"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ1"
FT                   /protein_id="AAW42901.1"
FT                   /translation="MSTEDYDEFGNYIGGDLDSDDESDVSISPAAPPPAAPGPSAGPSA
FT                   SYAPLEGFDEDEAMEDEEPGMAMQLHGVDGSTGQQVVLHEDKKYYATAEETYGPDVEAL
FT                   VQEEDLQPLSEPIVQPIKQKSFTVQEKGLPETRFDRNFMIDLMDHPSMIRNVMVAGHIH
FT                   HGKTSLLDMLVFETHKMTWDADQQTRYTDTHILSRARGISVKSGPMSLVLQNSKGKSNL
FT                   INIIDTPGHANFVDEVASIARLTDGVVIVVDVVEGVMHGTEQVIRHAMQEKLKMVLVVN
FT                   KMDRLILELRLPPSEAFFKIKHTIEEVNSIIASIDPDDSFRHSPERGNVAFSSTQMGWC
FT                   FTLKTFANMYADTFGSFDIDEFSLRLWGNIYFDSSTRKFTRKPADVESKRSFVHFILEP
FT                   LYKLYTQVLSADQETLKETLADLQITLKPSVYKMDVRPLLKVVLEAFFGPSVGLIDMIT
FT                   EFLPSPQGGAEAKIRHTYTGPLTSNLADSMISCDPQGPTVVHVTKLYHTADAEHFRAFG
FT                   RVMSGTVKVGQVVKVLGEGYSLEDEEDMISAIVDGIMIDESRYNVDIERAPAGNLVLLS
FT                   GVDASISKTATIVSKDVDDDLYIFRPIKHMTASVLKVAVEPVAPSNLPKMLDGLRKVNK
FT                   SYPLVTTKVEESGEHIILGTGELYMDSVLHDLRKLFSEIEIKVSDPVTKFCETVVETSA
FT                   LKCYAETPNKKNKLTMISEPLEAGIAADIEAGRVSMKMTNKERGKFFESNYQWDLLASR
FT                   NIWAFGPDENGPNALINDTLPSEVDSKLLSSVKESVKQGFQWGTREGPLCDEPIRGVKF
FT                   RILDASLAQEPIYRGGGQIIPTARRVCYSSFLLATPRLLEPVYYVEVQAPADCVAAVYT
FT                   VLSRRRGHVTKDIPKPGSPLYTVKAFIPVLDANGFETDLRTATLGQAFCQMSFDHWSVV
FT                   PGDPTDSSIQLRPLEPAMGQSLARDLVLKTRRRKGLSDSIAVSKYLEDETIIAISASGN
FT                   ADLLG"
FT   gene            585317..586406
FT                   /locus_tag="CND02180"
FT   mRNA            join(585317..585615,585680..586076,586128..586406)
FT                   /locus_tag="CND02180"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(585376..585615,585680..586076,586128..586339)
FT                   /codon_start=1
FT                   /locus_tag="CND02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIQ0"
FT                   /protein_id="AAW42991.1"
FT                   /translation="MSARPTVLTSLFKSLGLRALHTTRPALFLPTPELPPNPTSAEALG
FT                   FAPQGDRKRQLPQDLKVEVPASANRNVSALKDAGKPGRERRQRATPNPNTDADFFSGTS
FT                   SDSPVPLRRPNARARRTKSVSPDLVAGAESALPPDVQRRKRRDRTPKDGKIRTERPKRV
FT                   DPVREFREKRAMLPKRHLVVDVVDHSPEGMFGKQRLIGQTFNRNVGFGSPRHPIPLEAS
FT                   QFVTDLPDTPIPVLSTIPAKAHYQAIQLAEWSAALNATMQGDAKTALPEVVSNVIGVDR
FT                   Q"
FT   gene            complement(586364..587348)
FT                   /locus_tag="CND02190"
FT   mRNA            complement(join(586364..586716,586785..587198,
FT                   587252..587348))
FT                   /locus_tag="CND02190"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(586450..586716,586785..587198,
FT                   587252..587269))
FT                   /codon_start=1
FT                   /locus_tag="CND02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP9"
FT                   /protein_id="AAW43357.2"
FT                   /translation="MTTSITDARHSILHLTPASTLALSFDDPPETGWSVMPGFDESIPV
FT                   PLHLEPPRSDGDEILPSQMHPSYPLGRPTYGKGKGVSGKGGRKVGNLLGTVDAWGRGMR
FT                   AEAGAVGGLWGGGRGEVWEETGLEGVVEQEKRREVPPGMAGAKRPPTPPPPSLRPNQLP
FT                   LPRSIHLRRMLERQQVREEMQRPQEGFDAPVPNETYDNSHQQGVDAAAEGQRHVGDIGG
FT                   SQEWEGESGE"
FT   gene            complement(587729..589367)
FT                   /locus_tag="CND02200"
FT   mRNA            complement(join(587729..588511,588566..588811,
FT                   588860..589175,589238..589367))
FT                   /locus_tag="CND02200"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(587792..588511,588566..588811,
FT                   588860..589175,589238..589260))
FT                   /codon_start=1
FT                   /locus_tag="CND02200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42990"
FT                   /db_xref="GOA:P0CM98"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM98"
FT                   /protein_id="AAW42990.1"
FT                   /translation="MGGGDLNMKKSWHPVLLVNQERVWKAEKVANEEKKMLAQLRKERE
FT                   EERQLEELHRLQEASTGKKRVEKLDWMYAAPSTEGGALGGARIGERDMEEYLLGKKRVD
FT                   EVLGQGDKNIGAASREFIALQNANTARDTAAKIREDPLLAIKKQEQAALAALMNRPDIR
FT                   KQLRAAKKAKETKGREGESKEERKARKRAEKEERRKSKHRYHDSRSPPSDYYDDRDHRR
FT                   HRDSYDSQDRENRRTYRDRSDRSRTRSESPKREKKEKDYSNRDRDYRRRNDTTRGSFDE
FT                   SPRKGGGNRWGSHGPDGYRRSDHRDDGFRERQRGDRIPPPRHLSYNHSTPDVRPSSPPS
FT                   SSAAPVNRNTSTLEDQRAARLAAMSASADELYSSRSKSLAARAEEERREQEKDEKMRQK
FT                   YGKEQASANFFSQQSQLGLGEALQRRGGKGLLKDI"
FT   gene            complement(589473..591331)
FT                   /locus_tag="CND02210"
FT   mRNA            complement(join(589473..590155,590214..590276,
FT                   590325..590398,590468..590502,590556..590637,
FT                   590694..590739,590795..591009,591077..591185,
FT                   591230..591331))
FT                   /locus_tag="CND02210"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(589739..590155,590214..590276,
FT                   590325..590398,590468..590502,590556..590637,
FT                   590694..590739,590795..591009,591077..591185,
FT                   591230..591265))
FT                   /codon_start=1
FT                   /locus_tag="CND02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43124"
FT                   /db_xref="GOA:Q5KIP7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP7"
FT                   /protein_id="AAW43124.1"
FT                   /translation="MLSSNTALTVAKYALGASVTATTLAIGGLWYFQRSLIYPSGFPEG
FT                   SRIVVPKPIEVGCPYEDVTLTCSDGVKIKAYVIMARRKPLMMSELRGLSPAERKEKAQM
FT                   EMEAWAQEMGDEKAIEYSKSRPTIIIFHANAGNMGHRVPLARHFNVDFKCNVFMLSYRG
FT                   YGLSEGKPSESGLQIDIQTAMKYVQAHPILGQTKIILYGQSLGGAACFYAASKHRDTVA
FT                   GVIVENTMLSFQTLVPLIMPQIPRFLLPILLTEHWDAHKTVPLIPSTTPILFLVGKRDT
FT                   LVKAEQMLALRKLRGSGITRWREFDGEHNDTCLQPGYWEEIGKWLKEEIEDDGVEVVDQ
FT                   NDRGEKNSLKVTTEDAAL"
FT   gene            591308..592638
FT                   /locus_tag="CND02220"
FT   mRNA            join(591308..591690,591748..591861,591915..592121,
FT                   592175..592638)
FT                   /locus_tag="CND02220"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(591597..591690,591748..591861,591915..592121,
FT                   592175..592584)
FT                   /codon_start=1
FT                   /locus_tag="CND02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42989"
FT                   /db_xref="GOA:Q5KIP6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP6"
FT                   /protein_id="AAW42989.1"
FT                   /translation="MSSKDSASNSPFLYPFDPASPLFVLKGILATGTFGAITGASIGAL
FT                   QSKNPYTLGTNMTINMSIAGLAFFTVREYVVSPLLLIIEATPSHSRRLLDLQLSERQRS
FT                   KLPQVVSIGQMRTDRVLDSALAGALTGGVLSAAFRGRATFGKAAFTSALITSALQVSAN
FT                   QLRVMRLSYLAKSQTRMSSLDTASPSEQEPTATFDALKSSMPSLEPTSPPSLPERMMSN
FT                   LAKVLPVRKLSNEEYLATLEKKRAEVDKRLEEIAEEEIRMYEWAQKQQQRPT"
FT   gene            complement(592568..594263)
FT                   /locus_tag="CND02230"
FT   mRNA            complement(join(592568..592804,592864..592945,
FT                   592992..593206,593260..593315,593365..593585,
FT                   593668..593878,593977..594115,594178..594263))
FT                   /locus_tag="CND02230"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(592650..592804,592864..592945,
FT                   592992..593206,593260..593315,593365..593585,
FT                   593668..593878,593977..594032))
FT                   /codon_start=1
FT                   /locus_tag="CND02230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43123"
FT                   /db_xref="GOA:Q5KIP5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP5"
FT                   /protein_id="AAW43123.1"
FT                   /translation="MASSEVLHPKAVAVITGAASGIGLAAALRYAKEGASIVLVDIDPA
FT                   ALDPAVEKVKSVEGVGTVFGVRVDVGNVKEVASLRDRVLEEFGEVHILMANAGTSTKAP
FT                   TFSLGTPLEELQSHWNKVLNTNFFGVLNTAQAFAPFMVKQENSSVIIITGSKQGITCPP
FT                   GNAGYNVSKAAVKTYAEQLSHELRSDPDSRCTAHLFIPGWVFTSLTGANNIGATKPPGA
FT                   WTPEQTVDYMVDKVFGEGDFYVICPDNETPTSLDKARIQWSMDDVIQNRPALSRWHPSY
FT                   KARFEDFIQSKQGLAARSRSRGRPAQRDGSQVPSVVSIPSETDLLAFRRN"
FT   gene            complement(594335..596880)
FT                   /locus_tag="CND02240"
FT   mRNA            complement(join(594335..595622,595669..596196,
FT                   596258..596562,596622..596694,596745..596880))
FT                   /locus_tag="CND02240"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(594414..595622,595669..596196,
FT                   596258..596562,596622..596694,596745..596792))
FT                   /codon_start=1
FT                   /locus_tag="CND02240"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43347"
FT                   /db_xref="GOA:Q5KIP4"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024679"
FT                   /db_xref="InterPro:IPR037947"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP4"
FT                   /protein_id="AAW43347.1"
FT                   /translation="MPKATRKKKEKKADFVKAKLKLGKGKKQASNTTDTSFKARSIALP
FT                   GQEALNRALQISEGAGPSEPTTANGLTLEDIFIRLRHPNSVVRKEALGGLREILQVDVS
FT                   REVGKVLRALGGLVADDDAAVRKGLLGLLDWYLAHLSQSILSPHLPLLVLQASSALSHI
FT                   FPEIRLDACKLVHLMLQYVPSHVVSSWPYESSNILEGLRLAVGLGGEKGVNSQIGRLTG
FT                   GAKLVTMKAMREFVRIGLENGMTQKWGGGYLEDRQSSRGKFKVVKEESGLENVQLEGWL
FT                   VGTRMAKLVGDGDAWELGRLGSLGGKGDEEGVVSVLSQLYIQLHPLLLSTFLENAPTAF
FT                   SPSMASVTPASEDIPLALCVMTASLTELLADAILTRATPDANTPELRQVKNCISDFHRR
FT                   MTGWFPFNSRTAPTPSGVTPGFELSLAYARLAVLLSPRPVDLTFTKHSTKRGKEVRWRE
FT                   RVKATEEAWKTMRESERAKGKGKIGQNQWAMEEVADWVVEVLEPKKDVLAPSLTPEAYS
FT                   ALLPIVWALLAQPPCLASDDTDIPSHVGSAFISHLIRQGSTSPIREIGEEFLIALILVH
FT                   EKKYPILPFYIVPQSPLRPMIKGWFEGIPKTLFELGTKNQSASERLLRFLLVIGSRGEG
FT                   AYEQPYSLIDPATFPSLTPKLAPFWHLQHPSKGSIPGAWTKFNSGEVKRLGLDVAMVWK
FT                   QWNGLRLSDAIGRVCGHDQWGSYWRR"
FT   gene            complement(597053..600243)
FT                   /locus_tag="CND02250"
FT   mRNA            complement(join(597053..597597,597648..597836,
FT                   597886..598512,598561..599201,599250..599522,
FT                   599583..599902,599947..600243))
FT                   /locus_tag="CND02250"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   subunit, putative"
FT   CDS_pept        complement(join(597118..597597,597648..597836,
FT                   597886..598512,598561..599201,599250..599522,
FT                   599583..599902,599947..600116))
FT                   /codon_start=1
FT                   /locus_tag="CND02250"
FT                   /product="cleavage and polyadenylation specificity factor
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42988"
FT                   /db_xref="GOA:Q5KIP3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR025069"
FT                   /db_xref="InterPro:IPR027075"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP3"
FT                   /protein_id="AAW42988.1"
FT                   /translation="MITLTPLSASAAETSPSEPICYLLELDDARILLDMGQRDYRASSQ
FT                   QCSWDYEEAVRDLAPTLSLVLLSHSSSNYLSLYPYARARWGLTCPVYATQPTVEMGRVV
FT                   CLAEAESWRSECPVDSEKVAADDGSKKPLRGPFVPTVEEIHEAFDWIKAVRYSQPLHLG
FT                   GDFSHLLLTPFASGHTLGGSLFKIRSPTSGTVLYAVGINHTSERHLDGMVGVQNGPTGY
FT                   ADGVLRPDLLIVEGGRSMVVNPKRKEREAALIDTITSTLESNHSVLLPVDPSPRLLELM
FT                   ILLDQHWTFKRTPKVKQRRYNEPPADLWPYPLCIVSKTAQDMVAFARSLIDWMGGVVKD
FT                   SAGDMVDVGRGKRARGARMALGSEYGVLDFRHVQFFLNTTDLLQTYPLTRPKLVLAVPP
FT                   TMSHGPSRFLFTAMANTEGNVIMLTGRSEEQTLARDLYNRWERSQTTGSKWGEGKIGHL
FT                   TQLEGKLQVEVDSKVPLSGAELEAHVESERLQKEKEAAHKAAVDRSRRMLEADDLESDS
FT                   DSESEADGHAGDITVRRTEGANAYAGDGEDVRTMSFDIYVKGQQMRSGRGAEMARFRMF
FT                   PFVERKGRKIDQFGEGLDIGQWMRKGREIAEEGETEEVREAKKRKEEEEEKAKQAPEPP
FT                   SKYVSEEVGVELKAMIGFVDMEGLHDGQSIKTIISDLQPRKLIIVRSSKESTQNLISFL
FT                   GSVTGFTRDIFSPSLTEEIKIGEHVQSYSLTLGDSISSALAKKWSDFEGYEVTFVDGKI
FT                   VLPAGSTIPILETPSLVGPLVKTEAEGDDADDEAKPSAEELAAASAPPISSSAPLPLPT
FT                   STFIGDLRLARLKHRLSLLNPPIPAEFAGEGVLVCGPGIAQEAQGAASVVSVRKIGEGK
FT                   IVLEGCIGRVYVEVRKALYGGLARVDAA"
FT   gene            600314..605472
FT                   /locus_tag="CND02260"
FT   mRNA            join(600314..602162,602225..603555,603608..604611,
FT                   604674..605472)
FT                   /locus_tag="CND02260"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(600464..602162,602225..603555,603608..604611,
FT                   604674..605340)
FT                   /codon_start=1
FT                   /locus_tag="CND02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42986"
FT                   /db_xref="GOA:Q5KIP2"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP2"
FT                   /protein_id="AAW42986.2"
FT                   /translation="MFTSPKYYPASHPSSRSASRHDDRPASPQTKAQVRSEAIAKLKRA
FT                   ASLPRNADGRRPIQRHAGARTDDSSGDAEGSPGILPISVEISSLSRPDAPPRPTNDEQE
FT                   MLSPSPVQITFDHASIHPSVDHMHMQRSASASPSHNMTCNDYPSPTNGVNSERHAMQLA
FT                   QPYLPSLAPRSINSLQQQVPLAGRDTPSPLPTLGELRTLQRSNSQAARAQAMSKLTGGK
FT                   GATMNDDVSLHLPLRSLQRAGTLGANTNRTLRTPSRRRAEFSKPVAQDGHQATAFDEPR
FT                   PRLQRSFTVSSSNMGEERRSAVGRRMVERLAERRAARQKEEEEVRRLWEERKAATDPIG
FT                   KGQAHDIGRPGTDEQEQFQVTSSVSKTYDDGGVQIQAPTVASSNLLSAPERPVSGVTMQ
FT                   SAQFEYEDHLRRSLSSRTARGAVGVISEPVPPMTVPSVQSEATEEDTEQLNTPTLPQNP
FT                   MNHHPKSQASGASVPDLDAPLLPPHPPFITPTRHIAHDSTSTIQGSSNSPGGSSTPGGS
FT                   SILSGLDSMMFVTGGTGGHYAQLTSQGEVNWPVEAAEGSDWGTPGKEMHQTTLISSPTS
FT                   SARIDRPRSSTSEIFSTQVSETGGAESDYRSPNSHNSYGMPSTGSAMSSWEEVGRTDDQ
FT                   VSKAPANHSNHARSESVGAKMKRTMKSAMRKHSQSRSSMTSSSPPVSPRRGSGASAAPS
FT                   QGSVPRIWPKGEPLASNRIANHHPSVSSLSVSQANSATASSSNLIQHQLSSGPSQVSLL
FT                   PRANLNDPRIHISKLSPFPGIEHLESRSAGLEESPGEKPKLMQQVSDSVIPSHSSVLTP
FT                   GGTPAPENIYALPLVARAEANKRLSGESVTKRNWLTKALTSPRSSLSRKISYGDVRNRG
FT                   NPLGQGAMVISSGVDPFASPPMGAVPTSSTPSIPSSMSPGGKSNAASPTVSTVPEMNED
FT                   RTRAATLVRLREGESAPGMIQERVQMRKEALLPKKTIDILRRMDEVLALGPEHPARPEM
FT                   LDDPPRKFLMSSQILQVVNADIVKDRFLFLFTDLLVIAKPILVHNIHATLDTQFTVKNI
FT                   VSLDKLLVTAPNGESPAESGRHPVVDQFVDKFKQDPVEACRYVVEKCSPAVDLATLAGL
FT                   ILRTSELDKTQVGLLLGNNEGLTRAFVDRFHFRNIRVDDALRMFLLSLRLPTDHISCET
FT                   LLKVFAERYYVANHDHLTYNQELAIELVLTIMKFNDALYSTFGFASANNVITREAFITA
FT                   FRSKDPHGLVPHDLLSQIYTSLRSMRLTQALASNEVRFERWAVITLPHTSTKLTYNVWS
FT                   EKIYINIPAPDTKLRIKLLGEGLEFDPPELDFANKTEESFKLKGTSLGMKTLLLVRVGD
FT                   NAALYGSLGSTRQFTVERAFMRHTFQIAFSNHRGLKREYCFSTNSSASCQKWRELLEKH
FT                   IKETKRAKSMKGSSSRDVVRQTAEAVSFQVLRDALICSEETAQPTQKNAALRLGGNATA
FT                   LSEQDVESRSRTGSISAAYAQFALKEEYELGPLQRTRGEKDMDKASEKVNTRTGKELVL
FT                   LCRQNSLMPGLLKLLHAGAEHGPDDGQAREGVGRDENVVRSKGKRV"
FT   gene            605596..609769
FT                   /locus_tag="CND02270"
FT   mRNA            join(605596..606024,606077..606489,606540..607151,
FT                   607198..607278,607328..607519,607568..608356,
FT                   608403..608492,608543..608728,608779..608912,
FT                   608972..609418,609471..609769)
FT                   /locus_tag="CND02270"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(605841..606024,606077..606489,606540..607151,
FT                   607198..607278,607328..607519,607568..608356,
FT                   608403..608492,608543..608728,608779..608912,
FT                   608972..609418,609471..609591)
FT                   /codon_start=1
FT                   /locus_tag="CND02270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43125"
FT                   /db_xref="GOA:Q5KIP1"
FT                   /db_xref="InterPro:IPR012943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP1"
FT                   /protein_id="AAW43125.2"
FT                   /translation="MPPSNTLAALMASPATSGGDATVMANGQTLPDISLGSLGSSFKSD
FT                   EEGYVQQIGSSDPPSKANRRRSPETSHFQSISTSSPPRGALLTVSPPPTVRKSSSQSAL
FT                   SNTQAPRRPRVLHRRTSNSSIESDDISGPLEARYGKEEDTDDEAILSALSLASPKKEYG
FT                   AGKGRGYVVGTSARNGRHSVAAGELNGPMTLRDQEKQLEETKKEVFNLQLENHFLKERL
FT                   SNMAPEHIEGALKENVKLKLEILTLGKELKKLKKLVMQQDKDLAAAARESGKSQEAREF
FT                   EKLWGQEKERRKAAEQEIKILQEEMGADGINELRSKLEDAEASEDVWRKRTEELEAELE
FT                   DQKALNEDQIEQLERFRDAADRAHDEIERMREELKDAKSLSESVGLGKGREARLAQKVQ
FT                   ELEQENASLQADLSIAKKGVMTEDDAELLEERLNELQDKVAAAQLELDNRDREVDELNA
FT                   ELDAKVREHEKELQQVAEEWRDEVLEARTQIDELKDALDAREQEIKEIRDSLLEREEHL
FT                   TGALEEIQELQAAKAITHDRLEETLKNIERDNVEKDAELMDANREIEELGQRVYELEEA
FT                   LEDHRAREANLSADLRSADEEFENAKAHYEDLINVLKEARRKIQEEKEEALTRLGQERE
FT                   ERRSDREGIKRELDTENSRLRQALSEKETQASRLQFELDAARERIDLRDRDLSQVERKL
FT                   HDLEDERRKLGDEHTSNRFGLELEIDRVKRDLQRCEDELDIAKRELEERNENLRDRDIE
FT                   LATMLDKQRDIENKLSSERQGRLNISDKLDQTLKTAKQHEREANLLRERIEELEPLLTE
FT                   TQQERFQLQKQSETQRQERSELLLRVFKDVNKFLGVEHHTTPANFALFRDTLLQRLKSM
FT                   MSVRTEFEKKLKDTEASVDQRMASLKRQLEEKWRTLDQFEAAVKKLELTKREWRSKFAI
FT                   KEGELQAVQARNNELHSQISSLKSDTASGSSSQVRSLTERAIAAEKRAQTASNQLASLE
FT                   ERLAEYQTRYGQAESKWEARVKEYENRLRIAGEKIKTEKQGGKERAVQLEAQVRELEKQ
FT                   VQEARKRNQRAENVVASAAHLLPGYDERAGRTPW"
FT   gene            609842..611266
FT                   /locus_tag="CND02280"
FT   mRNA            join(609842..610043,610094..610356,610417..610603,
FT                   610656..611019,611073..611266)
FT                   /locus_tag="CND02280"
FT                   /product="oxidoreductase, putative"
FT   CDS_pept        join(609906..610043,610094..610356,610417..610603,
FT                   610656..611019,611073..611149)
FT                   /codon_start=1
FT                   /locus_tag="CND02280"
FT                   /product="oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42968"
FT                   /db_xref="GOA:Q5KIP0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIP0"
FT                   /protein_id="AAW42968.2"
FT                   /translation="MLLRPPLFTKLTKTSRLIRPILTTRHFRTTPLTMGDDQPKIITAY
FT                   PELTDIKAQHQSLPGKDVDMDPLAEFTKLETWDDDGKPYLKEYTGSGKLKGKKAIVTGG
FT                   DSGIGRAAAQMFAREGADVTIVYLPEEEQDAQRVKKAIEQDGQQCLTIAHDLMQADLAA
FT                   DVVKQHMDKFGKLDILVNNASKQIMSQSIAEIELENVESTFRSNILAMFALTKAAVPHL
FT                   KRGSTIINTSSVTAFKGSVAMVDYASTKGAIVSYTRSLAVQLAPQGIRVNGVCPGPVYT
FT                   PLQPASRPPDNMEGWSVGGPPLHGRASMPAEMGPAYVFLASSDANAMTGHFLHLNNGQW
FT                   LG"
FT   gene            complement(611247..612495)
FT                   /locus_tag="CND02290"
FT   mRNA            complement(join(611247..611552,611607..611770,
FT                   611826..612034,612096..612189,612245..612281,
FT                   612337..612344,612407..612495))
FT                   /locus_tag="CND02290"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(611412..611552,611607..611770,
FT                   611826..612034,612096..612189,612245..612281,
FT                   612337..612344,612407..612410))
FT                   /codon_start=1
FT                   /locus_tag="CND02290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43140"
FT                   /db_xref="GOA:Q5KIN9"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR031781"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN9"
FT                   /protein_id="AAW43140.1"
FT                   /translation="MDYQNRAGANKGSGGVAGASETAVDRRERLRKLALETIDLAKDPY
FT                   ILRTHLGTLECRLCLTLHVNEGSYLAHTQGKKHQTNLARRAAKDNKDQTLMIQAPTAAQ
FT                   QVKKKVFVKIGRPGYKIIKIREPVSQRMGLLFTVSLPEIKAGERPRRRFMSAFEQRREI
FT                   PNKAFQYLVLAAEPYETIAFAIPSKEMVDVDEDPESTWEHWDADEKVYSCQFLYK"
FT   gene            612617..614292
FT                   /locus_tag="CND02300"
FT   mRNA            join(612617..613222,613279..613360,613411..613889,
FT                   613948..614292)
FT                   /locus_tag="CND02300"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(612645..613222,613279..613360,613411..613889,
FT                   613948..614191)
FT                   /codon_start=1
FT                   /locus_tag="CND02300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43126"
FT                   /db_xref="GOA:Q5KIN8"
FT                   /db_xref="InterPro:IPR007823"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN8"
FT                   /protein_id="AAW43126.1"
FT                   /translation="MSLFPSAFESGVSKISPTLASAGKGGKKTNKRKHSDANAGLGQAQ
FT                   QVKQADANFEKLMRKFEGGEAIGKEEGKESMGVVGKKRNKKNKSRQVNDEEIVHSTPRA
FT                   KGDKPKPKPTPKSDQAKLNQAAKQNQTDTPPSKKSKANKITPGFKLEPVQLPIPIPPPS
FT                   KGTKLKVGGEGNLTEMQKDMQAKLEGARFRWINEQLYSTPSTEALAMMRKDPKIFADYH
FT                   QTHRLLTSAWPSPPLPHMINLLSSLPSGTVIADLGCGDAGLARALVPQGKIVMSFDLVG
FT                   DNGVLGAETTESNAAGGWVVEADFLEKVPLPGRPGGLDYGVSATEESEGKGKRKNKKKG
FT                   SRKRDVASSEIVDAVVCCLSLMGTNWVGGISEACRILKQGGTFHVAEVTSRFTSTEAFV
FT                   STVESFGFELEEESQPSTHFTLFRFTKNSEVPLGPVKGQEGWEERVRKGEEILRACVYK
FT                   KR"
FT   gene            complement(614268..617952)
FT                   /locus_tag="CND02310"
FT   mRNA            complement(join(614268..615333,615410..617624,
FT                   617666..617952))
FT                   /locus_tag="CND02310"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(614450..615333,615410..617624,
FT                   617666..617728))
FT                   /codon_start=1
FT                   /locus_tag="CND02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN7"
FT                   /protein_id="AAW43138.2"
FT                   /translation="MSPPAALADRRAHRLAPATKKPRMPLTTEPSLNARGTAAHDRTDG
FT                   RRRAKQVRDDTPTAPAQAHRHSAASHAHRRQRSSIALPSGAVSQAPVRPSVVGVYGDQP
FT                   EQTATTPPTPMLEKSPIPQEDEQEQGKGHDGEYEHVAARLSAFSFASKPAAGPFPPQRR
FT                   QPARLGSQSILGHELVSSPLSSPTSPRRFSNTSSRPPSLLLARPPSNALSPPRSAAGPS
FT                   SPPAQTKKKRHSHTRSNSISLPNIKLQNAASRPSSFNVLHSPSVGSPVSPTSPHGESKP
FT                   SRLAGLNSQRLKFEPSGRGAEAEKEKEESRRRALEKLTGSESRSTSPFVESPVAEISLP
FT                   DLDDEDSSSVASSNRPLSGAFGQPTFSWSNQPSFSFLPLPLGSSSPSPLSASPFSGASP
FT                   ADGQSADTPERCSGQSFGLPHGSLSMSGPKEDPLDYGMEVNDASIGKRPTMNRQLSALQ
FT                   EVDESEEDEEKMLGNVQEEAEEEDTAAPVVPTIPPENAPQDPESAVSPSGLRELRLSSS
FT                   ISSPRHYKTPSSSDRYSFPQSLTSPPPSAGSIGSSSPTKSYGTIGRGRPNRSNSDAGMS
FT                   NHRGPTPKRTTSNAGSRGSISYKKDASSSGSKELGELIASPSLTSGSTVSGGNNSSIKG
FT                   IWANTVTRGMRPCPRVRLTGDAGSGRVLTEVNEMEEEGSLERRRSASARIDLARSSIES
FT                   GRPSSELSRDSLDRSYWSDVQLDMERENESLRDELGFWKEKCRTLEERLDSERKESVVL
FT                   RERVRKLGDRLSSISSLPTERSDIYSQSQQAAESRLIAQMREQLFTLTGKLQQEHRAKE
FT                   MALVKLNDLRGHVAAQGHHQLTGRTEQDEDSGDEILLSRSATSRETTPSLTPPQTDLPT
FT                   SPALASPKPFTIDKVDDSESSISKRFTPDFTRLKSWGFPATPPTGSDNVPDSKEKKRES
FT                   FFGLSNPLRRASSDDGPRISEGIDLPPFVVDENTPGVFPALVAGDLPTLGGGVNVRAVS
FT                   DPTSLQSYGRDTLSDLPGIGPAQFRIPTITVNDGGAFRAAGVMCSGILDFRKGCRCCVG
FT                   DVVEV"
FT   gene            complement(618480..621691)
FT                   /locus_tag="CND02320"
FT   mRNA            complement(join(618480..618650,618725..618986,
FT                   619048..619124,619192..619683,619754..620012,
FT                   620078..621030,621085..621411,621459..621559,
FT                   621607..621691))
FT                   /locus_tag="CND02320"
FT                   /product="vacuolar (H+)-ATPase subunit, putative"
FT   CDS_pept        complement(join(618600..618650,618725..618986,
FT                   619048..619124,619192..619683,619754..620012,
FT                   620078..621030,621085..621411,621459..621559,
FT                   621607..621634))
FT                   /codon_start=1
FT                   /locus_tag="CND02320"
FT                   /product="vacuolar (H+)-ATPase subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42964"
FT                   /db_xref="GOA:Q5KIN6"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="InterPro:IPR026028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN6"
FT                   /protein_id="AAW42964.1"
FT                   /translation="MATNYPSLFRSEEMSLVQLYIPSEVAHDTISELAEMSNFQFKDLN
FT                   PSLTSFQRPFTPRLRRLAEMARRLRFFRSQITSLSPPLGVPPLAAVPPFTTVGPRAQNA
FT                   YDELEEKLKEHERRLNEMNKSWEELGRRKSELEENKCVLKETAGFFDEAGHRHTEIRTS
FT                   MEDSSDAAPLLEHAAEYGTLPGESGLSGFDLEFVAGTIDRARMPTFERILWRVLRGNLY
FT                   MNYSEIEEPFVDTVSGKETFKDVFIIFAHGQELLAKIRKVAESMGGTLYNIDSATDKRS
FT                   DALRQVSARLEDVDNVLYNMGQTRRVELSKIAESLEAWTDAVMREEEIYKTLNLLSYDQ
FT                   GRKTLVAEGWCPSRDITAIQLGLRRAMDTAGTSVPAILSELRTHQTPPTFHRTNKFTEG
FT                   FQTLIDSYGIATYQEVNPGLYAVITFPFLFAVMFGDIGHGILMFLTAAAMIFWERQIAK
FT                   NGVNENVETFFFGRYLIVLMGIFSVFTGFMYNDIFSKTLHLWQSGWEWPSNSTGLIEAE
FT                   PTGNIYPFGMDPMWHGSDNALIFNNSYKMKMSIILGVIHMTFAICLQVPNHIHFKKPLN
FT                   IYAEFIPQMLFFHSIFGYLVVCIIYKWSVDWSQSVTSPPGLLNMLIYMFLSPGTIEPGT
FT                   QLYAGQGFIQVVLLLIALVCVPWMLALKPYMLWKEHQRIVAQGYQGLQGQDNGGMHGRD
FT                   SIGAESRAEEEEEVGMAVAESSDEEHPFEMGDIIVHQVIHTIEFCLGCISNTASYLRLW
FT                   ALSLAHAQLSEVLWSMTLQLAFDFNGGLISRAVFLFVMFAVWFGGTVGILCVMEGLSAF
FT                   LHALRLHWVEANGKHYMAGGYPFTPLSFATIGQEEDI"
FT   gene            621842..624874
FT                   /locus_tag="CND02330"
FT   mRNA            join(621842..622129,622182..622279,622341..622435,
FT                   622482..622578,622626..622718,622766..623141,
FT                   623211..623301,623354..623718,623770..623885,
FT                   623939..624153,624207..624375,624424..624874)
FT                   /locus_tag="CND02330"
FT                   /product="transferase, putative"
FT   CDS_pept        join(621846..622129,622182..622279,622341..622435,
FT                   622482..622578,622626..622718,622766..623141,
FT                   623211..623301,623354..623718,623770..623885,
FT                   623939..624153,624207..624375,624424..624776)
FT                   /codon_start=1
FT                   /locus_tag="CND02330"
FT                   /product="transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43127"
FT                   /db_xref="GOA:Q5KIN5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="InterPro:IPR013234"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN5"
FT                   /protein_id="AAW43127.1"
FT                   /translation="MWKVIYYLNLALYTILLISTSFLAVLIAIVCSLTGRRLNTNYFVA
FT                   RTFYCIAGTILGWKFQVEGEQYLWELSGEHGGGKANEKGRSMVMVGNHQSFVDILYLGR
FT                   IFPKHAAIMAKKSIQWIPGLGWFMMMSGTVFINRSNNKSAIASLQHAGEEMKRKRISLW
FT                   IFPEGTRHNTPEPELLNFKKGAFYLAVQAGVPIVPVVCENYNHLFNGKSHFRRGTLRIK
FT                   VLPPISTTGLTAADVPGLIERTRNAMLETLQEISTPSQSTSQAGSPDPLLGRSGRERED
FT                   YYTSGSPAPPQSVPSTAEIGTEEEAEAAVEDAIGREEADNGERHVPVVGKNNKEDETMS
FT                   SPRRLVIAMVSDFFFPVIGGVEGHIYSLSVELMRRGHKVIVITHSHPDRLGIHYLEPSL
FT                   KVYYLPYLPIASSASLPNFLLFLPYFRHIILTENIQLVHGHGALSSLAHEAVIHAPLLG
FT                   VKAVFTDHSLFGFGDAVGVLTNKLLGAALRCVDEVICVSNTGRENTVLRAQLDPSIVSV
FT                   IPNALEAEHFKPDPFRADPDWITIVVISRLVHRKGIDLLISSAPQICALFPKVRFIVGG
FT                   DGPKMVELEQMREKYELQGRVELLGRVNPGDVRDVLTKGQIYLSNSLTEAFGISIIEAA
FT                   SAGLFVVATKVGGVPEILPQDMIEFCRADEDDVIRALTHAIHTIQSSRHSPWSAHIRVR
FT                   DMYSWSHVSSRAEIVYLRAMSRPHREIGERMRRYLELGPVFGVVMCCILAVEHYFFWLL
FT                   EWWNPRDKLRQVISFPGVERFEDRGKNNKK"
FT   gene            complement(624853..628007)
FT                   /locus_tag="CND02340"
FT   mRNA            complement(join(624853..625249,625303..625812,
FT                   625863..625888,625940..626663,626708..627064,
FT                   627112..627394,627444..627532,627670..627755,
FT                   627811..628007))
FT                   /locus_tag="CND02340"
FT                   /product="allantoicase, putative"
FT   CDS_pept        complement(join(624944..625249,625303..625812,
FT                   625863..625888,625940..626663,626708..627064,
FT                   627112..627394,627444..627532,627670..627755,
FT                   627811..627874))
FT                   /codon_start=1
FT                   /locus_tag="CND02340"
FT                   /product="allantoicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43136"
FT                   /db_xref="GOA:Q5KIN4"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN4"
FT                   /protein_id="AAW43136.1"
FT                   /translation="MLTPQQIPLEEFDSNIKSNYVEVSSSALGGEVVACSDDFFASCHN
FT                   LIKPTPSVSMKGQFGPNGALYDGWESRRHNPAYDWVIIRLATPLTSLHYVDIDTSHFNG
FT                   NEAPQSQVFALSLPSDGSTPMWTQGNPGWVEVLPVVDLGPNSRHIFEVGKAGKEGKWGA
FT                   VMVNMMPDGGMARFRAYGLPQGPSLPKSLPANYQSLQPTNLLSPLIGGRIISCSDAQFS
FT                   PPGNLLLPGRGVDMSDGWETRRSQENRGKYAPGGPLAGQERKEWAVAKLGVPGIVRWVE
FT                   VDTAFHPGNYPKYCAVEATLSSDEDLSSASWTTIVRKTPCGAHRQHYLPLEPNVPPTQV
FT                   FSHIRYSVFPDGGTKRVRIFGHPLDPTSPDAQGALEKARLEPMIIPALPLTPEAFKPYG
FT                   QVVQGFSLPTSAPKGIHVNIANQGTAFKFHRLAKPAESYAPGLLQKGGIHVGAVKASSK
FT                   MDIKNGKRIKVELLERHRHTSQAFVPMGAEPGKEGKQGAFVVVAALNGPDDKPDLSTVR
FT                   AFLATAAQGVNYDEGIWHHSLLTVGGDLNYAIVEAQMSVPNEIRDCEKVVPPSELHVEV
FT                   PPYPFTHPSTASVSAAHVVGHQTNSVLPSLASLLPGKALKPVPITPENFAPFGHLITTT
FT                   PSSSHTDTERAPDGLTVKHNRLAPVISTYPEETGAVTGIAVFRATKKVGLERGKVFDVR
FT                   YMERHPYTSQTFVPMGKGEWPGHGEAALPPGGEFLVIVAQNGPDDRPDPSTLQSFLLPA
FT                   HQGLSYSPGTWHHPVLVLDSTLDLMCVETQIATGVHDSDGRDCELLSWEGEEVFGRVAV
FT                   PE"
FT   gene            629718..630603
FT                   /locus_tag="CND02350"
FT   mRNA            join(629718..629862,629917..630236,630290..630603)
FT                   /locus_tag="CND02350"
FT                   /product="expressed protein"
FT   CDS_pept        join(629814..629862,629917..630236,630290..630466)
FT                   /codon_start=1
FT                   /locus_tag="CND02350"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43128"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN3"
FT                   /protein_id="AAW43128.1"
FT                   /translation="MRLLSWIVLPLIPFVSAGVSTIYWPVSNPDPSNPWVIGEKNLLAW
FT                   TTGSGTGVQSFDVQLHNSNRSVMVGFLPIALRVPMERLPSGYKNYGGEMEVDLGSNIPT
FT                   GDGFYLLFMNTYHGEVYAKSKKFSIYASTPANFTSADLPTATVTATLSEAPNPTQQWAI
FT                   TLNGVDQDATATATSTSS"
FT   gene            complement(630583..631376)
FT                   /locus_tag="CND02360"
FT   mRNA            complement(join(630583..630904,630958..631044,
FT                   631096..631376))
FT                   /locus_tag="CND02360"
FT                   /product="co-chaperone, putative"
FT   CDS_pept        complement(join(630800..630904,630958..631044,
FT                   631096..631263))
FT                   /codon_start=1
FT                   /locus_tag="CND02360"
FT                   /product="co-chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43135"
FT                   /db_xref="GOA:Q5KIN2"
FT                   /db_xref="InterPro:IPR004226"
FT                   /db_xref="InterPro:IPR036126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN2"
FT                   /protein_id="AAW43135.2"
FT                   /translation="MPDETSQTLRQLKIKTGVVKRLHKEESSYIQEVEDQQKVVEKLKA
FT                   DGADGADIRAAERVLKDSEMMVPRTRRSLEEAFQALEDLVNALGSDESIAGTQEFREAF
FT                   SQLQQVEVDWKTDGN"
FT   gene            631537..632933
FT                   /locus_tag="CND02370"
FT   mRNA            join(631537..631692,631770..631872,631970..632093,
FT                   632148..632289,632342..632599,632649..632781,
FT                   632832..632933)
FT                   /locus_tag="CND02370"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 11, putative"
FT   CDS_pept        join(631602..631692,631770..631872,631970..632093,
FT                   632148..632289,632342..632599,632649..632683)
FT                   /codon_start=1
FT                   /locus_tag="CND02370"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit 11, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42958"
FT                   /db_xref="GOA:P0CN54"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR009374"
FT                   /db_xref="InterPro:IPR016020"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN54"
FT                   /protein_id="AAW42958.1"
FT                   /translation="MVTAVSPENLKEWHTPSTRPDVIHELIHGVDRYNPSNLPFMEDYL
FT                   ATELKEGQYDLFGNLAILKLYQFNPQHSNPDVIINILIKALAATVSGPDFNLCLEMLRE
FT                   PSAILHDIESADEALVIVMPYLQRLHELSRTCQFTKFWQEINSDSEAAKILRTRYLPQH
FT                   ASPLDDFRFIFSASIASCFRRISLSQLSRWLDIPSDKVGEWCSKVEWTVEGQDAVIPNN
FT                   GQNDVKAGVVKENVQLGQLTKLVAAAGY"
FT   gene            complement(632907..634528)
FT                   /locus_tag="CND02380"
FT   mRNA            complement(join(632907..633076,633134..633512,
FT                   633569..633852,633902..634215,634274..634528))
FT                   /locus_tag="CND02380"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(633008..633076,633134..633512,
FT                   633569..633852,633902..634215,634274..634379))
FT                   /codon_start=1
FT                   /locus_tag="CND02380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42962"
FT                   /db_xref="GOA:Q5KIN0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIN0"
FT                   /protein_id="AAW42962.1"
FT                   /translation="MPVVRFPTLAEPVSLGALQLNTRVIMASLTRNRSIPTTVPNEDNV
FT                   KYYAQRAGPGRSGLILSEGTLIAHQGTEWENAPGIWDEEHANGWKKVTDAVHDKGGLIV
FT                   AQLWHTGRVCHPDMIEQKRSGDPVWAPSDVGARGGKFRTLPGKPGYISDPTPIPDPTYI
FT                   LDQYSKAAEMAKLAGFDGVELHSANGYLIEQFLSDVSNTRTDKWGGSVENRIRFGLEAA
FT                   KRLIDVWGADRVGVKISPCGGYNDTYNTTGDSRLETFKTYISRLDSLGLAYIQLMVAVL
FT                   GDDHHGGKPQGFPHDIIGTYGPLIKKSKLVVNGNYTPESGEEVVKSGKAAAVVYGRNYV
FT                   ANPDFVKRIQQGLPLAEINMKGLYTPAVEGQNGSGYNDYPDAE"
FT   gene            complement(635221..636338)
FT                   /locus_tag="CND02390"
FT   mRNA            complement(join(635221..635722,635865..635968,
FT                   636037..636089,636140..636160,636214..636338))
FT                   /locus_tag="CND02390"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(635638..635722,635865..635968,
FT                   636037..636089,636140..636160,636214..636271))
FT                   /codon_start=1
FT                   /locus_tag="CND02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42960"
FT                   /db_xref="GOA:Q5KIM9"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM9"
FT                   /protein_id="AAW42960.2"
FT                   /translation="MSKLIGRLLVGLACLALFHAAFSTYEHLSILKALSRPTSGLPLSI
FT                   VIEAFVSLICFIIGIVYATGELKDVTYRGELAHRTIDDSDARMGFMKLSKRGKAIFGDL
FT                   DR"
FT   gene            636456..646782
FT                   /locus_tag="CND02400"
FT   mRNA            join(636456..637060,637131..638078,638134..641659,
FT                   641716..641863,641910..642249,642302..642471,
FT                   642538..642640,642681..643355,643418..643695,
FT                   643749..644147,644185..644467,644529..645161,
FT                   645211..645696,645749..645878,645948..646483,
FT                   646540..646782)
FT                   /locus_tag="CND02400"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(636713..637060,637131..638078,638134..641659,
FT                   641716..641863,641910..642249,642302..642471,
FT                   642538..642640,642681..643355,643418..643695,
FT                   643749..644147,644185..644467,644529..645161,
FT                   645211..645696,645749..645878,645948..646483,
FT                   646540..646575)
FT                   /codon_start=1
FT                   /locus_tag="CND02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42956"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM8"
FT                   /protein_id="AAW42956.1"
FT                   /translation="MLFLPSFTAISVTLLILVLSSLVVHLHILPLLLRTFTQVRVSSFS
FT                   VISITGLEWRNEHEQEDIIPTLRIERARWTWGGIKGDVTGLVVLRIEGVSWRIKNNPSG
FT                   DLKNGRPSVQHRSPSRFKNRLITFILRLLIHHYPSIARLVSIQLVNCRVIFDDLDGIEL
FT                   TWKELGFGVKVEFRGMAEEAAVSTAPEREAPFRSLSSISFKDEYDIPPSFPTTAMSTPS
FT                   RHTQSLSGSPVMHTSFALPPLAEPCEASLPPSPGKKAQTTPRLSSPKPFHSRMSRTANK
FT                   IWTRATGRMYGSVSFNIYIDTIRCIDPRNSPPPSAKPSIPDLKSSTARRSQFISFRPLK
FT                   RCHPVYDLHSSDAGVSTLVALDERSSVRLSLGFGPKKGLLGEDTLSAVYEMGKLRTTIE
FT                   AVEKANKLLNKSKKNKQMEKKGMNRWSTHGTARVILRAMQSTKVSFAHITLLHHLHNPS
FT                   PIMPSLSQSHLSSISSLDLSSSPTGDRYTIILELSEIRCALSSADSSNNDRARNAFGTN
FT                   SSPESIIRGVGAEFGWKSIELQCIAPGESSNDKSQLFAIRQAQVIGFSSWRPEGWNREE
FT                   LLFASDPNIALVVCQADVASVDCAGDLQLLHELEAAWKATYPKSPTSSPPPSSESPIIS
FT                   HEDPSGWLPPRLRMVFDVGDIMAVLADRVSENTTTLTFALAGVHSSCYTSFSDIIARRR
FT                   DRVATKEAFKEEEELQQRREENDELDFAVHPSMLPAALRRRSTANKAELRDNLSISMRC
FT                   DATVKMEPIRVKMTLSGDKVYELAEIGRIYGTVTGDILGRLKVKPDGTESSSFDWSSIS
FT                   CGLDVGIQEGIDVDLWKEEVVEALIGMGEAHQRRPKDDRQPSPSEGKKTTTILDKLPSG
FT                   ISARLSLGKVNVFLGVRDPNPECALGLTRGLWFRTVLKLEYAYHKTVIQSLPWRHTLTT
FT                   PRRAKLRLPEDITTQSLAFGAKLRSTGGSAALVSINTEETYFQPIYNGEMFIKKGGFKK
FT                   GVLRKDPPKAREDDEFVGWGFQRAKQLRAMDEGKFANNVPPFEMRGTEQARRPWLRIPR
FT                   SHTSFAAQQPAPGSDIEYKITTRMESPTLISDLSHIYCHLLAGLMVKRVSAAWRSGSGK
FT                   SQVTQSALPSNNLNLSIDVSIPGMTAHFAFPLQEQLFMYSSGITFSKQPYKGMVFTAEQ
FT                   LLLYVPSPRIIGSWEELGRIKQFALALSDPHLPLVISPRIESFRVRIPFSYKLNSLILN
FT                   INVTVKACKLLFRTVSGKIPFTTVFKPCAEQPKNVPTFSFSVGYISLEIKDDPVETSLN
FT                   LIWRAGLVEQAKRNALEDNFAKKLLLISDPDTQPEVQEDTRTGSGRRMLVLTKKHSVGP
FT                   ERARWALDLLVSQSWIRRIRAAKHEQARREVLALQAISGSGVNIKLPIRVVSSSRTAPL
FT                   FRAAFHEVNLVITKPGLDRKQIIDYMGKMSAPFSDDVNFSLMVPLNIRWSMAEAKCTLR
FT                   DYPLPLIRVQRVNKNEQKPAFYMETTMVIAEELADDDSVMYVPVKVIPEGCGHNGASPF
FT                   VLEIAKTIMPVKTYAEPKFKISSKKTTEFTWGNSYQPAIQDLMKVIETLSHPPRDPSPR
FT                   VGFWDKFRLVLHWKPIVDFVGPCHLHLKGSFDPYSVSGLGSGFCLAWRGNTQLLIDQPN
FT                   ADKEAIQILADELVVAIPDLAPFHDGAAIGNNRNHRHDHHDHARERDILDDTDVVPLER
FT                   RYTKPCAQFVGGVRVGFGFKLERTCRPWSCQHGCGDTENLLHRQCREFTFLQHQQVILR
FT                   SPEAIAKAEKRLGRKVDSYEGFRSDFIHFSVSLVAPNGNGSAHRTQEETPDSVNSLHFA
FT                   PKASHHFLSWWKLFSHQMSLPIRHGKLFPDSPPPSKKFGRSLGTIKYRFDLRPVYISHM
FT                   YSQVSKDHSTTGKSESLGIKARFGRFRADAHQRAQEKIERHEKLGRSTVVVHKPFYAGD
FT                   ILADDLKVKGVRAHFVERIKGDNTPPSDPLPRASALPPETRHWYNYCDFIDVDRKPSDK
FT                   DPRIELADFGDCPHLFYCKRVKARASTSHDDSGSQASSSLGVESSKFGHEATHHCYLGM
FT                   ADCVRDAQRSITQKRINELQARLDSYPPPQDDENQSDRAVTLNRINVLVKHYEDLEKET
FT                   RHLSDETLEYSKQTTTTTFERPLSGAAFQDMIHIHGPRLVLTDGSRNIGFKYLYMMGDR
FT                   KKEEYYTSYASLRGILDTYQQRVRRRARPETEVFEDEQTKNTSADQQMVNDLIRWLSDK
FT                   PALDSLHTDDNAEEGSLRAHRGLPDDCDVKPNRHVLVFKPQIALRSESDPNAIVLLSAE
FT                   EFSFKQFKVIDSNAIDDMMADVLDRNYISMQGLQGFYPTTEALKRERTQLGMPRGLDFI
FT                   PLEIFLDVKSEATDYDRVLQKSDIMVSIDKFNNIRMPRGLEWPDTLDEYGEPIKHLRVH
FT                   QDYTAIIAPMLTVTANSRNFEALYVIVTDLLMYEDPGHKDRSEAIDDFTRTFDAADRDL
FT                   GKLVTDINALQTHMRGLLELQHGYESNFERLNDTGKEELFKIRSELQVGYENMYTINAL
FT                   IRATSAKDDARAAMKTSTKMDVRIGGVAWHMLRESRLETMAKVDINGAVFSMLTSKNGI
FT                   MDNAMVIGDLKALNGKWNTLYPEIIIRDDPSKKKIKKPFAAVYWSTRPSIGGIPIFPYV
FT                   NIEFVNIRFKLEERVGLDVMDYLFTDRTRRRQISGTAVKPPGGNGASSTTPTSSIFRGA
FT                   GMTSMDDLGGKRGEPLGIENGPLPRSRSQVSLLSLPQSDRDPVSIKRIEDTKEMRLRAS
FT                   TNKMFGTFRLQGMGFNLSYKSDDTRKHGTFSMPDCVDFRFKTPEMVYVSKVWSMEDLFE
FT                   HIKRDVKSSAWSQSGDIISQIFKKTSLFRSKERLKQAASVTALAEKAHKGKGSHQHPPK
FT                   SPSNLRYAFKNSSNSPEPDEDLIRTISRVMSHEAVPPEEKRRSKSVHRGYSNNLDIRSE
FT                   PSEGSSQRHAHLRSTNDHSPNSGKRSVEEVPETEEKGGGRIKGLLGKLKSKHLVGKDKE
FT                   PRSSEDSSGSSLRKSTI"
FT   gene            complement(646252..648574)
FT                   /locus_tag="CND02410"
FT   mRNA            complement(join(646252..646580,646638..646838,
FT                   646885..647097,647147..647223,647276..647446,
FT                   647508..647521,647598..647751,647814..647846,
FT                   647900..647941,648010..648122,648187..648574))
FT                   /locus_tag="CND02410"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(646784..646838,646885..647097,
FT                   647147..647223,647276..647446,647508..647521,
FT                   647598..647751,647814..647846,647900..647941,
FT                   648010..648045))
FT                   /codon_start=1
FT                   /locus_tag="CND02410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42966"
FT                   /db_xref="GOA:Q5KIM7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM7"
FT                   /protein_id="AAW42966.1"
FT                   /translation="MDVQTLFNVKDRVVLVTGGGRGVGEMIAHGFIANGAKVYISSRDA
FT                   SACEKTAKRLTELGPGQCIAIPADLSKYDECLRLAGEIERREEVLHILVNNSGVTWGES
FT                   FHSYPDSAFTKLLTLNVQRVFTITQKLVPMLEKAYQQENFVGRIINIGSINGVSVPGLE
FT                   TYAYSASKAALHQLSRHLASRLGPTITVNTLALGPFRSKMMKHTLDNFENELAEALPMK
FT                   RIGAPENVVATCLWLSGPAGDWITGTVVPVDGGSLVASNSKL"
FT   gene            649088..652918
FT                   /locus_tag="CND02420"
FT   mRNA            join(649088..649289,649353..649528,649602..652105,
FT                   652161..652918)
FT                   /locus_tag="CND02420"
FT                   /product="elongation factor 3"
FT   CDS_pept        join(649289,649353..649528,649602..652105,652161..652647)
FT                   /codon_start=1
FT                   /locus_tag="CND02420"
FT                   /product="elongation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:CND02420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42954"
FT                   /db_xref="GOA:Q5KIM6"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM6"
FT                   /protein_id="AAW42954.1"
FT                   /translation="MAPAATAAASSGKGSFDLATLFVADKAARDEAGLALADAVKKSGV
FT                   EFFTQIGFNDAIVKALNDKKSQSAREGACEVISTLCENGAAQLLEPHVISSAENTPFPA
FT                   LLEAFADKVAAVKTAAIAAVKAIVQSMNPWASFVLLPALLNLIRTSGKWQIKAGSLEIL
FT                   QQLITSAPYQMGEAMPDLVPVLAGAVWDTKSDVKKAAKATLEKAVSLVENKDIEKFVPA
FT                   LVKSLLNPIEEVPKTISLLSATTFVSEVTAPTISLIAPLLIRGLDERPTATKRKVCVIA
FT                   DNMSKLVDSEYTVRPFLPQLLPRLIKTAETIADPEARSVANRAIVTLRRIGKVPVESDG
FT                   SDLPPLPVAEGPHLATNFVALVKKHGGVSVEQTNPGLAYAGVLAASLVNHHNFDQKTWE
FT                   STLPPYLKLALPSYDSLPAVRELLQKKADEAETDDAKFPDEEEGEDLCNIEQFNLAYGA
FT                   KILLHHANMRLKRGHRYGLCGRNGSGKSTLMNAIINNQVEGFPPPTEVRTFYVQHDIDG
FT                   SEAEISILDWVLSDKRLLATPEEIKSTLESVGFDEVKQKNSIGSLSGGWKMKLALARAI
FT                   LFKADILLLDEPTNHLDVLNVDWLINYLTSLTRCTSIIVSHDSDFLNRTVTDVLHLNNF
FT                   KLKRYPGNLEEFVKHVPEAKSYYQLDVAEDYQFKLPNPPLLDGVKTKEKSLLKMRNVSF
FT                   QYPGSSIQQLYDISLQVSLSSRVAVLGPNGSGKSTLVKLLTGETEPNLGGQVWKHPNLV
FT                   IGYVAQHAFHHIDNHLDSTPLEYMLWRYQTGEDLEEMHKANRVMTEAELAKMKEGATVI
FT                   KDGVKRIIDELVARKKLKQSYEYEVSFKGMSSAENIWISRDELVARGFEKKVMELDTRE
FT                   AQRLGLMRPLVRREIEKHFEDFGLDAEFVSHNSMRGLSGGQKVKVVLGAATWRRPHIIC
FT                   LDEPTNYLDRESLAALIAALKNFEGGVLIITHNREFSESICTEVWAMREGHLEASGHNW
FT                   VEGQGSGERIDKKAGDDDEVEYDALGNPIVKAKKEKKLSAADKRKAKKDRMARRKRGEE
FT                   VFSDEEL"
FT   gene            654255..657103
FT                   /locus_tag="CND02430"
FT   mRNA            join(654255..654490,654563..654736,654807..655391,
FT                   655459..655543,655595..655821,655873..656142,
FT                   656198..656595,656648..657103)
FT                   /locus_tag="CND02430"
FT                   /product="amino acid transporter, putative"
FT   CDS_pept        join(655107..655391,655459..655543,655595..655821,
FT                   655873..656142,656198..656595,656648..657029)
FT                   /codon_start=1
FT                   /locus_tag="CND02430"
FT                   /product="amino acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43161"
FT                   /db_xref="GOA:Q5KIM5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM5"
FT                   /protein_id="AAW43161.1"
FT                   /translation="MSVHLEYDDKKDAAYDYTQQVAPADAVPSSSDVEDVEVKSGLKRN
FT                   LKSRHMAMISLGGVIGTGLFLGTGSALANGGPLGLFLGYATMGSICYCVMICLGEMISF
FT                   LPIPGGHIKLAERFVDPALAFTMGWNYWYNWVIILPAELSAAAVLINLWNDTINNALWI
FT                   SICLVVVVAINFLGFFGECEFWFASIKILTIVGLIILGIIITAGGGPDHTSIGFQYWRN
FT                   PGPFVQYEGISGSLGRFLGYWAVLTQAAFSYIGTEIVAIAAGEAKNPRRNLPRAIKRVY
FT                   IRILVFYLGGTFIIGLLVPSNDEGLALNSGNALASPFVIAIRRAGIPVLPSIINACLLT
FT                   SAWSAASSDLYTSSRALYGLSITRQAPKIFSRTTRRGLPWVSISFCALFAALSYMSLQS
FT                   TAGEVFGYFSNLTAAAGLMTWWGICFIYIRFEKGLRVQGIARSSLPYSSRLNYRASAAW
FT                   YGIIMITIILFFSAWSVFLKDNWSTSTFVTNYLPLWLFPILWVGYKYIKKTHFVRASEM
FT                   DFVSGLQAIEAECHDETPPSTILGKFWDFLM"
FT   gene            659406..662139
FT                   /locus_tag="CND02440"
FT   mRNA            join(659406..659744,659798..660017,660072..660132,
FT                   660188..660348,660404..660749,660797..661256,
FT                   661311..662139)
FT                   /locus_tag="CND02440"
FT                   /product="peptide transporter, putative"
FT   CDS_pept        join(659741..659744,659798..660017,660072..660132,
FT                   660188..660348,660404..660749,660797..661256,
FT                   661311..661957)
FT                   /codon_start=1
FT                   /locus_tag="CND02440"
FT                   /product="peptide transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43163"
FT                   /db_xref="GOA:Q5KIM4"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM4"
FT                   /protein_id="AAW43163.1"
FT                   /translation="MTTHANAIQDFEAAPVPSAAIPSSEDKTSAAGPVTLSYGDKKDSL
FT                   PDVSVGDAGAIDYITEEVEPTDEEFAVLKKVHGKMPWVCIAMCAIELSERASYYGITGV
FT                   VQNFIKNPLPEGGNGAGAVAPGAAGTNQSAGALGRGSVQSSACYNAFVFLANVFPIMGG
FT                   ILADTRWGRFKTVAIGTAVGAFAHILMVVVTIPQVLRTGNGLGPFLVSFYILSFAAGFI
FT                   KPCLATLLCDQSPVKKPVITTTKTGERVILDPQTTVQRYLLIFYWCINVGGFFAIASSY
FT                   SARFVGFWLAYLLPGIVYMLMPIVLVVCYKRLYKAPPQGSVTLEAMKVLYLIIKKGGFV
FT                   KMFKGGEEFWQTAKPSYILAKEGSVDTSKIFWDDLFVDEIRQSIAACGVFALIPIFNLA
FT                   DGGIGSQENDMSTAMTLNNAPNDVISNFNPLTIIVATPIITYGLYPFFDKIGHPIKPMT
FT                   RMAIGFILGMANMIYGAVIQWKIYSISECGWYASTCDTVTSISIWAQIPLYSLPAIGEI
FT                   FVNVTSYELAYTRAPARMKGLVYALCLFNQAISSAIGLACSNAIQDPYLIWPYVALAIA
FT                   CLICAVLCPTYFRHLNDPVRTFADPARQAGKLQELEPLTAARASQNELNEKADEKA"
FT   gene            662603..664410
FT                   /locus_tag="CND02450"
FT   mRNA            join(662603..662730,662788..662993,663043..663432,
FT                   663484..663670,663720..663794,663842..664410)
FT                   /locus_tag="CND02450"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase,
FT                   putative"
FT   CDS_pept        join(662658..662730,662788..662993,663043..663432,
FT                   663484..663670,663720..663794,663842..664350)
FT                   /codon_start=1
FT                   /locus_tag="CND02450"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43137"
FT                   /db_xref="GOA:Q5KIM3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM3"
FT                   /protein_id="AAW43137.1"
FT                   /translation="MLSFAQVAKRSAAVSFRRQAVASRTLRTSAPSNVLSKFAMPAMSP
FT                   TMTEGGVAQWKKKEGESFSAGDVLIEIETDKATIDVEAQDDGIMAKIIAQDGTKNIAVG
FT                   TPIAIIGEEGDDLSQADALAAESQSESAPSQKEAAPKEEKTAPKEEKSESSTTPAVGVP
FT                   GEQKSGAGDAQTSPAKAPEHPSKGDRPKFFASPLARKIALENGIPLAEIKGTGPNGRIV
FT                   EADVKNYKPSAAAASTPAAGKSAAVPADYEDIPTSNMRRTIGKRLTESKQQLPHYYVTV
FT                   EVNMDRVLKLREVFNKAGESKTKLSVNDFIVKAASLALADVPEANSAWLGETIRTYKKA
FT                   DICVAVATPNGLITPIIKDVGAKGLATISAETKALASRARDGKLKPEEYQGGSFTISNL
FT                   GMFGVDEFTAIINPPQSCILAVGKTTTKLELAPEDPKGFKAVQVMKVTLSADHRTVDGA
FT                   VGARWLKAFREYMEQPLTFML"
FT   gene            665222..666371
FT                   /locus_tag="CND02460"
FT   mRNA            join(665222..665857,665914..665996,666059..666371)
FT                   /locus_tag="CND02460"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(665585..665857,665914..665996,666059..666146)
FT                   /codon_start=1
FT                   /locus_tag="CND02460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM2"
FT                   /protein_id="AAW43139.1"
FT                   /translation="MFFTYLAVVFFSSLSLIRGSQAAPAAHKSEILQPKAFINQGTHVY
FT                   PRLEFTTRFSTCIPPDTDVRIKWEGGSGQGVELYYIPQWPGQIEYFPNDIAKTKSPQYV
FT                   WRTPKVGEYPEGTTFIVGINDVVPHIGADWYDLTGLLKFGCSR"
FT   gene            complement(666212..667611)
FT                   /locus_tag="CND02465"
FT   mRNA            complement(join(666212..667029,667085..667183,
FT                   667238..667611))
FT                   /locus_tag="CND02465"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(666308..667029,667085..667183,
FT                   667238..667469))
FT                   /codon_start=1
FT                   /locus_tag="CND02465"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIG8"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIG8"
FT                   /protein_id="ALO60517.1"
FT                   /translation="MRRRSSPLPYLPSEDSHPLIVATNRSRFLFIRIEPEANFRLDCPP
FT                   RRFCFCFRCLAFCLCKMRPFLQILCGTAFLSAAFSLPMVEERSLEKRDYIGLWNGTGPV
FT                   VTDVKQVKILNCWFDACTLAVLISSQYWVENMIRYGNGAPMANVSWPQDGTVQVQVWNP
FT                   DTLEPVIEIATVANKSQTEDHPDGNWWHDALSQATKLLGTQVSFAGILPNGTYDSTAGS
FT                   ATIGLKILTGYDTASNLTSEYADADEFWNDLARANENTPVIFNTVSSADLGITTPQLGD
FT                   SHDYAVFNGTVKHDGSKTIWARNSWGSTDEFKLEDVYSNTFQIIHLKNWDKLEWTSDLW
FT                   SSNFAVPNEG"
FT   gene            complement(667664..669881)
FT                   /locus_tag="CND02470"
FT   mRNA            complement(join(667664..668207,668271..668577,
FT                   668630..668650,668710..668773,668823..668901,
FT                   668955..669096,669149..669227,669276..669381,
FT                   669433..669518,669571..669637,669694..669881))
FT                   /locus_tag="CND02470"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(667712..668207,668271..668577,
FT                   668630..668650,668710..668773,668823..668901,
FT                   668955..669096,669149..669227,669276..669381,
FT                   669433..669518,669571..669637,669694..669803))
FT                   /codon_start=1
FT                   /locus_tag="CND02470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42952"
FT                   /db_xref="GOA:Q5KIM1"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM1"
FT                   /protein_id="AAW42952.2"
FT                   /translation="MPDPAASSSNMYPRGMNPRLRYIKSYWWPYKTFVKQRWIGRQLLE
FT                   VITTEFRDRSMEYYRHALESGVTRVNGVVAQPDLILRNGDRIDNTVHRHEPPVTNDPIL
FT                   VLHIDREREFIVISKPGSLPVHAAGRYFKHTVLEMMESDYGLKCYSVNRLDRLTSGLMI
FT                   LALSGKAASKLAREFVEGKVKKEYVARVKGKFPKEEITVDKPMMTVDRQMGLVIITPEG
FT                   KDAVTIFNRIAYDPVRDQSVVRCRPQTGRTHQIRVHLQYLGHPIANDPLYGVPSVWGPS
FT                   LGKGGVDLTPSTNGISQADALKARAGTSTPQNIDTNREYDNIDLNSPIRLSNQAREIIA
FT                   KLRRQKDDAEDWIRWSEVIFSAKKAQEDLESESKSSTPQVVPRLAGRQEALKLPDPLPD
FT                   DTPSPLKPPVYLPPGFCTECYVPVPDDPDPETLFIYLHALRYTTEQLGTWETPMPRWAS
FT                   ADWDGDWRGWEEGAILPNALEEDRRKMEAKAAKKADSDLSSNLEEKALTPVALAEGSVQ
FT                   D"
FT   gene            669995..671276
FT                   /locus_tag="CND02475"
FT   mRNA            join(669995..670092,670146..670177,670226..670489,
FT                   670542..671276)
FT                   /locus_tag="CND02475"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(670001..670092,670146..670177,670226..670489,
FT                   670542..670951)
FT                   /codon_start=1
FT                   /locus_tag="CND02475"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIH0"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR040197"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIH0"
FT                   /protein_id="ALO60518.1"
FT                   /translation="MPKNAAQNEKTCAVCSQHPPKYRCSSCLLRYCSVSCYKTHKTQCN
FT                   ATAQQPSTVHPTEPLGSEIGILSQAAEGAAPEHGLNREGHSTNNASLRPLTSLNWPPEP
FT                   DPGLFTDPLLKDDPKPLRHEELLRIAQSTSLRALLVDQTLISILQLLDTLPPPARHSAL
FT                   SKLLGFDPQSLSNTSNTLINGRDSPPPLDELLGALARGVGDTAEEAVQDGGWWLNGPKN
FT                   KVWITEREKKLMRLFAGSVCLAIDGKIEDGDLVWGQGELAWDV"
FT   gene            complement(671030..675944)
FT                   /locus_tag="CND02480"
FT   mRNA            complement(join(671030..673237,673296..673828,
FT                   673882..674629,675425..675944))
FT                   /locus_tag="CND02480"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(671030..673237,673296..673828,
FT                   673882..674629,674719..675944))
FT                   /locus_tag="CND02480"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(671411..673237,673296..673828,
FT                   673882..674629,675425..675463))
FT                   /codon_start=1
FT                   /locus_tag="CND02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42950"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIM0"
FT                   /protein_id="AAW42950.2"
FT                   /translation="MAVYTDQLQPWEENQSPSPTEVAENPYELALAPLRTSSLQVRSPG
FT                   PPSPVNTLHSRLSGDPDSPPPAWKRRSSINRRPSISSEHQRQLSASSTNNSLKSAGDHT
FT                   GTQNTSPRAARSPAESVHSAQSTSPTSSRTAPPSRRHPNLAMTIAATRPPATTLSSVVS
FT                   HESSEGSSLSLGDDLALPNPAFRRRVAEGANSARSSTVSSQDLNSLTSEELWTLGQEEV
FT                   PDMSNPMRTAAERPLDTVRRLSTIADTDPVYHTGLPSEVIWPPGPPPEELLYRPVRNKS
FT                   FTSIQNSTKRLSIRRSSRRTSAADISTSTLTKGKIKPGAQSLPVSPVAPHKINMLSSAH
FT                   SSSTSLSSHQAITPNKSYPALGHSKSGPPASFYSKDFINSLAPREGGYAVAATIGGVAS
FT                   PAGSISNDKRRTSYVDSSISRTRAPLARSAGMGRWSLDGGENYGRPYLTSSAATTSSNL
FT                   TAPPLTSNQADVHLSEPRGKAHSQVPDGALPPAINLHGAATQSSLVSGAMQRSSPNPSP
FT                   LSQQTHAQDVMSTAAGDTAEDSKVNGNTPVQYPIENAANAINKPSTFEMSIPAGPLATE
FT                   SATPPLTNKKSKKQLAKDAKAQRKAEAQAAARARAEQMRQELARKQQQREEEQRKKIEI
FT                   KRKEKEEKVKRKAEKKEKKNGFLRKPASSALRKAETEPAVASSRAEAQRDEVDASTTTS
FT                   KPAPAITSSSTTSFPVMRSMLNVNKLSTARPEASESGQSSPSSTPAGQSPPSFRTGEEQ
FT                   GDNSKKPEVKLKRSFFGTIKKRFSYSAGDKEGVSPMPSQRERRFTAVADRHEAGKTGYE
FT                   KQEADGSLKLRPEKDGLIAPPPRQTSLMAVASDSSIHRRTDTVSEETSEVIAGESPRTV
FT                   RPNSTLMSSPSSSPSSGRHQIPRKPISTEGTLGNKILDQSSFSEAPDPFPIEHNASPLE
FT                   HIHGDDQISRVIPFSTATAANSGTHLEFSSPAPMPVTPSTSGDSQLSYMHSHASHNSNV
FT                   TPVTSVSESEALSDENLRMGKESRDSQLLGGQIPPQREGSDETVLAIKVDPTSSPIIAV
FT                   "
FT   CDS_pept        complement(join(671411..673237,673296..673828,
FT                   673882..674233))
FT                   /codon_start=1
FT                   /locus_tag="CND02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII1"
FT                   /protein_id="ALO60519.1"
FT                   /translation="MTIAATRPPATTLSSVVSHESSEGSSLSLGDDLALPNPAFRRRVA
FT                   EGANSARSSTVSSQDLNSLTSEELWTLGQEEVPDMSNPMRTAAERPLDTVRRLSTIADT
FT                   DPVYHTGLPSEVIWPPGPPPEELLYRPVRNKSFTSIQNSTKRLSIRRSSRRTSAADIST
FT                   STLTKGKIKPGAQSLPVSPVAPHKINMLSSAHSSSTSLSSHQAITPNKSYPALGHSKSG
FT                   PPASFYSKDFINSLAPREGGYAVAATIGGVASPAGSISNDKRRTSYVDSSISRTRAPLA
FT                   RSAGMGRWSLDGGENYGRPYLTSSAATTSSNLTAPPLTSNQADVHLSEPRGKAHSQVPD
FT                   GALPPAINLHGAATQSSLVSGAMQRSSPNPSPLSQQTHAQDVMSTAAGDTAEDSKVNGN
FT                   TPVQYPIENAANAINKPSTFEMSIPAGPLATESATPPLTNKKSKKQLAKDAKAQRKAEA
FT                   QAAARARAEQMRQELARKQQQREEEQRKKIEIKRKEKEEKVKRKAEKKEKKNGFLRKPA
FT                   SSALRKAETEPAVASSRAEAQRDEVDASTTTSKPAPAITSSSTTSFPVMRSMLNVNKLS
FT                   TARPEASESGQSSPSSTPAGQSPPSFRTGEEQGDNSKKPEVKLKRSFFGTIKKRFSYSA
FT                   GDKEGVSPMPSQRERRFTAVADRHEAGKTGYEKQEADGSLKLRPEKDGLIAPPPRQTSL
FT                   MAVASDSSIHRRTDTVSEETSEVIAGESPRTVRPNSTLMSSPSSSPSSGRHQIPRKPIS
FT                   TEGTLGNKILDQSSFSEAPDPFPIEHNASPLEHIHGDDQISRVIPFSTATAANSGTHLE
FT                   FSSPAPMPVTPSTSGDSQLSYMHSHASHNSNVTPVTSVSESEALSDENLRMGKESRDSQ
FT                   LLGGQIPPQREGSDETVLAIKVDPTSSPIIAV"
FT   gene            676686..683468
FT                   /locus_tag="CND02490"
FT   mRNA            join(676686..678033,678085..678420,678468..678741,
FT                   678790..680615,680664..680802,680855..681043,
FT                   681107..681280,681334..681773,681827..682107,
FT                   682158..682358,682430..682729,682787..682928,
FT                   682984..683110,683171..683468)
FT                   /locus_tag="CND02490"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(676733..678033,678085..678420,678468..678741,
FT                   678790..680615,680664..680802,680855..681043,
FT                   681107..681280,681334..681773,681827..682107,
FT                   682158..682358,682430..682729,682787..682928,
FT                   682984..683110,683171..683308)
FT                   /codon_start=1
FT                   /locus_tag="CND02490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42948"
FT                   /db_xref="GOA:Q5KIL9"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR023394"
FT                   /db_xref="InterPro:IPR032629"
FT                   /db_xref="InterPro:IPR032691"
FT                   /db_xref="InterPro:IPR035999"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL9"
FT                   /protein_id="AAW42948.2"
FT                   /translation="MGSHSDTEGSTDATQQHSSPTPNPEPTIEGPPDNPQPDSAESELV
FT                   GLGIQSGSAIKELPPYPEKDDSHNSEVMHEPPLNPEDISVSPPLPPPKPERAVPTRTDS
FT                   KETLEDVELSRENTPSVARGGDMAFKGSVNVSHSHTSLPSIVAPSLPPTPSRQQAYARP
FT                   PSTIQGHRSRRSSTATTLSLSNFGPNSPGPQLSTVLITPPLQLLVSSKEAKKSPSFHAA
FT                   AQRALDLCQSSEGANAAYLHPREIFEPLRLAISNPQTTSVPILVTSLDLLSKLISHSFF
FT                   AEPHGPPPGLPPLPDLITHTITLSYSESSPPQVALQVVKALMAIVLSTDKGMLVHQSSL
FT                   LKAVRTVYNVFLLSNDAANQVVAQGGLTQMVHHVFGRVIRPDIKNATPESGRGSVSENE
FT                   ARRRSGVMQESTTAGSLPSTPAPERHDSVNGKMTLESFAAENPNDSIPVDRAPITDSVN
FT                   HDAAAEADIEVEAPRLPQHTVSIPVPASVADSNGAPSNQQAGQGIDEEGGSFDAMGRPI
FT                   PTEQLFVKDAFLVFRALCKLTMKPLVTDSEKDLRSHAMRSKLLSLHLVLTILRSHSDIF
FT                   VNPLVCIPSNSSLEMTPFLQATKQYLALSLSRNALSPVNQVFELSVEIFWCMLKDMRAQ
FT                   LKKEIEVLLNEIFIPILEMRHSTIRQKSIILGVFIRLCHDPQALVEIYINYDCDRSSLE
FT                   NIYERLMNIVSKIGQTHFAPPSKEELAQGGSSKQTSGSSGPAIPPSLSTSALGEGVGHN
FT                   APHYAGMPPEIKLRRQSLECLVAALNSLVAWSTSNPGTKAGNLEENHSTTDAVGRHHAS
FT                   GSVSGSIAELVAPTPIWPTDSSLKSSVSGMASGMNTPDLGEDDVGKFESAKQRKTNLLE
FT                   GIKKFNFKPKRGIAYLLEQGFIRSNSPVDIARFLLTNEGLNKAMIGEYLGEGDDENIAT
FT                   MHAFVDMLDFSNMQFTDALRMYLQSFRLPGEAQKIDRFMLKFAERYMHSNPSSHFANAD
FT                   TAYILAFSVIMLNTDAHNKNLKQKRMTKQEFVKNNRGINDGKDLPEELLAGIYDEITTN
FT                   EIKMKDEVEIPQPATSGGLASVGRDLQREAYVAQSENMASKTESLLKAMVRQQRRGVVR
FT                   PTDHYHTASRLEHVRFMFEVAWMPFLAGISAPLQETDDMDVVDLCLEGLRSAIRIVCLF
FT                   DMELERNAFVTTLAKFTYLSNVAEMKPKNMEAIKSLLDVAVTDGNYLKASWKDVLVCVS
FT                   QLERMQLISSGMDVPDLNRTVTTSTDKRKPSSSKKKVPTEEVAEESRSSQVTVAADMVF
FT                   STSKNLSGSAIVDFVKALSEVSWEEIQSSGSSARPRMFSLQKLVEISYYNMGRIRLEWS
FT                   NIWLILGEHFNQVCCHNNPNVSFFALDALRQLAMNFLEKEELSHFRFQKDFLRPFEYTI
FT                   VHNKNSDAREMVLQCLQHMLQSRVQNLRSGWRTMFGVFSAASKVVTERVCSYAFELVTL
FT                   VYRDYFSLVVKYGSFSDLTVCITDFCKVSKFQKISLQAIEMVRGLVPTMLQCPECLLPQ
FT                   LGDEGKVQHGDDPMVKYWLPVLHSFYEIIMTGEDLEVRRLALDCLFDTLKTHGSGFSVD
FT                   FWNIVCQQVLFPIFSILRAKSDIRFKSPEVLSIWLSTTLISALRDLINLYTVYFEVMQR
FT                   YLDGLLDILVACICQENDTLARIGTSCFEQLLEQNVRKLSPEKWMLIVSAFVQLFKTTT
FT                   AYQLFDPVMCSEIEPTGNMDENDAPFQKFVAPAPLEPATDKPPSLPSTISYGEQRRIFK
FT                   QVIVKCVLQLLLIETTHELLQNGEVYNTIPAEHLLRLLDVLDDSWSFARKFNADKELRM
FT                   QLWKVGFMKQLPNLLKQESSAAATLVNVLLKMYNDPREAHRATRKDVVKRLVPLAKEII
FT                   GDFNLLDAESQPRNVAAWTPVIGDILQGCCILEIDSFEQHITTFYPLVTDILVKDVSLD
FT                   IRIKATNYLRRVGEVRGLIEKQ"
FT   gene            683481..686510
FT                   /locus_tag="CND02500"
FT   mRNA            join(683481..683830,683895..684084,684236..684528,
FT                   684589..684722,684783..684957,685018..685057,
FT                   685117..685208,685275..685401,685473..685844,
FT                   685899..685971,686050..686089,686158..686510)
FT                   /locus_tag="CND02500"
FT                   /product="expressed protein"
FT   CDS_pept        join(684053..684084,684236..684528,684589..684722,
FT                   684783..684957,685018..685057,685117..685208,
FT                   685275..685401,685473..685844,685899..685971,
FT                   686050..686089,686158..686222)
FT                   /codon_start=1
FT                   /locus_tag="CND02500"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42946"
FT                   /db_xref="GOA:Q5KIL8"
FT                   /db_xref="InterPro:IPR019026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL8"
FT                   /protein_id="AAW42946.2"
FT                   /translation="MAPLERQKAYACFGVGLSLFATLALSSPFHQKPLSYDSVESIKGC
FT                   FSPSDLSSSSPNDNPPYVPHINYAAFDKDDDGSTPPPDYMTLYPLHVFGSREERVNLMF
FT                   FSDGYTVGEEEKFVKDASKLKDDIVSHGGAMSHVAHLLNVWATFVPSNGSGIGSHDRPL
FT                   EGASFGLYRPGAELRAVFVNNPRRARAACRWFRENKAKQGGCDQPILLGNDPLYGGLGG
FT                   EFTVITASELNGPLVLRHELGHSIMDVGEEYDGGYAYFGVNSDRYKRRDALKWREFLTN
FT                   PESSRIEDVRVPLQVYPWHDLDISSWEISFNSSNLISPQNGVSCYPTALLRASLSSIPY
FT                   SSHVVLVLNGCTLDLADGFPKAWEGSSDRRWLEVPLTLETGLQPGCNTIKVALTDEGRR
FT                   ARAGQGGKMIASLEIIEYGGDGRFNHTEGFIGAFPTYAMDGRVRLRPTNEGCLMRKIDH
FT                   PTFCPVCAHYLGNRLENIIKNH"
FT   gene            686584..688062
FT                   /locus_tag="CND02510"
FT   mRNA            join(686584..686723,686805..687006,687114..687226,
FT                   687284..687370,687422..687462,687528..687669,
FT                   687728..687832,687907..688062)
FT                   /locus_tag="CND02510"
FT                   /product="hydroxyacylglutathione hydrolase, putative"
FT   CDS_pept        join(686659..686723,686805..687006,687114..687226,
FT                   687284..687370,687422..687462,687528..687669,
FT                   687728..687832,687907..687976)
FT                   /codon_start=1
FT                   /locus_tag="CND02510"
FT                   /product="hydroxyacylglutathione hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43141"
FT                   /db_xref="GOA:Q5KIL7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL7"
FT                   /protein_id="AAW43141.1"
FT                   /translation="MLTPSARISAPRFSRQLSTSLISKMKVLPYKARSDNWMYLIIDSS
FT                   NEAAVVDPYDANKISGAVKEQRANVTSLITTHHHADHSGGNSKFLSLHPNLKVYAGSTQ
FT                   SPGTNTVVKDGDTFTLGQDITVKCLHTPCHTQDSICFFLEDKKTGQRGVFTGDTLFLAG
FT                   CGRFFEGTPEEMHAALTKLSNLPEDTIVYNGHEYTKGSAKFGLTIEPDNQHLKELLKKA
FT                   ENDSCTTGKSTIGDEKNWNVFMRLDTPQAKQATGKTEAVEIMGRLREMKNAM"
FT   gene            688226..691258
FT                   /locus_tag="CND02520"
FT   mRNA            join(688226..688444,688502..688613,688664..688793,
FT                   688847..688968,689019..689155,689210..689231,
FT                   689278..689351,689407..690205,690270..690300,
FT                   690358..690432,690483..690554,690608..690758,
FT                   690807..691020,691072..691258)
FT                   /locus_tag="CND02520"
FT                   /product="lanosterol synthase, putative"
FT   CDS_pept        join(688229..688444,688502..688613,688664..688793,
FT                   688847..688968,689019..689155,689210..689231,
FT                   689278..689351,689407..690205,690270..690300,
FT                   690358..690432,690483..690554,690608..690758,
FT                   690807..691020,691072..691133)
FT                   /codon_start=1
FT                   /locus_tag="CND02520"
FT                   /product="lanosterol synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43143"
FT                   /db_xref="GOA:Q5KIL6"
FT                   /db_xref="InterPro:IPR002365"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR018333"
FT                   /db_xref="InterPro:IPR032696"
FT                   /db_xref="InterPro:IPR032697"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL6"
FT                   /protein_id="AAW43143.1"
FT                   /translation="MPTITNTFISFPPFTDTFMAQYTPPATDLTAWRLKVSEDSHGQQK
FT                   WVYLSDPAQRKEWPQMNIEKYWLGLDVEVPELEEPKTPLDAARNGYRFYKELQSEDGHF
FT                   STEYGGPLFLIPGLIIALYVTGQSLRHEQAIEMRRYLFNKRRKEGGWGLHTAAPPTVYG
FT                   TVMNYVALRMLGMGPDEGPMTEIRSLIHKMGGATGIPTWGKVWLSILGAYEWDGVGSVP
FT                   PELWLLPDWAPFAPWRWWIHVRQVFTPMSFLYGTRFVGPFTPLVFSLRQELYVEPYETI
FT                   NWPSQRSNISSYDIYSPHHPILDMAHQLLAVYEKLPHVPILSSRLPLRKVALDKVYRMI
FT                   TYEDENTTYQTVGPVSKAFHIVCRFAREGPNSEAFKSHLSRIDDFLWLSKSGLMMMGTN
FT                   GSQMWDTGFMAQAAVETGLAEESEFKESVKGMLDWLDKAQMRENPKWYKEGYRHRTKGA
FT                   WPFSTPEQSYTVSDCTAEGLKAVLALQHLDYTPKPVGLDRMRDAVDTLLSMQNKSGGFA
FT                   SYELTRGSTKLEWLNAAEVFGDIMIDYTYPECTTSVLSALKYFSKVDTEYRAADIELTI
FT                   RRAIQYIHDIQRPDGSWYGSWGICFTYATMFALESLGIAGETCANSDKVRRACDFLVGH
FT                   QMEDGGWGETYMSCVTGKYAQHDQSQVVQTAWAILALIYGQYRDKTVIERAAKLIMSRQ
FT                   LKDGRWEQEDTEGIFNKNCAIDYPAFKFVFCIWALGRADKYLRS"
FT   gene            691473..694666
FT                   /locus_tag="CND02530"
FT   mRNA            join(691473..691913,692000..693103,693153..693853,
FT                   693923..694666)
FT                   /locus_tag="CND02530"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(691661..691913,692000..693103,693153..693853,
FT                   693923..694114)
FT                   /codon_start=1
FT                   /locus_tag="CND02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42944"
FT                   /db_xref="GOA:Q5KIL5"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR040366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL5"
FT                   /protein_id="AAW42944.1"
FT                   /translation="MAVESVPVQPQAVSPTEMHIEKDALKSASAAVEEKKEDEVEALQE
FT                   QVEAVNLGNVDDLHAACVEGKLQDVRALLSKGTDRLETLDVNSGCTPIVLAIRGNHHDI
FT                   VRELLAAGAIIPPPGLTNDPLMLSILYPQPVYGMPPQFMSIPPQDFYPQPNYFPSQNGE
FT                   TQRFPLRKDSASAPNGAPNGNGSASNLPPAEVSKSIPCRNFPNCKYGNACVFLHPRPAH
FT                   FYPGPGQNGFAPQGFEGYPPYPPAPAPYFMPNGNNFQSFAPSDAQPQVSDSAEAGAQVD
FT                   SASIAAVPAPTGAAPAPIPAPPHIPSAVAPVFVPGYQPADMMGSPPPPPFGLSPMSPSM
FT                   LGSSLPSIPPAEVFFATSPTNGFMPPPPMTGPHARRQSFGQGPQFGGQGKPFGHGKKPS
FT                   FSGGKPWTGNRPAGGKFGNWKDGNPPPCAFFSQGNCRNGEFCKFPHLDPDGNDCRHPDV
FT                   VRGVIPPLPPLSRQNRNMRAVGPGFAPFDPAFRQQQYQQQMQFLQHQRMAAAQAQQSQA
FT                   PAEPNDEVKPIVEDEAPATDAEKQATDSVPAAATSPAVTVLPAKPAVTMPTLLRSASQP
FT                   GVQRVHANGVPSRSHSPAPSNVSFHGNGHPRRAGRVPNVNGARSSSSGPEKKPAQRVPK
FT                   PDEFPVLGTPTSEKKEPVWGMSGKTAAQVLQAPAPVKPVVKVSQPIEEDAQSVTMESES
FT                   DSDTVLVSRKPSASATPATTASPDPEPKKAAISFASIAGAVAAPSVETAPVAVKA"
FT   gene            695693..697157
FT                   /locus_tag="CND02540"
FT   mRNA            join(695693..696506,696565..696753,696811..697157)
FT                   /locus_tag="CND02540"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(696580..696753,696811..696834)
FT                   /codon_start=1
FT                   /locus_tag="CND02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43145"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL4"
FT                   /protein_id="AAW43145.1"
FT                   /translation="MCFAQNTFISSPVNHHSHSQSCSAPMCSYTDGNYPDDHVCECGSC
FT                   KCLVVTKNKLCVNCKKGNHA"
FT   gene            complement(697005..698386)
FT                   /locus_tag="CND02550"
FT   mRNA            complement(join(697005..697353,697410..697786,
FT                   697840..697899,697953..698386))
FT                   /locus_tag="CND02550"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(697192..697353,697410..697786,
FT                   697840..697899,697953..698313))
FT                   /codon_start=1
FT                   /locus_tag="CND02550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43170"
FT                   /db_xref="GOA:Q5KIL3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034228"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL3"
FT                   /protein_id="AAW43170.1"
FT                   /translation="MSETLTKKQQKAAAFRSKQKAKKAGVEAPPDLPEEDVVEDAEAAE
FT                   EEQVLDQATKKRKRNVEDENAENVVTVEESEVSIKPKDHEKKKRKTAWDEEGDGESEGK
FT                   KGKGKKDAKQRFILFVGNLSFKTTKEEIQKHFEPAAGQLPSVRLLTTKATPTQAAKSRG
FT                   IAFLELPSSTVLQACLKLHHSELKGRTINVELTAGGGGSSEDRKKKIQERNQRVGGQRE
FT                   RRAEREKETGGGEENDAFEGQPSGQKGDDEKKAKMRGGRRVKAKTSNAVAPVPSTARHQ
FT                   SSNSFAPSRPPTKEYSGGKFQKKRWEPTGANSISVGQK"
FT   gene            698594..700883
FT                   /locus_tag="CND02560"
FT   mRNA            join(698594..699299,699364..699475,699531..700883)
FT                   /locus_tag="CND02560"
FT                   /product="expressed protein"
FT   CDS_pept        join(699015..699299,699364..699475,699531..700789)
FT                   /codon_start=1
FT                   /locus_tag="CND02560"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43147"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL2"
FT                   /protein_id="AAW43147.1"
FT                   /translation="MRRPRESLDLLQDDETFSQSLGFRWWVNLHCIDAHHDMIFYHDIT
FT                   YSESSAWPKREQKGPSKVILDDPSLHVQGSVVYVWEGQFKGYHVSTEDLFIQVEERAKK
FT                   QYFSQEECFASGLLGTFDQIEQFKMANPYSHDHYYPSSMASIDDDRASPVFPDLTQHTT
FT                   LGQNIGTALKSAHKIHFSSALPEMRITSPGPIKPNKAIDTEPGESDSDSPSHKNMNLPG
FT                   NYRRSPIGPQRLFSHNSTHYSNNRISLEAKLDAREANLLKREAFVKRREVEIVKREHEF
FT                   EQRLYSAEEASRKRDAKLSDREAILRACEERLGRKWDKLCDNEVEVFELKQNARERFQL
FT                   LEEVEEINGFLRAKLEPVCQCIRTPHSPAWGTGNVIRPQVQLRYPVWVTVIGKDRKDKA
FT                   VRVLSITGIPTEANVARTAATEFKNWALPFGHIYRIRLNNNCSEKLSKWASTEAKLIDR
FT                   YGFEMFFQRVGENTFVRFGPMLDIIFEPVSPNVDISTPVPIPFASASTGSIPGNGQTSK
FT                   IKKEKVKITPKFPPAIAGLARNQQKPVPEVSPME"
FT   gene            complement(700879..702164)
FT                   /locus_tag="CND02570"
FT   mRNA            complement(join(700879..701111,701179..701333,
FT                   701390..701565,701617..701697,701754..701767,
FT                   701823..702164))
FT                   /locus_tag="CND02570"
FT                   /product="mitochondrion protein, putative"
FT   CDS_pept        complement(join(700952..701111,701179..701333,
FT                   701390..701565,701617..701697,701754..701767,
FT                   701823..702085))
FT                   /codon_start=1
FT                   /locus_tag="CND02570"
FT                   /product="mitochondrion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43168"
FT                   /db_xref="GOA:Q5KIL1"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL1"
FT                   /protein_id="AAW43168.1"
FT                   /translation="MSASYSPQKNPQHQQLSSEPPHASSSAWSGNLGEDPVFIGIVSAV
FT                   GASAFTLLGVMGYRRYWRRIKNADYVTSELLRRKTWVKGIVTSVGDGDNLRLYHTPGPF
FT                   FQYPLKIRSVPTTQKGLRNETISIRIAGVDAPENAHFGNPAQPHARESLEWLRATILGK
FT                   RMRCQLLAKDQYNRIVAVPYISRRFWWDRPLPLMMLREGMAVVYKAGGADYGPWGLDEM
FT                   LKVEAEARNAKRGLWALKKFESPGDFKARMKLKSDVSEERPEGKLPSGWIALVKRLMGR
FT                   T"
FT   gene            702257..706110
FT                   /locus_tag="CND02580"
FT   mRNA            join(702257..702389,702447..702484,702538..702621,
FT                   702681..702775,702830..703085,703146..706110)
FT                   /locus_tag="CND02580"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(702279..702389,702447..702484,702538..702621,
FT                   702681..702775,702830..703085,703146..705927)
FT                   /codon_start=1
FT                   /locus_tag="CND02580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43149"
FT                   /db_xref="InterPro:IPR019384"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIL0"
FT                   /protein_id="AAW43149.1"
FT                   /translation="MDVSSFFTRLLQVPKHPPSTARPDHLEDFDSAWQSIKETLEHPDE
FT                   RQLVRGISSTEVPVHLRHIVDALVYESNRTDEDTTGVCLEYFLKNDILAHLERLCEADR
FT                   PHGIKAEVVKSINNLVVLLSERFLVHNAVHRPLRRLLRSCIGDEPEEKLDGTRVFGAAG
FT                   MANGMERGASNEDIEGDLVDLMCVLCSKMRAYPPLLLIFFHDRGWAQSNNNVSQVDSNS
FT                   NRARSPTPTTHTTLSELPTKTSSRATHQFEFLLFSYLLRFVHREGRLGDFARAGLIFLF
FT                   DIAFLTPGEEGGENLSSGPGNNGPDPLQEARDALGEFILDGDFADVMAAALGAVYSLLP
FT                   TKLQVPSISSQEVPEEDNKNISSGGMHLGSGMKRQDGEDNIQLSTDLHVRTQLDLLLKL
FT                   FGFLQDIIRRCNSPILYADPHSGAVTVTHVLGGAIAGATLDAIHSSFLDNVLYPSLLEC
FT                   SSHDGSSVAVLTYLDVLFSNLDDGPIVDRVLSFLLDIDLSDTCMPLPAVNSKRERQETG
FT                   AMRYVGRIPLKSTEYFASEGRFTLKDLILDNLCSGQWNSVTAALCLLQTLLSNHPHQAT
FT                   RGLLSYIHEPAATALVRNPIPRSLNLQSPDASFLPKPVNFSDAREVELYGSLLSLLDPL
FT                   QTSIEMSPGYVGYLADMQTALESNPSFRLAPILPFVDEEDVGETTFNKASVNGGGGGGR
FT                   LDGDDPIPHKLSPADPLLRAVLGEFEKFLCKTADENVAMTGVLTAMASCPYRALGGWLL
FT                   YEKEASVGHMSLGGDESDSDASSDVSFSRHVSDGDRDPFVGRGSSVDLPVIYQILRSLV
FT                   KQISLLRRQVPQFDRLLSERRQGLLFADHLDEAMSIMLDVDRAGSTVFSSPSAKSGGNE
FT                   ASSLLTTRRKGGGGRSSALGLASSIKSFLTPKKKTGAPGTPGTGTGTPGTPELGSHPRL
FT                   GLFAGFSPSPLPPSTPPVFAAGPASGTSSPSSSLMSSAEPAPAPFKTHYDQTRQSVSLC
FT                   LCDEREREREDADADAEDERGMIVTGVWGGKVKTTTTTTTTPVWSGRHGKRRPDLIHLS
FT                   SVPGKSGGAGGDGDVSFSMDPDEIDQLVKEEEDKQVSLSTVLDNCVILEEFLKETVALI
FT                   VARRMLGVDQVGFI"
FT   gene            complement(705942..707758)
FT                   /locus_tag="CND02590"
FT   mRNA            complement(join(705942..706122,706172..706447,
FT                   706510..706626,706690..706821,706870..706966,
FT                   707010..707187,707226..707677,707731..707758))
FT                   /locus_tag="CND02590"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(706108..706122,706172..706447,
FT                   706510..706626,706690..706821,706870..706966,
FT                   707010..707187,707226..707667))
FT                   /codon_start=1
FT                   /locus_tag="CND02590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43166"
FT                   /db_xref="GOA:P0CS42"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017252"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037190"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS42"
FT                   /protein_id="AAW43166.1"
FT                   /translation="MLAYLHAAGMHNAYAALQHDAALADVDPRDRAVGLLEKKWTSVIR
FT                   LQKKVIDLENRNAALLAELAAAARPAAPGPFLPRPPPRHTLASHRAPVTRLAFHPTWTL
FT                   LASASEDATVKLWDWEAGDMERTLKGHTKAVMDVDFDPRGGLMATCSSDLTLKLWDTAN
FT                   QYTNVKTLHGHDHSVSSVRFMPDGETLVSASRDKTIRVWQVSSGYCIKTFSGHAEWVRE
FT                   AVPSEDGRWLVSASNDQTSRIWDFSTGETKMELRGHEHVVECAVFAPVNAYPAIRELAG
FT                   LKPPAPRDTRAKSPGVYAATGSRDKTIKLWDALSGQCLRTLVGHDNWIRALVFHPSGKY
FT                   LLSASDDKTIKVWDLANGRCTKTIEAHSHFVTSMTWGRAVGASGGIEKVNGDASSKEPR
FT                   RINVLATGSVDQTIKVWTP"
FT   gene            707974..709167
FT                   /locus_tag="CND02600"
FT   mRNA            join(707974..708144,708186..708587,708632..708709,
FT                   708768..708783,708832..708870,708920..708938,
FT                   709009..709167)
FT                   /locus_tag="CND02600"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(708036..708144,708186..708587,708632..708709,
FT                   708768..708783,708832..708870,708920..708938,
FT                   709009..709086)
FT                   /codon_start=1
FT                   /locus_tag="CND02600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42942"
FT                   /db_xref="GOA:Q5KIK8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK8"
FT                   /protein_id="AAW42942.2"
FT                   /translation="MWTELAHIVRHASADPAIRVLVLSSTSDAAFTAGLDLNSQSLLAA
FT                   PAADPARKALALHAHLRAFQAAVSSLSACRQPVICALHGFALGLAIDIAAACDIRLCAS
FT                   DTQFGVSEVNVGLAADIGSLQRLPKVTGNDSKVRELALTGRAFGPREAEQMGFVSEVVD
FT                   GGRAQVVAVAIEKAKVIASRSPIAVISTKHVLNHARDHTVEQGLQYVAAWNMSMLQSSD
FT                   TAKAMSATRNKESVTFPGFSDAKL"
FT   gene            complement(709118..710367)
FT                   /locus_tag="CND02610"
FT   mRNA            complement(join(709118..709547,709602..709773,
FT                   709835..710367))
FT                   /locus_tag="CND02610"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(709170..709547,709602..709773,
FT                   709835..710289))
FT                   /codon_start=1
FT                   /locus_tag="CND02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42940"
FT                   /db_xref="GOA:Q5KIK7"
FT                   /db_xref="InterPro:IPR016939"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK7"
FT                   /protein_id="AAW42940.2"
FT                   /translation="MRRIPSQVPSAVSRLLQGQVISSPPTWYNPALAHPPPQLPPYQVK
FT                   SRPRVSAKLPGGGSGDGGGQFIDTAPIPAGELERRDRLRGYKQRKGRPLKIAYEEDWVR
FT                   RQFFKDFPFEALRPVSMVEGVEIDVREKVGGEEWTSLEQRGLYPTVEDCIEFVINVRNT
FT                   RNVSISEAYALATEEFVSLRGRHQLATLAAEIEARHYGAEFKPDVFERAFNLEEKALES
FT                   LRPFTASSSSSSGSSRVKYREQPRWQWSNTVPPSSIPGAGAGGFSRGQNYVAKWKMPEP
FT                   LRVGAQGQGDLLAAIPAAGEMPPAEGAEGVAEEDAKLEDLEMLKAALGSSKSA"
FT   gene            complement(710447..713728)
FT                   /locus_tag="CND02620"
FT   mRNA            complement(join(710447..710753,710804..711271,
FT                   711328..711768,711822..712487,712540..712757,
FT                   712813..713048,713108..713216,713474..713728))
FT                   /locus_tag="CND02620"
FT                   /product="aconitase, putative"
FT   CDS_pept        complement(join(710701..710753,710804..711271,
FT                   711328..711768,711822..712487,712540..712757,
FT                   712813..713048,713108..713216,713474..713661))
FT                   /codon_start=1
FT                   /locus_tag="CND02620"
FT                   /product="aconitase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42938"
FT                   /db_xref="GOA:Q5KIK6"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK6"
FT                   /protein_id="AAW42938.1"
FT                   /translation="MVSSRYLVRGANSLSRQSMVAKRSMATVQSSIGDKKVEMSNLEKG
FT                   KFINYQRIENNLQVVRSRLNRPLTLAEKVVYGHLDNPHEQDIERGVSYLKLRPDRVACQ
FT                   DATAQMAILQFMSAGLPQTAVPTSVHCDHLIQAQIGGKADLARAIDINKEVYDFLATAC
FT                   AKYGIGFWKPGSGIIHQIILENYAVPGLMMIGTDSHTPNAGGLGMVACGVGGADAVDVM
FT                   ADIPWELKAPKVIGVYLDGQMSGWTTPKDVILKVAGILTVKGGTGAIIEYHGPGVESLS
FT                   CTGMATICNMGAEIGATTSLFPFNHRMGSYLKATNRSAIAQYAEEFNHNLQPDEGCEYD
FT                   QRIEINLSELEPHINGPFTPDLATPLSKFAEEVKRHSWPQELKVGLIGSCTNSSYEDMS
FT                   RSAHIAREAASHGLTAKSQFTITPGSEQVRATIARDGMVDDFEKVGGLVLANACGPCIG
FT                   QWDRRDVKKGEANSIITSYNRNFTGRNDANPATHAFVASPDLVTAMIFAGDLTFNPMTD
FT                   SLKGADGKEFRFSDPSGFELPAKGYDPGENTFQAPPADGTTVSVAVSPTSDRLQLLKPF
FT                   KPWDGKDIIEARVLIKAKGKCTTDHISAGGPWLKYRGHLENISQNCLIGAINSDNGEAN
FT                   KILNQETGEFGPVPTVAAYYRDRDIPWVVVGDENYGEGSSREHAALEPRFLGGRAVICR
FT                   SFARIHETNLKKQGMLPLWFKNPADYDKISGTDKISILDLQNFKPGQDIKVEITHKDGS
FT                   KEQILTTSSINEGQWGWFKAGSALNMMASAAKARAEKQA"
FT   gene            complement(714655..716523)
FT                   /locus_tag="CND02630"
FT   mRNA            complement(join(714655..714935,714990..715073,
FT                   715142..715195,715252..715351,715402..715463,
FT                   715518..715747,715798..715937,716001..716253,
FT                   716307..716523))
FT                   /locus_tag="CND02630"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(714845..714935,714990..715073,
FT                   715142..715195,715252..715351,715402..715463,
FT                   715518..715747,715798..715937,716001..716253,
FT                   716307..716426))
FT                   /codon_start=1
FT                   /locus_tag="CND02630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42936"
FT                   /db_xref="GOA:P0CP54"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP54"
FT                   /protein_id="AAW42936.1"
FT                   /translation="MSFRAPNLIRSAAGRRASQTLNLRSQVIRRRFATEGGPEITKPSS
FT                   PRSSNTRYLLAGVGIAAVGAAYYFYGTGRTAHDSANKADTVVRGAVATVEAKTGLRRGK
FT                   DEYQKVYNRIAETLEKEGYDDGSLAPVLLRLAWHSSGTYNKEDGTGGSNFATMRFKPEA
FT                   EHSANNGLHVAREHMEKIKQEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRIDGFEA
FT                   QVTPDGRLPDASQAQDHLRFIFNRMGFNDQEIVALSGAHAMGRCHTNRSGFEGPWTFSP
FT                   VTFSNQYFALLRDEPWQWKKWTGPAQYEDKNTKTLMMLPTDMALLKDKSFKKYVDIYAD
FT                   NEEKFFSDFAKAFSKLIELGVPERQWAGEPWTLGTSD"
FT   gene            complement(717929..718969)
FT                   /locus_tag="CND02640"
FT   mRNA            complement(join(717929..718035,718089..718190,
FT                   718239..718301,718388..718551,718608..718969))
FT                   /locus_tag="CND02640"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(718004..718035,718089..718190,
FT                   718239..718301,718388..718466))
FT                   /codon_start=1
FT                   /locus_tag="CND02640"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK4"
FT                   /protein_id="AAW43358.1"
FT                   /translation="MLEDDKRSRRRAQFARFFKDCQQNSKYSTFTRAPEKREHGTTVRA
FT                   SVPLPLYQLTVALYDFGHQRNVCSVYEICDNFDISSEEGSHIAGCP"
FT   gene            complement(722886..725626)
FT                   /locus_tag="CND02650"
FT   mRNA            complement(join(722886..723404,723463..723583,
FT                   723635..724000,724052..725335,725391..725626))
FT                   /locus_tag="CND02650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(722986..723404,723463..723583,
FT                   723635..724000,724052..725335,725391..725582))
FT                   /codon_start=1
FT                   /locus_tag="CND02650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43165"
FT                   /db_xref="GOA:P0CQ92"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ92"
FT                   /protein_id="AAW43165.2"
FT                   /translation="MADDFITTIDSDDEVSNYGEPSALPKIKDDELDPDFQFDLGGGRS
FT                   EGLDLWGGDEVQGVKKGNEPINVDDIIERKRGKPIRAFKDRKRKRDEDATSEDDLEEDE
FT                   EEEGDSNDDSDAAKSGDSEEDEMDVDMSEGDGDEEDENEIESLKREDESDEEEEEEEDD
FT                   YDEEGENEVVDSDSESEEETAAEIARKDAFFSSDPTTTDPTLPSSFTAMNLSRPLLRAL
FT                   TSLQFTAPTPIQARAIPLALLGRDILGSAVTGSGKTAAFMVPILERLCYRDRGKGGAAC
FT                   RVLVLCPTRELAVQCEAVGKALAEKGGLDVRFALLVGGLSLNAQAHTLRTLPDILIATP
FT                   GRLIDHLTNTPSFTLSALDVLVIDEADRMLEAGFTDELEEIIKACPRSRQTMLFSATMT
FT                   DSVDELVKLSLDKPIRVFVDPKRNTARGLTQEFVRIRSDDSRSPSLLALCKRTIREKCI
FT                   IFFRSKALAHQMRIVFGLFGLKAAELHGNLTQEQRLQALNDFKAGTVDYLLATDLASRG
FT                   LDIKGVETVINYDMPGQLAQYTHRVGRTARAGRKGRSVSLVGEADRKMLKAAIKQAEAD
FT                   QVRHRIIPSEAVTAMKEKLEEFKDDIQEILKEEKEEKLLRQADMEIKKGQNMVEHEAEI
FT                   FSRPARTWFQSGKEKQASKSAGKDAYVGSFPSTGKSAEKEKEKLKRGKYDGLSRRLKRR
FT                   KMAIEEDAADAAAARKTEMGIRAAKKNALPKKITEPQPRLEKAGKGKDKKKGKARRVTG
FT                   GKGSAFDSEGKKSHEGMRAKPAKVNLEKGKKKGGKGKGRK"
FT   gene            725826..726869
FT                   /locus_tag="CND02660"
FT   mRNA            join(725826..726148,726203..726352,726414..726565,
FT                   726619..726869)
FT                   /locus_tag="CND02660"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(725918..726148,726203..726352,726414..726565,
FT                   726619..726829)
FT                   /codon_start=1
FT                   /locus_tag="CND02660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42934"
FT                   /db_xref="GOA:Q5KIK2"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR037319"
FT                   /db_xref="InterPro:IPR041054"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK2"
FT                   /protein_id="AAW42934.1"
FT                   /translation="MPTLILPGETVPIPSTSKAVVLGPGISQSTPTLQASSSTASGSSS
FT                   AQGYIATRLGMLHSGKGKERSQKLWIEGNSKRYIPAQKDIVLGIIIARHADGYRVDLGS
FT                   SQMAQLDALAFEGATKRSKPNLKVGTLVFARVMSASRDMEPELECFDPNTGKSDGFGEL
FT                   KGGVMVNATLQLCRRLLDRNHIVLPTIASIFPFEIAIGLNGRVWMKAETVGETLAMKRL
FT                   IESVDDHIIPVEEKAIKEKLREYLS"
FT   gene            727177..731418
FT                   /locus_tag="CND02670"
FT   mRNA            join(727177..727315,727363..728125,728174..728369,
FT                   728423..728526,728583..728940,729017..731418)
FT                   /locus_tag="CND02670"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        join(727234..727315,727363..728125,728174..728369,
FT                   728423..728526,728583..728940,729017..731302)
FT                   /codon_start=1
FT                   /locus_tag="CND02670"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42932"
FT                   /db_xref="GOA:Q5KIK1"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK1"
FT                   /protein_id="AAW42932.2"
FT                   /translation="MWWPFQWLFIYVLGGLTFVPLVVVIIVVYAIKYGSSPIRDDDPFK
FT                   LRKNQLQSQTEKEEQLQKRHSKERATTSETHSLSGWLTIRRQFHSNSTGGDGGISSSNK
FT                   GGSSMATTGSIAPPLPEVLTEDENPAKRSAELKDIDQSINTALGDSNAPSMNPAAKSTY
FT                   SSRIAQTYRSIVPRQNKLPAPKSYFFCVLKSSVLFLYEDESQSNCAAAIGIEDYNVEVE
FT                   DGGGQFNGRDGEMFSKRNAIVLKLREGGRGIPLLSKSMSAEDADGEASGPIYLFSKSNT
FT                   KMEDWYMALLQVSSCQPTFDDVFSSKDMQNMVDTIDTEPDPIPMRWFNAFMGRVFFGYY
FT                   RTEAFEQFIISKIMKKLSKVPRPSFLSPIVVREVNVGSSPPFFSKPMLKDLTASGTAAF
FT                   EVHVQHRSRASQPASDVRLTIATTATIPTGFKPYVVDLVLAVVLKSFEGNLLVQIKEPP
FT                   SNRIWYGFTKMPKIEMEIIPVVSERKIQISMVLKAIEKQLRDVIAESVVLPNMDDLAFF
FT                   NSCDYPVRGGIFDFAAKAKRNAKGEREDTFHASERSTQDALSPSSEASSTTLRQRHQKQ
FT                   TVYTSTTTVPPLTPSIPSSESGADTGTEIVRTETAPITLPSGSASSKKAAALSATKKWF
FT                   AASGAKPSSSVAQTLTGGVGQGADDDNSTNENLSKRSMESQEADRKIGQKGQTNWENRP
FT                   EIASVEVSLSTSSHSDIPEPVRASGIDDVTSGSRSTLGLVAPSPSKFSETSSIATSSTE
FT                   AFPNVIPTDETFALPHQLGMGSTSSLISSLRSRDKKALQAQMDSAKDQMKKWSVNFGAK
FT                   RRSKAGIIEEGGRSEKDEGRQALYRPKEEEEDVRDDDHIPLPSQSQTHRRTTSSLSHGL
FT                   SLQERLNAAAHETHATVVPHTHSSPMLIPERQRSSSTVSRPSLLPSPSKTSSLASVGVS
FT                   PSKWTPVGGRPTTGVIKDDAASTSSNILAAQAQPMSQGHTRRQSSSAPVSTQPTAERIM
FT                   VVPSVPKRPGQVTGIGSSDLVPSKLNEGSAIRHDQEEDSKLESTEDAKDELKPEPSTLP
FT                   PRKNTEPMQTEEKIEQEPPRGILPAHNVGVPPPLPPRKSAFDSPSKPKSLGQQNDQKVQ
FT                   LRAPEQVPDLSGSARFSEVYRSQPEKKSNDLREEVHSVSSNDKRPTHDPSLALASFSDR
FT                   QRNRGDDNDYNFTPCEFQAPTAPVAQSTKDRTGDSDAESALRMVTIKYEEARKAKEAES
FT                   NPEGEKVHVVNEEDDVLKNTRGYDAKTPAENRDSTLL"
FT   gene            complement(731193..732741)
FT                   /locus_tag="CND02680"
FT   mRNA            complement(join(731193..731537,731594..731723,
FT                   731770..731968,732022..732100,732156..732272,
FT                   732322..732432,732483..732741))
FT                   /locus_tag="CND02680"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(731427..731537,731594..731723,
FT                   731770..731968,732022..732100,732156..732272,
FT                   732322..732432,732483..732716))
FT                   /codon_start=1
FT                   /locus_tag="CND02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42930"
FT                   /db_xref="GOA:Q5KIK0"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR026846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIK0"
FT                   /protein_id="AAW42930.2"
FT                   /translation="MPSATYARQSANALNRATRGDDSLSPPAGPSNARDEDVKMNTRGS
FT                   PSEDEDEEEDIEGWTEDTFVDKPVNGSQPTMTMFRTLKSKLEEVTNRLEEAIEEIKDAA
FT                   FAIEEANPNDESLENIEGSLFKAFDQRQVLQIKIRCLEQLEARLKGGEEYTNVNDAFNH
FT                   LSEPEIKEYLAKSQRAKLRKFKEYIDFRSNLWSINHDDACPPVSSFLEKGINDEESDDE
FT                   IDVGGQTQTYRCPITLTLYQDPMTCTKCSHTYSKIAIYDLIDSARKQRRSAKCPVTGCS
FT                   VTIEKSDLKPNPSMQKRANEFARRQQDKDDEREDDIASIEDSDED"
FT   gene            732917..735459
FT                   /locus_tag="CND02690"
FT   mRNA            join(732917..733116,733171..733311,733361..733633,
FT                   733681..733783,733841..734099,734149..734216,
FT                   734263..734804,734853..735063,735120..735459)
FT                   /locus_tag="CND02690"
FT                   /product="damaged DNA binding protein, putative"
FT   CDS_pept        join(732977..733116,733171..733311,733361..733633,
FT                   733681..733783,733841..734099,734149..734216,
FT                   734263..734804,734853..735063,735120..735221)
FT                   /codon_start=1
FT                   /locus_tag="CND02690"
FT                   /product="damaged DNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42928"
FT                   /db_xref="GOA:Q5KIJ9"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004591"
FT                   /db_xref="InterPro:IPR007199"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013955"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ9"
FT                   /protein_id="AAW42928.2"
FT                   /translation="MASPLTVGFCERATSAEDVSECFDSVVQVLNVKKIASTDTTAVDR
FT                   YRAILSDGQYFIQAMLATQLNHFVESKQVDKHSLVKVVNFSVNSVSGRKLLIILALEVV
FT                   PWTDEKIGNPVSVDQAKSGASASAQPAGAHSAPLQSATAPAPARAQVPGRNASSARPGN
FT                   TKPKGDLGPLYPIEGLSPYQNRWTIKARVTQKSDIRHYSNQRGDGKLFNVTFMDETGEI
FT                   RATGFNDAVDNFYNLLEVGKVFFVSRARINIAKKQFSNVNNEYEIMFERDTEIEPCADE
FT                   SVPQVKYNFKGIGDLGELQKDDVCDVIGVVREVGELGSVTSRATNKPFAKRELQLVDQS
FT                   GQSVRLTLWGKQAETFQADDQPVIAFKGVKVGDFGGRSLSMFSNATMTINPDIPEAHSL
FT                   RGWFDAEGHNKHFTAYTTASVGDSAINTAAGAATRPAELKTIAQVKDEQLGMSEKTDFF
FT                   STEATVAFIKKDPFSYPACANPDNCAKKVVEDGSGWWCEKCQRRWDEPIHRYILSMNVM
FT                   DYTGQFWMTAFNETAEQIMGISANDLMKLKNEGNDLDYDVHFAKATARTYVFQMMAKQD
FT                   SFNDQVRVRYQCRKVAPPDYVADSAHLSQMISQMSV"
FT   gene            complement(735415..736938)
FT                   /locus_tag="CND02700"
FT   mRNA            complement(join(735415..736074,736125..736267,
FT                   736318..736376,736430..736682,736734..736938))
FT                   /locus_tag="CND02700"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(735505..736074,736125..736267,
FT                   736318..736376,736430..736682,736734..736866))
FT                   /codon_start=1
FT                   /locus_tag="CND02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43164"
FT                   /db_xref="GOA:Q5KIJ8"
FT                   /db_xref="InterPro:IPR018851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ8"
FT                   /protein_id="AAW43164.1"
FT                   /translation="MSAKTVRSVHAAVTLSTPPPLSKHSRSAFSEAERQGLLQNFDLEV
FT                   QDKLQYFRSMLKQTLDSFSLRGETEILSIPRELRTMTLGELEEKWGGGWAGTFHRIKTE
FT                   RFEVEEKEREEREEKGREEAVKGKRKRNIATTSRANSPARSTKNPRREAPTGPNRNAPS
FT                   RATSSTAAARAKPAAMSKRTSKAIVASSSNSTSGLPQVHIFNPALPTAPFRSAGAGSAA
FT                   RPSPISKVTHSYSCSRELSDNSGSIISVNEDSLEGDEEEDDLPDPQAMEAKLLSQPEAK
FT                   SPTSKSRSRKKRGPSLIFHQSFGAGKIISTPEPPSSLDSDEPLATIQLSDGREISFNPF
FT                   SLTPGRVERELEEGGVSKEEKIRVQNEVHAEVVKSLQARMEKWKV"
FT   gene            737062..741230
FT                   /locus_tag="CND02710"
FT   mRNA            join(737062..737145,737201..737854,737902..738091,
FT                   738143..738610,738663..738939,738990..740616,
FT                   740665..741012,741070..741230)
FT                   /locus_tag="CND02710"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(737077..737145,737201..737854,737902..738091,
FT                   738143..738610,738663..738939,738990..740616,
FT                   740665..741012,741070..741162)
FT                   /codon_start=1
FT                   /locus_tag="CND02710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42926"
FT                   /db_xref="GOA:Q5KIJ7"
FT                   /db_xref="InterPro:IPR005554"
FT                   /db_xref="InterPro:IPR035082"
FT                   /db_xref="InterPro:IPR035367"
FT                   /db_xref="InterPro:IPR035368"
FT                   /db_xref="InterPro:IPR035369"
FT                   /db_xref="InterPro:IPR035370"
FT                   /db_xref="InterPro:IPR035371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ7"
FT                   /protein_id="AAW42926.2"
FT                   /translation="MRNMVAQHSLKRKATLENGSGNKRGPAVPQSSRAENDNDLQELGN
FT                   ESSISYDEEAMEPLEDPMIDQQVFSDDAGSVSDADAHEEASESEEHDRPTAGPSRSSKN
FT                   LYKAPTLSEMEALRRAEETGGTTFSLQLSELLEASLLPTAPHAALKDLLTAIHSRILGM
FT                   PAIESLHPAKAIKRIGIKVPFPGPAEFSPLKNGKEIKWTLGWAKPEEVVIGGSWSVVGG
FT                   YKKEKGEMGGIDLVVAMPHGIFSPKDRLDYRYFHKRIFYLAVIFSELQRLATKEGELKG
FT                   VKIEWATNMADERRPIVVVRAGKDQGLKSKVDIRIHASIPSSLFPLSSLSPAKSLVRTA
FT                   LFATTDQTSGTPSPLYNTSILHDTLHKPHLLHLHRLSQLLPSNARTVDSFLALWRIWAK
FT                   RRGIRRERGGSAWLAGMVLGWVINGGWVGGVGGKREQVKKVAGVGRSLGAWGALRAAWE
FT                   FLAHTDFKQTPIFLHPPSSPSSFEHSVFLTFSHVFTDPSGLVNIFAGWDEGEIDFLRYH
FT                   ARETLAMLEDESGERFADVFLKEFDLGPAVFDEFFHIDISSARLPDDLYKRSEHPSVSS
FT                   LAVTVFSSTLRQGLSNRVNFVHICPISDHSISVGLLLDPSHANRVLDIGPSSDKPLEGE
FT                   AFRGLWGEKAELRRFKDGSIAESVVWDLSRPEDAALIPSKIVRYLLENHYSIPGDAVTS
FT                   FSSSQSWLSLIQIPSSARDAITIKGSEKLGFRPMLSGYDSLYKVLKDIDHKLPLAVLNV
FT                   QPSSPLLRYSSTFVPHPVDIHRFSAAPDCIKYIPSADVIVQFESSPKWPDDLAAVQKVK
FT                   LALFEKLARILPSRLPEIKADIVFDAGASEIEDQASLAVMLPEGISFRLRIYYEREKTM
FT                   LERVLQEEKPLFATSLPYPPRRLVVPALAIHLERFHYLPAHHSSLAPMHHRYPTYSSAC
FT                   RLLKRWFAAHMLLGESGVREEIVELIMAGVYLEPGRGKTPSSAVGGFMRAMELLECWDW
FT                   RTEPLLIPIVSASSPTSASASGRVRFPAELKEEALKLFEHLRAKEKGTEGNEGNVHAWV
FT                   VCTEQDVEGMRWTKGIGKAVAVRVGALARATVRAVKDSIEKGSLDVTALFITPLEHYDI
FT                   IIHLSPKFLSTSAQSILPDPSLWEPHLKYRNLTSSSEESDGMRIDFDPAALFVRDLKKI
FT                   YGDSLMFFVDRHGGDAVGGVWNLARDGARGLKSFLGWNGMPVKSEAELVEINKEAIIGE
FT                   IARLGQDLVVRIERRR"
FT   gene            complement(740667..742040)
FT                   /locus_tag="CND02720"
FT   mRNA            complement(join(740667..741282,741330..741500,
FT                   741556..741882,741937..742040))
FT                   /locus_tag="CND02720"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(741274..741282,741330..741500,
FT                   741556..741882,741937..741939))
FT                   /codon_start=1
FT                   /locus_tag="CND02720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43162"
FT                   /db_xref="GOA:Q5KIJ6"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="InterPro:IPR034666"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ6"
FT                   /protein_id="AAW43162.2"
FT                   /translation="MSNTLRPYLNAVRATLTAALTLSNFSSQVVERHNKPEVECGTSPE
FT                   VVLHPLIISRNESERVLIEPSVNSIRLSIAIKQADEIEKILCHKFTRFMMMRAEGFVIL
FT                   RRKPLPGYDISFLITNFHSESMLKHKLVDFIIQFMEDVDKEISEMKLSLNARARIVAES
FT                   YLSTFA"
FT   gene            742143..744059
FT                   /locus_tag="CND02730"
FT   mRNA            join(742143..742287,742335..742700,742752..742822,
FT                   742873..743022,743071..743347,743499..743584,
FT                   743646..743793,743854..743906,743962..744059)
FT                   /locus_tag="CND02730"
FT                   /product="fk506-binding protein 39 kda, putative"
FT   CDS_pept        join(742264..742287,742335..742700,742752..742822,
FT                   742873..743022,743071..743347,743499..743584,
FT                   743646..743793,743854..743906,743962..744004)
FT                   /codon_start=1
FT                   /locus_tag="CND02730"
FT                   /product="fk506-binding protein 39 kda, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42924"
FT                   /db_xref="GOA:P0CP98"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP98"
FT                   /protein_id="AAW42924.1"
FT                   /translation="MPLAMNLWSLTLLPGQQYPTYVRRDFQITNAALGEELRSKDGRSV
FT                   VKVTHNPISQSMLESDDEWSDEDEDEEILSEEDDGEMEVEEVKQKKGKKAEKVEEEDSE
FT                   EEDEDESDFEDELEETNVLCSLTAGKTEQASLNLTFVRGEVVVFEVTGDNVVHLMGNYI
FT                   QQDEDSDDESDSDFDGEDDYSELYGSDDDLELDSEEEAAVAKITEIPDEPTPKTKKALP
FT                   AADKKPVPEAKPAQKRKAEELESPAKEDAALSKAQKKKLAKKAKVEGEKAEEKPAAAAV
FT                   AEKPATKKEAKAPQKKTLPSGLIIEDIKIGDGPVAKTGKRLGMRYIGKLTNGKQFDANT
FT                   SGKPFSFVLGKGEVIRGWDEGLAGMAVGGERRLTIPAALAYGNQKIPGIPKNSTLKFDV
FT                   KLVSIN"
FT   gene            744200..749776
FT                   /locus_tag="CND02740"
FT   mRNA            join(744432..744541,744597..744690,744821..745559,
FT                   745610..745762,745812..745923,745969..746180,
FT                   746236..747356,747406..748932,748986..749369,
FT                   749426..749776)
FT                   /locus_tag="CND02740"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(744459..744541,744597..744690,744821..745559,
FT                   745610..745762,745812..745923,745969..746180,
FT                   746236..747356,747406..748932,748986..749369,
FT                   749426..749614)
FT                   /codon_start=1
FT                   /locus_tag="CND02740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42922"
FT                   /db_xref="GOA:Q5KIJ4"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ4"
FT                   /protein_id="AAW42922.2"
FT                   /translation="MSLFKRKHSKADLHPPPATTPAPAATQPVAPSAAPHRGQAYGNVG
FT                   IGGNNNPRRMTSNPQLKSSAQASYPAHSGQSPQLNQHLPGQVDTHAGHMSMMSTPHPQL
FT                   GYRINPQSPTPSANGPAASGGYGGSPHLGMSPPPIHSSAPASVQASAQPQQGQLQHQAL
FT                   HSNHPQGQSQEIGQGQLQSRPHPSPNPLSYPWQIRPLRLYSSGQNVPASPFPRYGLSVP
FT                   CFPSHSGHMLVFGGLVNEKVRNDLWSIDIRDLSVMYVKTKGDAPPPRVGHASVIMDRIM
FT                   VVWGGDTKIDVADEQDEGLYILDLRSQEWTKVPISKGPVGRYGHAACMVENRFYVFGGQ
FT                   ADGMFMNDMWMYDIKQLSGTAMVHTWEQVSYTTPPPPRRTGHVLVAASSGKLYLFGGTD
FT                   GNYHYNDTWCFDPSTGAWAELSCIGFIPLPREGHAAAIVDDTIYIFGGRDVKGKDLGDL
FT                   AAFRLSNQRWFMFQNMGPSPAARSGHAMVSAHGKIFVVGGEANQVPLEPGERDDPQKIH
FT                   VLDTSKIKYPHDAKSKTTMADQADSRGMQGTPQPGQQQGQTPGRLPQSASTEGLNTRTG
FT                   TSSPSSERGPSTQHVLTQSQSQVLDTQVSPQSQAQIPQPPLQSPRNVGPVLTTKPNGPP
FT                   PQRPRREGDEEFREAMSPTKLHYSSQASDQAQSPVQSSLPSRVTSPTHISPTSPKNHPK
FT                   MFHSSVNGTRSPSPRLRNADGPSSERERAPPPPDAFYYGRRSPTANGFRQSASSRPSSF
FT                   GASNDLVKEVRAKENEVEEGKRRETALKIILNRAVKQGFLLGDEEQKPSGGDKEEQADD
FT                   NKQNDGLVGRLTDALVRLKKEKAKMQNDLVAQIRAASAKSVEADHLRRGALQETAFYRA
FT                   KIAALETNSLLDLKRVEKERINELEKQINILANENAQMSKELEWEKEGREQANCLHSSA
FT                   TQREAETLRRAEEAEEAQKEALEELERLRGHFLTYEQGAREHSEQLITLSSRVQQREAE
FT                   RDQLRSQLDEAIATRDQNIQLVSEVQAAITSAGLMASEMEAMYTKESVKVQQLEEELAE
FT                   CRAELESRTRNAELATEKLKEIENAYAKSREEADALRAVTTSRLGEILDSHKEMRADET
FT                   RAARGHQEQLQALEEEGKSLRKMLKEAGQRVDAAESGVNQHRTKMRDVESKVQTLRGEL
FT                   RTSQTKLLSAQAEVARYKQLHSTRDEELKEKEIAMTEVETRCAMLRNLLADHGIAVNDS
FT                   DLEDIKAPSTRELEGKLREQTRVSEAAQREIQDLRTRCEEAEVKVESLGKLVERIKGAR
FT                   SPTSASMRSPTPTSGEMTRVSELEKKLIDMEKEHRDKVAGLETDYQTAVRYVKGTEKML
FT                   KRMKDELNRQKATNTTIQTELDHLRGRSSISGRSTPSSSSVIESDVQRRFNVLQNQHQK
FT                   LQEDFSASQDVLSARNREVDLLRMRLDEAERDMESLRDDLAQAQHRIQTLLDVKGGSDD
FT                   EDDGSLEATMAFDKFSQELKQWERSRSPGEGNFEDKSSEEGTTMPGQSASYQARVVAQS
FT                   SKAHSPSSSEYSGDWVQ"
FT   gene            complement(750068..752442)
FT                   /locus_tag="CND02750"
FT   mRNA            complement(join(750068..750542,750638..750802,
FT                   750856..751480,751531..751758,751817..751915,
FT                   751987..752103,752209..752442))
FT                   /locus_tag="CND02750"
FT                   /product="Delta-12 fatty acid desaturase, putative"
FT   mRNA            complement(join(750392..750802,750856..751480,
FT                   751531..751758,751817..751915,751987..752103,
FT                   752209..752442))
FT                   /locus_tag="CND02750"
FT                   /product="Delta-12 fatty acid desaturase, putative"
FT   CDS_pept        complement(join(750680..750802,750856..751480,
FT                   751531..751758,751817..751915,751987..752103,
FT                   752209..752363))
FT                   /codon_start=1
FT                   /locus_tag="CND02750"
FT                   /product="Delta-12 fatty acid desaturase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42919"
FT                   /db_xref="GOA:Q5KIJ3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ3"
FT                   /protein_id="AAW42919.1"
FT                   /translation="MTSTLRQRAVTPPAGQVEKDQLLREAEEKEISQGQQFIVPNFTIK
FT                   QLLDAIPAHCYKRSALRSSLYVVQDVVVIAALVYGAFHIDSLLGRFSLSPVAYYAAKFA
FT                   LWSAYWFITGLFGTGIWVIAHEAGHQAYSSSKAINNAVGWVLHSALLVPYHSWRISHGR
FT                   HHAATGHLTRDEVFVPRTRKQLGYPEVEEEGEILGINVSKERQNQLREALEDSPIVVCY
FT                   NLFLQQLFGWPMYLIRNASGQLHYPEKTNHFSPHSFIFKANQYWQIIWSDIGIVLVFAA
FT                   LAFWASQRGIKEVATIYGIPYLWVNHWLVFITFLQHTDPVLPHYSANKWTFPRGALATI
FT                   DRDFLGPVGAYAFHGITETHVAHHISSKIPHYNAWEATEALKKFLGPAYHKSNENMFVS
FT                   CYKCYRDCLFVEDGQDIVFYKNASGLAQRVPVEENGNISDSGIDMAESK"
FT   CDS_pept        complement(join(750680..750802,750856..751480,
FT                   751531..751758,751817..751915,751987..752103,
FT                   752209..752363))
FT                   /codon_start=1
FT                   /locus_tag="CND02750"
FT                   /product="Delta-12 fatty acid desaturase, putative"
FT                   /db_xref="GOA:Q5KIJ3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ3"
FT                   /protein_id="ALO60520.1"
FT                   /translation="MTSTLRQRAVTPPAGQVEKDQLLREAEEKEISQGQQFIVPNFTIK
FT                   QLLDAIPAHCYKRSALRSSLYVVQDVVVIAALVYGAFHIDSLLGRFSLSPVAYYAAKFA
FT                   LWSAYWFITGLFGTGIWVIAHEAGHQAYSSSKAINNAVGWVLHSALLVPYHSWRISHGR
FT                   HHAATGHLTRDEVFVPRTRKQLGYPEVEEEGEILGINVSKERQNQLREALEDSPIVVCY
FT                   NLFLQQLFGWPMYLIRNASGQLHYPEKTNHFSPHSFIFKANQYWQIIWSDIGIVLVFAA
FT                   LAFWASQRGIKEVATIYGIPYLWVNHWLVFITFLQHTDPVLPHYSANKWTFPRGALATI
FT                   DRDFLGPVGAYAFHGITETHVAHHISSKIPHYNAWEATEALKKFLGPAYHKSNENMFVS
FT                   CYKCYRDCLFVEDGQDIVFYKNASGLAQRVPVEENGNISDSGIDMAESK"
FT   gene            complement(752829..752920)
FT                   /locus_tag="CND02760"
FT   tRNA            complement(752829..752920)
FT                   /locus_tag="CND02760"
FT                   /product="tRNA-Tyr"
FT   gene            753048..754206
FT                   /locus_tag="CND02770"
FT   mRNA            join(753048..753464,753536..753613,753693..753742,
FT                   753804..753862,753912..753976,754030..754206)
FT                   /locus_tag="CND02770"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(753384..753464,753536..753613,753693..753742,
FT                   753804..753862,753912..753976,754030..754104)
FT                   /codon_start=1
FT                   /locus_tag="CND02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42917"
FT                   /db_xref="GOA:Q5KIJ2"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ2"
FT                   /protein_id="AAW42917.1"
FT                   /translation="MSTPPANITVVPDEANLQVWRVRITGPPGTPYAKGTFTVSVEFTK
FT                   EYPFKPPVIKFETRTYHPNIDNDGNICIGLLKTEQWKPATKMDNVLREIYNLLAEPNPD
FT                   DPLVTSIAEQYRTDRKTFDKRAAEFVVKYAS"
FT   gene            complement(754357..755453)
FT                   /locus_tag="CND02780"
FT   mRNA            complement(join(754357..754456,754504..754676,
FT                   754736..755070,755123..755247,755362..755453))
FT                   /locus_tag="CND02780"
FT                   /product="40s ribosomal protein s6-b, putative"
FT   CDS_pept        complement(join(754447..754456,754504..754676,
FT                   754736..755070,755123..755247,755362..755432))
FT                   /codon_start=1
FT                   /locus_tag="CND02780"
FT                   /product="40s ribosomal protein s6-b, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42915"
FT                   /db_xref="GOA:Q5KIJ1"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ1"
FT                   /protein_id="AAW42915.1"
FT                   /translation="MKVNFSNPATGAQKLIDFEDERKTRIFMEKRMGQEVAIDSLGEEF
FT                   AGYVVRITGGNDKQGFPMKQGVLLQHRTRLLLSDGHSCYRARRDGERKRKSVRGCIVGS
FT                   DIGVLAVAIVKQGANELPGLTDVVLPKRLGPKRATKIRKFFNLSKEDDVTKFVVRREVT
FT                   KKNGKTTTKAPKIQRLVTPLRLQRKRHLRSLKKRRTEAQKETVAEYNAAVAKHAEEKKV
FT                   HNAAVKAAKKARRSA"
FT   gene            755682..756450
FT                   /locus_tag="CND02790"
FT   mRNA            join(755682..755746,755797..756023,756117..756219,
FT                   756275..756450)
FT                   /locus_tag="CND02790"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(755739..755746,755797..756023,756117..756219,
FT                   756275..756392)
FT                   /codon_start=1
FT                   /locus_tag="CND02790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42913"
FT                   /db_xref="GOA:Q5KIJ0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="InterPro:IPR012606"
FT                   /db_xref="InterPro:IPR023029"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIJ0"
FT                   /protein_id="AAW42913.1"
FT                   /translation="MGRMHSKGKGMSASALPYRRSQPSWSKATPEEVCDQIFKLARRGL
FT                   SPSQIGVILRDSQGIPQVKSVTGNKILRILKTNGLAPSIPEDLYHLIKKAVSVRKHLER
FT                   NRGDKDAKFRMILIESRIHRLARYYIKTQQVPATFKYEAATASTLVA"
FT   gene            758600..759825
FT                   /locus_tag="CND02795"
FT   mRNA            join(758600..758951,759013..759089,759158..759171,
FT                   759249..759825)
FT                   /locus_tag="CND02795"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(758931..758951,759013..759089,759158..759171,
FT                   759249..759574)
FT                   /codon_start=1
FT                   /locus_tag="CND02795"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIR1"
FT                   /protein_id="ALO60521.1"
FT                   /translation="MMRVEGESRTALTSPLDRLGKRDFLRKFSVVLVSNSMRTAILSHD
FT                   IDHDSMPSTPDHLLSLYPHTLGRTLIRPPAPVLQQIALLRPLIAVLHSQHKINLNCSSF
FT                   PSSLDQRTKLKRHIPFPMVVLQVARLAVPGQGAADEHGRLS"
FT   gene            complement(760093..762927)
FT                   /locus_tag="CND02800"
FT   mRNA            complement(join(760093..760853,760906..761354,
FT                   761416..761548,761603..761981,762036..762235,
FT                   762308..762927))
FT                   /locus_tag="CND02800"
FT                   /product="glycerol kinase, putative"
FT   CDS_pept        complement(join(760214..760853,760906..761354,
FT                   761416..761548,761603..761981,762036..762235,
FT                   762308..762786))
FT                   /codon_start=1
FT                   /locus_tag="CND02800"
FT                   /product="glycerol kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43160"
FT                   /db_xref="GOA:Q5KII9"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII9"
FT                   /protein_id="AAW43160.1"
FT                   /translation="MSRPIDLSMSSVKNPSPLAAGGTGGFTPVFEASPANSPAGSRRPS
FT                   ISQPTARRPSEVSISRRPSVNHQYSSYVSQYPQQGSLSRRSSMASGPRPIRRGEYSGPV
FT                   TPSVLSRAGSPTLPLGNEFTQAPRSYYEGASGYTPLGGTRELRNGQFIGSLDCGTTSTR
FT                   FIIFDKRAKIIAEHQTEFEQILPHAGWHEHDPDALVEAMNECIIKAVEKLEWMGWSRNS
FT                   IKGIGITNQRETTVCWSRSTGKPLCNAIVWDDARTINVVREMEKKLDEEGLEIDDEEED
FT                   EINQKSKIVPDEVEMGTGTHEAAFGEKGDVVDGDTSMTGKIGKAMEGLGLSGRGKDGKA
FT                   KKYRKGKEGLVDVTGIPLSTYFSAIKLRWMLDHQKAVRIAHEADDLMFGTVDTWLVYNL
FT                   TGANNGGLHIIDVTNASRTLLISLKTLRWHAPLLRFFGLRASILPKIVSSAEVYGNISD
FT                   SLGLPLSGVPIAGIVGDQQAALVGNKCLMKGQAKCTYGTGAFVLFNTGEDIVRSNYGLI
FT                   STVAFQAGADSKPVYALEGSIAVAGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYF
FT                   VTAFSGLLAPYWDREASGTIIGLTGYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRL
FT                   DTLKVDGGVTNSDLAMQLQANIGGFNVARPSMRESTALGSALLAAHALGLFGWDLTRPE
FT                   TLSEVNTAGVHTFEPELEEKARLKKIKGWNKAVDRAKKWHDIDDEDDEEEEYENEAGYA
FT                   KIIGSA"
FT   gene            763206..765779
FT                   /locus_tag="CND02810"
FT   mRNA            join(763206..764091,764141..764275,764317..764804,
FT                   764849..765040,765106..765115,765169..765287,
FT                   765343..765420,765491..765779)
FT                   /locus_tag="CND02810"
FT                   /product="CAP1-related"
FT   CDS_pept        join(763278..764091,764141..764275,764317..764804,
FT                   764849..765040,765106..765115,765169..765287,
FT                   765343..765420,765491..765565)
FT                   /codon_start=1
FT                   /locus_tag="CND02810"
FT                   /product="CAP1-related"
FT                   /db_xref="EnsemblGenomes-Gn:CND02810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42911"
FT                   /db_xref="GOA:Q5KII8"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII8"
FT                   /protein_id="AAW42911.1"
FT                   /translation="MTPSRAYTPPVSPKLKNTNLSYTILPHGAPPVSRPIRRPKKIIYL
FT                   AAIFFLLYWFGIRHGLGRERLPIPPLGYAVKGGRRGRKSSLAWHSKGMATLLQPQPGTK
FT                   QEHPIYELMERAETHWTSMLASQSTTLPQAVAQYRKRYGIAPPLGFDAWFDFCKRHDIK
FT                   IIDEYDQMMKDILPHHALPPVMFIARSKALEGAAYTYTLDISQEHVNITGERSSYDRPQ
FT                   HLLKLIAGFKGDLPPEFRLRVTGSDHNTGSVVLGMDQRMRAMELVQQSKHFDEDELKSL
FT                   EDPYRTPAWGWFKACPLDSPANIRPWSENATDEFQPKSFIHDHLPIMDFCEYPELKRLH
FT                   GAMSLDYANRSPSVLKPILVLSKFPFDSSFQTPPMEGYMNITEEDVLFLDRWEDKTDNR
FT                   LFWRGSTTGGYTAQRDWKDSHRLRLHLMINGPKGGNAWWDQQLRDVMVPDGEGGFKIVR
FT                   RWERVLSKAYADVKLSGQPVQCPSEEICREVADTIEFGKKVWPDEAAVYKYNLDVDGDG
FT                   WSSRFHRLLISGSPVIKFTMFPEWHQEWLTPWYHYIPLKPDYSDLYDIMAFFVGPLDDA
FT                   GHVDFSKGHDYLAKKIGNAGQKFALEHSSWVDMQAYMFRLLLELQRLHSLNRSSMSYKA
FT                   Q"
FT   gene            766692..768753
FT                   /locus_tag="CND02820"
FT   mRNA            join(766692..766792,766847..767239,767295..767316,
FT                   767399..767645,767694..768399,768452..768499,
FT                   768548..768753)
FT                   /locus_tag="CND02820"
FT                   /product="expressed protein"
FT   mRNA            join(766704..767239,767295..767316,767399..767645,
FT                   767694..768399,768452..768499,768548..768753)
FT                   /locus_tag="CND02820"
FT                   /product="expressed protein"
FT   CDS_pept        join(766892..767239,767295..767316,767399..767645,
FT                   767694..768399,768452..768499,768548..768622)
FT                   /codon_start=1
FT                   /locus_tag="CND02820"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII7"
FT                   /protein_id="AAW42908.1"
FT                   /translation="MDILDEPLPGHMESISAFRTLLKSPSDRVTCPDSVARPAEPDALQ
FT                   TSAIESWKATEPSRESRLRLLRLLNDLTYIINSKYKGYEEGGLKRYWVDVFGSVSWAGD
FT                   TGHSGDLDLIVLDRKLLHGYAPVFWRTPPGEPLSTPTSHKRNNIPTPLKHLPEVYDTFS
FT                   MAECLRQAGFEDVESIAAASTPINKFKYRDQECDLNVNDLGGWYNSSLLLHYCRLAPYV
FT                   LRPMVHALKLWASSHKLNDPSGAKGPATMSSYCLTLMAIAYLQHIGHLPNLQADINVPE
FT                   VCRPEDTSEHDVVWVSWGKEQGVKAHVGFSLSPSDDWKPSNPNLTAADAIRGFFEFFSL
FT                   NGSAPLRGEKFDRVTQIVSILQGGIVPRAKEYGQEIRESQQRRDTLLNLGISLERIRQS
FT                   EDMIRQERFKEEERMGKGDRGIQPRNWGEKKLVVQDPFLWFKNCAGMMSRDGLDRWWTT
FT                   VDNTHRVIKLKGKNFTLADLLML"
FT   CDS_pept        join(766892..767239,767295..767316,767399..767645,
FT                   767694..768399,768452..768499,768548..768622)
FT                   /codon_start=1
FT                   /locus_tag="CND02820"
FT                   /product="expressed protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII7"
FT                   /protein_id="ALO60522.1"
FT                   /translation="MDILDEPLPGHMESISAFRTLLKSPSDRVTCPDSVARPAEPDALQ
FT                   TSAIESWKATEPSRESRLRLLRLLNDLTYIINSKYKGYEEGGLKRYWVDVFGSVSWAGD
FT                   TGHSGDLDLIVLDRKLLHGYAPVFWRTPPGEPLSTPTSHKRNNIPTPLKHLPEVYDTFS
FT                   MAECLRQAGFEDVESIAAASTPINKFKYRDQECDLNVNDLGGWYNSSLLLHYCRLAPYV
FT                   LRPMVHALKLWASSHKLNDPSGAKGPATMSSYCLTLMAIAYLQHIGHLPNLQADINVPE
FT                   VCRPEDTSEHDVVWVSWGKEQGVKAHVGFSLSPSDDWKPSNPNLTAADAIRGFFEFFSL
FT                   NGSAPLRGEKFDRVTQIVSILQGGIVPRAKEYGQEIRESQQRRDTLLNLGISLERIRQS
FT                   EDMIRQERFKEEERMGKGDRGIQPRNWGEKKLVVQDPFLWFKNCAGMMSRDGLDRWWTT
FT                   VDNTHRVIKLKGKNFTLADLLML"
FT   gene            complement(769029..770419)
FT                   /locus_tag="CND02830"
FT   mRNA            complement(join(769029..769420,769474..769658,
FT                   769709..770419))
FT                   /locus_tag="CND02830"
FT                   /product="nitrogen metabolism-related protein, putative"
FT   CDS_pept        complement(join(769247..769420,769474..769658,
FT                   769709..770180))
FT                   /codon_start=1
FT                   /locus_tag="CND02830"
FT                   /product="nitrogen metabolism-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43159"
FT                   /db_xref="GOA:Q5KII6"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII6"
FT                   /protein_id="AAW43159.1"
FT                   /translation="MAGLYHDQFGRKVAKIQLLLINPNSTSTFTQDVARHLHPRLPTDV
FT                   GITFYTPPPEAPASIDGPLDGIVSTAVILKDLELQPKGQAVNAPEDSSGASRLATSYSG
FT                   IVVACFSAHPLVPVLKELLAGYDKPPPVLGILESSVLAALQLGPTFGIATTGPQWEPLF
FT                   DEAVRAMGISPTRYTGTKGTGFNAVSLHGDKPAEALLEASCFLVQKGARVIILGCAGMA
FT                   PMRASLQEQLADRVGQSVAVIDGVSAAVDMAIGYARMGIGRTFGPDLSENSPTT"
FT   gene            770537..772158
FT                   /locus_tag="CND02840"
FT   mRNA            join(770537..770647,770699..770772,770819..770840,
FT                   770916..771108,771173..771415,771465..771796,
FT                   771851..772158)
FT                   /locus_tag="CND02840"
FT                   /product="host-pathogen interaction-related protein,
FT                   putative"
FT   CDS_pept        join(770611..770647,770699..770772,770819..770840,
FT                   770916..771108,771173..771415,771465..771796,
FT                   771851..771987)
FT                   /codon_start=1
FT                   /locus_tag="CND02840"
FT                   /product="host-pathogen interaction-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42906"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034094"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII5"
FT                   /protein_id="AAW42906.2"
FT                   /translation="MTLSKQRKVLTLEHFIIDTFTRLGNDGIERPIEQPDQIGGGGTYA
FT                   VIGARAFLPPTQLGMIVDYTPSTFPRALKDVLESYGNEMWAFRERTDGLPTARAVNRYD
FT                   GETRGFEYLCQPVLLTPNSLKGTQFEDIVPSVIHFISYPAPRAGIVLDEINNFRTSKGW
FT                   SPLIVWEPEDESLEAVTSIASHVDILGPNQNEALRLYSLLTDPTFTDDDFKAVLTKICR
FT                   SLAYLRPRIGAVIRAGHLGCCYASADPRGYRPEVKWIPAYWNKERDGYEGKVIDPTGAG
FT                   NAFMGGIAAALSEGKSLDEAVRWGSVAASFAIEQIGLPQLTKTVDGRELWNGQNPQERL
FT                   TAMSM"
FT   gene            772440..772532
FT                   /locus_tag="CND02850"
FT   tRNA            772440..772532
FT                   /locus_tag="CND02850"
FT                   /product="tRNA-Tyr"
FT   gene            772920..776429
FT                   /locus_tag="CND02860"
FT   mRNA            join(772920..773243,773294..773394,773453..773573,
FT                   773623..773752,773803..774002,774054..774232,
FT                   774291..774477,774529..775031,775086..775572,
FT                   775618..775760,775816..776032,776079..776429)
FT                   /locus_tag="CND02860"
FT                   /product="WD-repeat protein, putative"
FT   CDS_pept        join(772970..773243,773294..773394,773453..773573,
FT                   773623..773752,773803..774002,774054..774232,
FT                   774291..774477,774529..775031,775086..775572,
FT                   775618..775760,775816..776032,776079..776395)
FT                   /codon_start=1
FT                   /locus_tag="CND02860"
FT                   /product="WD-repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42904"
FT                   /db_xref="GOA:Q5KII4"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII4"
FT                   /protein_id="AAW42904.2"
FT                   /translation="MISSAGHPTKKRQKKQLRSSQPAAGPSQQPSSPPRIFAPFRALGY
FT                   VTDHVPFAMFVHTPSGALATPTVNITTSVGRSWLMWDAARMTLVFAGADTGNQINGLAM
FT                   TGTDIYVSSGSKVIKYHRGKEVASFLSPDGSTLGQILIFGDDFLVLKKDGSGMFVFDLA
FT                   TRHLRNQIAFHSSFTASSLMHPATYLNKVLVGSKQGELQLWNVRTCALVHSFPHPTPFN
FT                   PSSITTIVQTPAVDVVGIGYLDGSIRIQDIKHGDLVMQMKIEDGAVSSMSFRMDGPSIL
FT                   ATASSTGSISIWDLSKGGRILHTLRGAHDQSISGLQWVSGQPLLVSSSLDNSVKQWLCD
FT                   SPTGMPRLLKLRGGHHAPPTCVRYYGEDGKQILTAGKDRALRYTSVVRDSRSFELSQGS
FT                   LVKKAIGLGVTVDHLKFPQITAISSSSMRSKDWEDVLTAHSEDAVARTWRVQEKRMGPW
FT                   TFELEDGYAQSVCVTACGNFGIAGSSTGEIRMWNMQSGKERKSFALTGAAPGNSKPKII
FT                   SQSTGMVKAKVRKPERAKGNKSVQAITGLATDALNTILVASTLEGKLYFFDFHSTQKLD
FT                   EVQIESSITAISLHRDSGLLAATCDDLVIRLVDIESRRVVRELRGFKGRILDVVFTPDS
FT                   RWVIATSLDSIIRTYDIPTGKLIDAFKTSSIATSVTFSPTGDFLATAHVDSVGVHLWAN
FT                   RAQFTDVALRNLEEDDDVVEVGLPTVQGLDADDAIEGIEDVGAPEFTDIYTTPDQIDES
FT                   LVTLSLIPRSRWQMLLNLETIKQRNKPKEAPKAPEKAPFFLPTISGLETQFDLSAVDKN
FT                   RTEEELHKGKRLELDGSWLESEFTRRLSVEDETGSYNTFFEYMKALPPSTLDLEIRSLI
FT                   SLTHLSSFINALTQRLKSHRDYEAIQAIMSVFLRVHGDMLIANAELKEGLGALRLEQER
FT                   ESKRLRELVGYALGTLGFLRGA"
FT   gene            complement(776420..778469)
FT                   /locus_tag="CND02870"
FT   mRNA            complement(join(776420..776558,776616..777065,
FT                   777115..777192,777245..777515,777562..778400,
FT                   778440..778469))
FT                   /locus_tag="CND02870"
FT                   /product="mRNA processing-related protein, putative"
FT   CDS_pept        complement(join(776488..776558,776616..777065,
FT                   777115..777192,777245..777515,777562..778400,
FT                   778440..778455))
FT                   /codon_start=1
FT                   /locus_tag="CND02870"
FT                   /product="mRNA processing-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43157"
FT                   /db_xref="GOA:P0CR52"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR52"
FT                   /protein_id="AAW43157.1"
FT                   /translation="MLSTSTSLQGGKVSREEYRRQKDLEAARKAGTAPAALDEQGNAIN
FT                   PHIPEYITKAPWYADTGRPSLAHQRINEQGPHLKLDEWYDRGAKAGPAAKKYRKGACEN
FT                   CGAMTHKMKDCVERPRKRGAKFTNKDIAPDELVQQFEGDYDAKRDRWNGYDPASYKHVV
FT                   EEYEATEQMRKKYREEEIDQQTSTDMAVVKKLAKKDKEGKVEDDDDDFGSSDEDEDDED
FT                   KYADAADQVGQKLDTKTRITVRNLRIREDTAKYLINLDESSAYYDPKTRSMRDAPVRNM
FT                   NPEDMKFAGDNFQRYSGDATNMQKLQLFAWQSAQKGSNINVSANPTAGELLHREFQQKK
FT                   EVLKDTNKTSILAKYGGEEHLQRMPNELLSGQTENYVEYSRSGQIIKGRERAKARSKYD
FT                   EDVYINNHTAIWGSYYDLSTSQWGFACCHSVLPGSYCTGDAGKLANAASSASALLASSN
FT                   ERSKIEEAAEKERESLAEQHLKDLASGKAKKGKEREWDLPQYAKRREDGEELDLDKGRL
FT                   KNALKEEKKRKKMGEDEAWQQTKKGKTDVTQEELEAYRLSRQAYDDPMSNYQDPEDQ"
FT   gene            778610..780857
FT                   /locus_tag="CND02880"
FT   mRNA            join(778610..778686,778732..779068,779124..779755,
FT                   779808..780000,780053..780274,780324..780495,
FT                   780545..780857)
FT                   /locus_tag="CND02880"
FT                   /product="splicing factor SF1, putative"
FT   CDS_pept        join(778648..778686,778732..779068,779124..779755,
FT                   779808..780000,780053..780274,780324..780495,
FT                   780545..780590)
FT                   /codon_start=1
FT                   /locus_tag="CND02880"
FT                   /product="splicing factor SF1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42902"
FT                   /db_xref="GOA:P0CO44"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR031150"
FT                   /db_xref="InterPro:IPR032570"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO44"
FT                   /protein_id="AAW42902.1"
FT                   /translation="MWRPAAKTTGTNDVPLANKRRFGLPEEGPPSNSPSYAPRPAADIQ
FT                   YFNGRQERERDARDDRERPRDDYDRRRDDYVRDDRDRRYDDYPRDGHSDRRDERSKWDE
FT                   GDRREAPRGRERSRDRGDSNEDGPRKRRSRWGDASAKVNVPGMPVAVMGNVSQTELDNY
FT                   AIHVRLEEINRKLRTGDVVPPEGQRSPSPTPQYDAYGRRTNTRELRYRKKLEDERTRLI
FT                   DRAVKSDPNFRPPVDFQHKRGSRPQDKVYIPVKEFPEINFFGLLVGPRGNSLKKMERES
FT                   GAKISIRGKGSVKEGKGRAGNFPQDEEDELHCLITADDESKVKTCVALINKVIETAAST
FT                   PEGENDHKRNQLRELASLNGTLRDDENQLCQNCGEKGHRRWECPQQRVYSANVICRICG
FT                   GAGHMARDCRGRGDPSLTQNKQTAFDSEYTALMAELGEGGGSTPGSAPAAAIGAPGAIP
FT                   PQSRVPPWRLPENWQTNSGGFRGPPNFQAQGYQQAAPGAAAYGQQAYPGYAGYQTGAVS
FT                   GYGSPATGGADAYAAYYASMGQQAPAAAV"
FT   gene            complement(781724..784805)
FT                   /locus_tag="CND02890"
FT   mRNA            complement(join(781724..782026,782081..782284,
FT                   782343..782467,782519..782789,782840..783128,
FT                   783178..783474,783530..784338,784400..784805))
FT                   /locus_tag="CND02890"
FT                   /product="DNA supercoiling, putative"
FT   CDS_pept        complement(join(781918..782026,782081..782284,
FT                   782343..782467,782519..782789,782840..783128,
FT                   783178..783474,783530..784338,784400..784752))
FT                   /codon_start=1
FT                   /locus_tag="CND02890"
FT                   /product="DNA supercoiling, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43155"
FT                   /db_xref="GOA:Q5KII1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR013967"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII1"
FT                   /protein_id="AAW43155.1"
FT                   /translation="MLRRTIQRPSEPPLTSATSGGYGIVSTPFKVPKSSAPKRESALPA
FT                   RKRKAVSYKEEGSFDGSGDYEDNNEGRASKKGKFAMGNKEYGSDGVLGDMAKWCNRKFP
FT                   VFQPKDKSGVFTKSFSIPVMYCPKTSEPIIHSLSHASLGARRHPTLIPRPLHNPMDDHA
FT                   IVLFDPTIDDKPNPEDMKAAEFHEEMKKKEELNKGPHRSLKAILGIVDEKKNKQVVKVP
FT                   VVIDPRLSKVLRPHQIEGVKFLYRCTTGLIADGAWGCIMADEMGLGKTLQCIALLWTLL
FT                   KQSPVAGKPTCEKVIIACPTSLVGNWANELVKWLGTGAVSPMVVDGKGGKAELIPAVRR
FT                   WVQAHGRNVTLPVMIVSYETLRTLQEELASCEIGLLLADEGHRLKNAETLTFQALTSLK
FT                   VQRRVILTGTPIQNDLSEYFALLNFANPEYLGSKLDFKKNFESKILRGRDADATEKEKL
FT                   ESDAKLKELGGLVSKFIIRRTNDLLSKYLPVKYEHVVFCRPSPLQASLYNLFVTSKDVQ
FT                   RLLRGKDSQPLKAIGLLRKLVNHPDLLNLPEDLPGSEALLPDGYNGKGRDRTVNCQYSG
FT                   KFVVLERMLDHINHHTNDKIVLISNATQTLDLMEKLCRSKRYGYLRLDGSMSVPKRSKI
FT                   VAQFNQPESKEFVFLLSSKAGGCGINLIGANRLVLFDPDWNPASDQQALARVWRDGQKK
FT                   ECFVYRFQTTGTIEEKIFQRQCQKQNLSACVVDEAEDTARHFTQGDLRQLFNFNPETLC
FT                   DTHDTYKCKRCREGKQFVKAQALLYGDASTWNHYPNEELGKMHDDLLRAELGLPEVSYV
FT                   FQYISH"
FT   gene            785182..788988
FT                   /locus_tag="CND02900"
FT   mRNA            join(785182..785430,786063..786095,786146..786253,
FT                   786318..786763,786815..786968,787021..788028,
FT                   788074..788135,788191..788332,788386..788508,
FT                   788556..788988)
FT                   /locus_tag="CND02900"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing), putative"
FT   mRNA            join(785182..785218,785270..785430,786063..786095,
FT                   786146..786253,786318..786763,786815..786968,
FT                   787021..788028,788074..788135,788191..788332,
FT                   788386..788508,788556..788988)
FT                   /locus_tag="CND02900"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing), putative"
FT   CDS_pept        join(786089..786095,786146..786253,786318..786763,
FT                   786815..786968,787021..788028,788074..788135,
FT                   788191..788332,788386..788508,788556..788626)
FT                   /codon_start=1
FT                   /locus_tag="CND02900"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42899"
FT                   /db_xref="GOA:Q5KII0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII0"
FT                   /protein_id="AAW42899.1"
FT                   /translation="MCGIFSYCSFLCERNRKYVCDVLCNGLARLEYRGYDSAGIGIDGD
FT                   SKGSSMILFKEVGKVAALRKHIDEGIPCPLPGQAPSKEKVDMSKVFLSQTSMAHTRWAT
FT                   HGVPSPGNCHPHVSDVQTEFSLVHNGIITNYKELKLVLLKRGYTFHSDTDTEVVAVLCK
FT                   YVWDSQPNKRLNFTELIKTVVKELEGSFAFVFKSTHFPDEIVAARRGSPLLIGVKTDRK
FT                   LKVDFVDVELPTAEERVNDVDASGLLAVPAAVAEGPGPKLRRSQSRAFLSEDGMPQPIE
FT                   FFVASDASAVIEHTKRVLYLEDDDIAHIAEGELHIHRLRRDDTVSSVRAIEHLEIELAA
FT                   IMKGQYDHFMQKEIYEQPESVVNTMRGRVNFDTRSIMLGGLKAYLPVIRRGRRLIFVAC
FT                   GTSYHSCIAVRPVFEELTDIPVAVELASDFLDRRTPVFRDDVAIFVSQSGETADTILAM
FT                   RYCLERGALCLGVVNAVGSTLSRETHSGVHINAGPEIGVASTKAYTSQYVALVMIAVQL
FT                   SDDSITKTARRQQIIDGLHDIPAQIRKVLAMDKVLQQMAKDMLSKEKSLLIMGRGYQYA
FT                   TCLEGALKIKEVSYMHSEGILAGELKHGPLALVDEHLPVIFIMTRDSLYPKVQSALAQV
FT                   TARKGRPIIICNEDDDTVNDNAKVIRVPQTVDCLQGLINVIPLQLLSYHLAVMNGVDVD
FT                   FPRNLAKSVTTE"
FT   CDS_pept        join(786089..786095,786146..786253,786318..786763,
FT                   786815..786968,787021..788028,788074..788135,
FT                   788191..788332,788386..788508,788556..788626)
FT                   /codon_start=1
FT                   /locus_tag="CND02900"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing), putative"
FT                   /db_xref="GOA:Q5KII0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KII0"
FT                   /protein_id="ALO60523.1"
FT                   /translation="MCGIFSYCSFLCERNRKYVCDVLCNGLARLEYRGYDSAGIGIDGD
FT                   SKGSSMILFKEVGKVAALRKHIDEGIPCPLPGQAPSKEKVDMSKVFLSQTSMAHTRWAT
FT                   HGVPSPGNCHPHVSDVQTEFSLVHNGIITNYKELKLVLLKRGYTFHSDTDTEVVAVLCK
FT                   YVWDSQPNKRLNFTELIKTVVKELEGSFAFVFKSTHFPDEIVAARRGSPLLIGVKTDRK
FT                   LKVDFVDVELPTAEERVNDVDASGLLAVPAAVAEGPGPKLRRSQSRAFLSEDGMPQPIE
FT                   FFVASDASAVIEHTKRVLYLEDDDIAHIAEGELHIHRLRRDDTVSSVRAIEHLEIELAA
FT                   IMKGQYDHFMQKEIYEQPESVVNTMRGRVNFDTRSIMLGGLKAYLPVIRRGRRLIFVAC
FT                   GTSYHSCIAVRPVFEELTDIPVAVELASDFLDRRTPVFRDDVAIFVSQSGETADTILAM
FT                   RYCLERGALCLGVVNAVGSTLSRETHSGVHINAGPEIGVASTKAYTSQYVALVMIAVQL
FT                   SDDSITKTARRQQIIDGLHDIPAQIRKVLAMDKVLQQMAKDMLSKEKSLLIMGRGYQYA
FT                   TCLEGALKIKEVSYMHSEGILAGELKHGPLALVDEHLPVIFIMTRDSLYPKVQSALAQV
FT                   TARKGRPIIICNEDDDTVNDNAKVIRVPQTVDCLQGLINVIPLQLLSYHLAVMNGVDVD
FT                   FPRNLAKSVTTE"
FT   gene            complement(788856..791315)
FT                   /locus_tag="CND02910"
FT   mRNA            complement(join(788856..789160,789218..789274,
FT                   789331..789509,789570..790200,790250..790333,
FT                   790389..790501,790565..790622,790687..790815,
FT                   790871..791086,791150..791315))
FT                   /locus_tag="CND02910"
FT                   /product="D-erythro-sphingosine kinase, putative"
FT   CDS_pept        complement(join(789036..789160,789218..789274,
FT                   789331..789509,789570..790200,790250..790333,
FT                   790389..790501,790565..790622,790687..790815,
FT                   790871..791086,791150..791258))
FT                   /codon_start=1
FT                   /locus_tag="CND02910"
FT                   /product="D-erythro-sphingosine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42898"
FT                   /db_xref="GOA:Q5KIH9"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH9"
FT                   /protein_id="AAW42898.1"
FT                   /translation="MRPPHHLPVILHNNNRGLLIIQPSTLDVLQLSGDGPPPKRLLTCP
FT                   LTNFLKAYLAPAPENSARRLDLHCLGGGMGTQLKLVKLHVLVEPINIPETNEWIRMLME
FT                   AAYGSIKPFRNVLILVNPVGGKGKAKDIVQDTVIPILEAAGTTVTVKETTHRLHAEEIA
FT                   SSMDLIYDVIVTASGDGLVYEVVNGLASRSDARKALLTPIAPIPTGSANAVCTNLFGVK
FT                   DTFNIPLAVLNIIKGCNLPIDLCSVLILPSMTRRFAFLSQAIGLMVDLDIGTENLRWMG
FT                   DTRFLVGFLKGIANNKGARCRLRLKVVEDDKQNMAKKAKERTQQGTTEGAVTPLINGTR
FT                   NMSVDGETPVSTNDNIIGEHEPSAVIGEPISSASHTPPKPANANYVPDHGPIPDALPLK
FT                   HDETWLTIESLPKKSSIKPKKSIQSLKALRKASAQNKWVDGQEILYFYAGMMRWVARDL
FT                   MQWPVSIPGDGLIDVVVQSVVPRLTMANAIAGAEKGETYWMDCQYYYKVSQFIAENLDT
FT                   ENQPLFTIDGEAFPFESFHVEVHTRVANLLSLNGDFFTSDFLKKPTGKS"
FT   gene            791457..792575
FT                   /locus_tag="CND02920"
FT   mRNA            791457..792575
FT                   /locus_tag="CND02920"
FT                   /product="hypothetical protein"
FT   CDS_pept        791460..792431
FT                   /codon_start=1
FT                   /locus_tag="CND02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42896"
FT                   /db_xref="GOA:Q5KIH8"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH8"
FT                   /protein_id="AAW42896.2"
FT                   /translation="MKAPLRNPPRLLAGEGRVHLSASNAHPSFSTRLAAYPLKLLSPIP
FT                   LPSQPSNFAVLYTLAYGGGLVAGDLVSLSVVLDPGCGLVMLTQGTTKVYKRRPGLRPLS
FT                   HLHTSPPSSDPNLTRQRMHIRLSSSSFLLLLPESVSPFRASIYSQTQRFVLPADRTASV
FT                   LILDWVNSGRGQRPQEVDEEIWSMDSYGSTNEIWVGDERIMRERMVLDNSHFALNAGGS
FT                   LSPIANQLSPYNVYATILILGPHFTTLFSYLAYLSDHSRQFQLKEPPGLAWSFSEIDGK
FT                   LQAGVVRIAACEVEDARKWLREVMTAGGVAALVGEGMWPRCI"
FT   gene            complement(792548..797263)
FT                   /locus_tag="CND02930"
FT   mRNA            complement(join(792548..792854,792913..793168,
FT                   793220..793522,793572..793819,793866..794646,
FT                   794698..794899,794971..795107,795160..795259,
FT                   795315..795632,795687..795973,796027..796283,
FT                   796334..796451,796505..796683,796736..796858,
FT                   796907..796965,797021..797063,797119..797143,
FT                   797194..797263))
FT                   /locus_tag="CND02930"
FT                   /product="chromosome associated protein, putative"
FT   CDS_pept        complement(join(792667..792854,792913..793168,
FT                   793220..793522,793572..793819,793866..794646,
FT                   794698..794899,794971..795107,795160..795259,
FT                   795315..795632,795687..795973,796027..796283,
FT                   796334..796451,796505..796683,796736..796858,
FT                   796907..796965,797021..797063,797119..797143,
FT                   797194..797196))
FT                   /codon_start=1
FT                   /locus_tag="CND02930"
FT                   /product="chromosome associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42894"
FT                   /db_xref="GOA:Q5KIH7"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041741"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH7"
FT                   /protein_id="AAW42894.1"
FT                   /translation="MYIKTITIQGFKSYRDQVAVDPFSPGHNVVVGRNGSGKSNFFSAI
FT                   RFVLSDQYTKLSREERQRLLHEGTSTSTTLSAYVEIVFDNSDGRFPTGRQELVLRRTIG
FT                   LKKDEYSLDRKSASKSEVDQLLESAGFSKANPYYIVPQGRITHLTNMNDRERLRLLKDV
FT                   AGTEVYEQKRAESTRIMEETDGKRDKILELLTTIEDRLRELEEEKEELKEYQEKDRERR
FT                   CLEYALHQRELEDVTNALDEIEAERRQDIHNSNEKRKEFNDREDEIQRYEEALTAAKHS
FT                   LSTTQASLRQYETERADLVRNKTELECVIADFETAGQVGEHRRAELAEELEVMQQKVDE
FT                   ATARLEDLVQEAEQRIGEEKAAREALEPTQSKLSVLFAKQGRAQQFATQAARDKYLKDE
FT                   IKALKEHEKNQGKRVEILQKEVAGAKEQLAQLSAKSEQQVQGENDRRENLKKMNEEIAQ
FT                   LQRNIAGMHEQKKELWREEGKLAQTEVNAKSEMEAAERSLMGMMNKDTSNGLRAVRQIA
FT                   KRLNLDGVFGPLYDLFEVSDKYKTAVEVTSGNSLFHVVVDNDETASKLLDVMNREKSGR
FT                   VTFMPLNRLKSHSVNYPKANDAIPMIQKLQFDREYVMAFEQVFGRTIICEDLQTAAHYT
FT                   RSHGLNAVTIEGDRVDRKGALTGGYHDVRRSRLDAVKAAKKWRTAYETDHARHAEVKAA
FT                   LQNIEQEVTRTMGQVQALEAKKRHMSDGGEGSFKLLTLPARDLDQARDRVARLEFSLEE
FT                   AEGASRDAKAKRASYEEELRTPMRQNLTDEELRELETLTQNAEAQKKLLFEATQNRAKA
FT                   VGERNRLEIELSENLRRKRQELRGKLDRLEGEAGNGELQSGEVELRRSELRNLVRDIEQ
FT                   LEEKVSESEGRVGELNSEISKISENLERVQTQQMENTRAIMRVQKNAERYLTKRQTLIN
FT                   RKEECNNAIRDLGVLPEEAFSKYIDQRSDKIIKRLHKVNDGLKKFAHVNKKAFEQYSNF
FT                   TKQRDELMDRRDELDQSAIKIEELIETLDQRKDEAIERTFKQVSKYFEEVFETLVPLGK
FT                   GELIMQKKTDGFIEEESEESLEQGREKSDIDSYTGVSIRVSFNSKHDEGQRIQQLSGGQ
FT                   KSLVALALVFAIQKCDPAPFYLFDEIDANLDAQYRTAVATMIHTLSTSAQFITTTFKSE
FT                   MLAQADKFYGVFFDKQKVSTIKVIEKEEASDFVETAAQVGQL"
FT   gene            797479..799761
FT                   /locus_tag="CND02940"
FT   mRNA            join(797479..797626,797674..797753,797807..798419,
FT                   798470..799225,799312..799761)
FT                   /locus_tag="CND02940"
FT                   /product="centromere/microtubule binding protein cbf5,
FT                   putative"
FT   CDS_pept        join(797524..797626,797674..797753,797807..798419,
FT                   798470..799185)
FT                   /codon_start=1
FT                   /locus_tag="CND02940"
FT                   /product="centromere/microtubule binding protein cbf5,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42892"
FT                   /db_xref="GOA:Q5KIH6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH6"
FT                   /protein_id="AAW42892.1"
FT                   /translation="MAVASSSTLTDSQVSKIQQDSDFSIKSESVTPKLDTSQWPLLLKN
FT                   YDKLLVRSSHFTPIPSGISPLKRDLQTYVKSGVINLDKPSNPSSHEVVAWLKRILRVEK
FT                   TGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVVRFHDKLQDEKALPRALETL
FT                   TGALFQRPPLISAVKRQLRVRTIYESKLIEYDNERNLGVFWVSCEAGTYIRTLCVHLGL
FT                   LLGVGAHMQELRRVRSGITGENDDIVSMHDVLDAQWLYDNTRDESYLRRVIRPLESLLV
FT                   NYKRIVVKDSAVNAICYGAKLMIPGLLRYEADIEVNEEVVLMTTKGEAIAIGIAQMSTV
FT                   DLASCDHGVVAKVKRCIMNRDLYPRKWGLGPKAQEKKKMIKKGELDKYGKPIEGVTPQQ
FT                   WSSGYIDYNDPDAVPASGSNDLLPTQPPTAEDVKMEPVEVKVEADEKKRKREEEEVGSP
FT                   KAEEKKKKKKVKTEDGAEREETAEERAARKAAKKEKKEKKKAKEE"
FT   gene            complement(799236..801133)
FT                   /locus_tag="CND02950"
FT   mRNA            complement(join(799236..799502,799561..799743,
FT                   799796..800039,800090..800176,800231..800989,
FT                   801047..801133))
FT                   /locus_tag="CND02950"
FT                   /product="aminopeptidase, putative"
FT   CDS_pept        complement(join(799308..799502,799561..799743,
FT                   799796..800039,800090..800176,800231..800989,
FT                   801047..801087))
FT                   /codon_start=1
FT                   /locus_tag="CND02950"
FT                   /product="aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND02950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43153"
FT                   /db_xref="GOA:Q5KIH5"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH5"
FT                   /protein_id="AAW43153.1"
FT                   /translation="MKASIPPPPKDAVNFCDFVTHAPTPFHAVAHLTTRLFTSGFVPIS
FT                   ERSPTSSLEPGGKYYYTRNQSSLVAFTLPAKPLPETAISFAVGHLDSPCLKVRPVSKKT
FT                   KSNYLQVGVELYGGGIWHSWFDRDLSLAGRVIVANREAHHSEDPKFVSKLVKIDRPILR
FT                   IPTLAIHLDRTANDNFKFNKETEFQPILGLVEDALNATDAGLGMKRSHSGSLHQPLAKK
FT                   DSHETEKSDDLFNVANMEDKHHPKLLAVLADELGCDIADIQDFELSLFDTQPSTIGGLS
FT                   NEFVYSPRIDNLMTSFCTIEALCEAVKTSNAEDESNIRCVILFDNEEVGSVSHHGAESN
FT                   LLPAFVERIVQLKDYKDVGYYAMLANSFLISADMGHAMHPNYESRYEPNLAPKINGGIV
FT                   IKTNANQRYTSNAQTTFLLRRVAKKAGVPVQEFEIRNDSTCGSTVGPHLSTHVRTVDIG
FT                   LAQLSMHSIRETAGSHDVRHYINFFKIFFQGFGEIDRELRIDWH"
FT   gene            801431..802557
FT                   /locus_tag="CND02960"
FT   mRNA            join(801431..801448,801565..801647,801926..801996,
FT                   802049..802139,802190..802557)
FT                   /locus_tag="CND02960"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(801446..801448,801565..801647,801926..801996,
FT                   802049..802139,802190..802373)
FT                   /codon_start=1
FT                   /locus_tag="CND02960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43196"
FT                   /db_xref="GOA:Q5KIH4"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH4"
FT                   /protein_id="AAW43196.1"
FT                   /translation="MGRVRTKTVKRSSRILIERFYPRLTLDFHSNKRILDEVATVPSKR
FT                   LRNKIAGFTTHLMKRIQKGPVRGISFRLQEEERERKDQYVPEVSALASSEESPLEVDAE
FT                   TKDLLKSLGMDDLSVNVINVSANAPRERKTRFIPGAGRA"
FT   gene            complement(802527..803236)
FT                   /locus_tag="CND02970"
FT   mRNA            complement(join(802527..802768,802819..803081,
FT                   803135..803236))
FT                   /locus_tag="CND02970"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(802733..802768,802819..803081,
FT                   803135..803141))
FT                   /codon_start=1
FT                   /locus_tag="CND02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH3"
FT                   /protein_id="AAW43359.1"
FT                   /translation="MPAQQATSTSALPSTSHTAQPVQPSKLAKNPRLPATMVTPSGSIQ
FT                   ASQKNKSHKGQISKKKRAKLEKGKEKAAELSGKLEVKVREREDRKAKRQRAKKAWE"
FT   gene            803396..805737
FT                   /locus_tag="CND02980"
FT   mRNA            join(803396..803546,803630..803795,803844..803999,
FT                   804054..804129,804179..804301,804362..804875,
FT                   804928..805040,805093..805416,805469..805737)
FT                   /locus_tag="CND02980"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(803432..803546,803630..803795,803844..803999,
FT                   804054..804129,804179..804301,804362..804875,
FT                   804928..805040,805093..805416,805469..805702)
FT                   /codon_start=1
FT                   /locus_tag="CND02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43197"
FT                   /db_xref="GOA:Q5KIH2"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH2"
FT                   /protein_id="AAW43197.1"
FT                   /translation="MLIPLIPLLLYVASAVAATTPKCLVSGNQDSINDALALGGEGTTV
FT                   TLCPGSVHRLNSSIIFTAPSQTLTTLGNPKDRNRAMLVVDGEDLACAIKADCKQCSHAM
FT                   IRSLVIDGNRPQLLRIPKGDALIEIGNSESQTVRDCKLYEPRGWSALHFREGDTRQCRF
FT                   GHIMDNEIGPCGEEWDDEYDGMDEIRPPWGNPRADGISLACKDSIVERNVVYDATDGAI
FT                   VLFGSAGSTVRNNHIYARTRVILGGINLVDYEPWDGDYTNVKVHNNHLYALGRYFKVGI
FT                   VIGPASWSDDTESVVHSASVTDNEFSGGYWGYGIVVASAKNFEVLRNKVIWDGEQGVAK
FT                   FSGVPGSRCPKAPENGKPTAFLINRGSAKGTFQDDFINGEVQHIICLNPDQEPPYKPWR
FT                   FRDSPEAIAAREAENPTANTAFDSRIAEALVSYQMSLLNSMDAITQKVEHLTNPIVDDA
FT                   LPFVHEHERAEADQRARQEARRKEKESGNKDVDMLNVKVEELEKGGRRLKKALDGLKSD
FT                   FEGLSGRLKKSADENKPIIETIFVSSQNLLLGATSQQNLINRSLDGAYSTLSFVNALGG
FT                   MAGIVVSIMIARRLRRWWMMRQKTQSNKWS"
FT   gene            complement(805927..810360)
FT                   /locus_tag="CND02990"
FT   mRNA            complement(join(805927..806222,806286..806378,
FT                   806443..806631,806697..807795,807855..809373,
FT                   809423..809606,810240..810360))
FT                   /locus_tag="CND02990"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(806099..806222,806286..806378,
FT                   806443..806631,806697..807795,807855..809373,
FT                   809423..809446))
FT                   /codon_start=1
FT                   /locus_tag="CND02990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND02990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43213"
FT                   /db_xref="GOA:Q5KIH1"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR015350"
FT                   /db_xref="InterPro:IPR015351"
FT                   /db_xref="InterPro:IPR036358"
FT                   /db_xref="InterPro:IPR037095"
FT                   /db_xref="InterPro:IPR040159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH1"
FT                   /protein_id="AAW43213.1"
FT                   /translation="MSYQWNHNYDTSTSHRDQEPVYQDNDKQNVGYAPMQGQGMLDLMG
FT                   IPQPMFFPGIQTEFNNGRAPVSATGGYQNNMPPPQYQFRPALALDTTGGYLAPQPQPSS
FT                   AYSEMPSGLRPDLGSNTDSDLVMPNSYPSAGVQYPPYNSDFMTSLSVNTGMVNPGQTGR
FT                   GIEQPQSMLGTYQSTVMSQYGYYPIPHPEMQQTQQPIEPSVQLGTISPSELGQRQPLKP
FT                   TKSFSDLMMGSRASSSSSLASQDVPPDGWNGNALEDWTRPLSRALPSSGTPVSTSAGSR
FT                   QLPSAADISSLPDLTKRPSFASSPLRNPSFSPLSPNASDTDSIIKQYIRAPNRLAFGER
FT                   RIIVMSPKVGQKSYGTEKRFLVPHPQAILIGSGWWAKSPDGCPVSPLQPPRINISLTGE
FT                   QAVKDSIISWTDLNGKNMDEKASTQGVKIDDQPFTGSVAGKNLHISDNDPKRKEVKALV
FT                   TVKAPLNKHAGPNGWGSAKGTLSDVTNDNVFGIFESKDIKIISKPSKKRSTAKSGELTI
FT                   SHGTTVALFNRIKSQTTSTRYLSVVPDFTRTLGSDGRPVTGAKAPQYENDKGALRGFTA
FT                   DASFWESFIIWLVDPSLPSGPSNHQAPNPDWPRPPANIIPLNTISHSIRYNSTVVLQSL
FT                   RTGVISPTLVVRRIETDSDAVGMDGHVHEVPAMPPGELASDLVSQLQKVAFEIYSPDTM
FT                   NRLQRESKYGGSWLSCYQDEVREHAIKAERKWAVLQAPAGSKPTSRPNSLPNTPQQRFG
FT                   VLPMTPHTNNMNLPSTPSSPVSSSSSLDYFNYQSQRSSGHNHSLMSPGSVETALPSTDG
FT                   GPIRRQRTSSMGKGPLSRPLHRKRLSTDSTGSNSYEYMPSLSSAMSSAEQPIQPQRMFW
FT                   TMDVGDSCVWSIISVEQASYTFFTPPITSFEEFEPVAPFPVANRLLPANLSAEVPSKYA
FT                   HHYTTTTNMPLVTLYGKHFVKNVDGRAKHVMYYGDEPARHNEVRCGEVMVASEPEPSIK
FT                   SDRKRPIFLVREDGKVIIPTSLHYPV"
FT   gene            complement(810559..815132)
FT                   /locus_tag="CND03000"
FT   mRNA            complement(join(810559..810749,810804..810973,
FT                   811034..811177,811233..811306,811360..811444,
FT                   811508..811584,811639..811919,811979..812329,
FT                   812393..812463,812514..814657,814753..815132))
FT                   /locus_tag="CND03000"
FT                   /product="conjugation with cellular fusion-related protein,
FT                   putative"
FT   CDS_pept        complement(join(810668..810749,810804..810973,
FT                   811034..811177,811233..811306,811360..811444,
FT                   811508..811584,811639..811919,811979..812329,
FT                   812393..812463,812514..814487))
FT                   /codon_start=1
FT                   /locus_tag="CND03000"
FT                   /product="conjugation with cellular fusion-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42889"
FT                   /db_xref="GOA:Q5KIH0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIH0"
FT                   /protein_id="AAW42889.2"
FT                   /translation="MSIPDNPFQPPTDTSPPTLQLEATSHDDGQSIKSGINGSPMPAGS
FT                   PHSHLSPPSEIASPRPVLSNLQHLGPGVKTPRRVQWTSDPHIVQLQPVEPAPGSPQTLD
FT                   PSNIDEFRDALERHRSGGAGRRPPSQLSRQSSASGSVTRHGTDDEEDYDYRTDVDPPQR
FT                   PDIERHDTDETMYESNLIDNGMRGHVSQYIAPGETDGLPNIPQMSRENQNDTAKDLVRA
FT                   HTGKWGVLRRRVRGAGAVKGALNAAAPNRKRGDDGEEEEKRRSGEHDRASQDAFAARYP
FT                   EPRKGPSAGGFGGGAVPGGASVLSSLLALYGQQNDQHSANTSAASSRRGSEDEYSSGDE
FT                   RSAAKGGRHAWRHLGRRSADEGLPAFAVHDQPRPSNVQPPRVSQGSLDPNDPTSPTSPG
FT                   FGPDSGQDHEYSRTQSRYDDTPGSPGFKGFFQRAKEQLQYNRPDAARNAGGVFGALIQN
FT                   TQNLSGAATPAASTLAPAARRPGYQLNRYSLGDVNDETRKGPWRPPSRPSSGAGSRSGS
FT                   RPASIHSSTAVSGNGESPKDDSGNSFGGKKAISSDDLMSMRKANESTLSLGGKKRPKTG
FT                   LHLESLAHLPVAAVKGGGKQIKNAEKWLLGGKTPLGSTPPEKGGADYFHRPLTEDERRR
FT                   KEWEAEKKKRKKAREARKKQEIFIIQHVAAILSRQQFLLKLARALMMFGSPSHRLETQI
FT                   QATAKVLEINCQVVYLPGTMLVSFGDDATHTSETKFLKQSTGLDLGKLQATHHLYWNVV
FT                   HDKMSVDQASKDLDVLMTTPVYYTWWQTLAIGALCSAFISVMAFYGSFIDALMSMVLGA
FT                   TLVGVQMLAARNDMFSNVFEIAIATLISFVAAALASTKVFCYTALVSGGVVLILPGYIV
FT                   LSGALELASRNITAGAVRIGYSVIYSLFLGFGISMGAVIYSKITKHDVLNSNDYTCGNT
FT                   HYSGSPWYMETPSAWWYFLCAPGFSLGLSLKNQQPLWAKELPVMVIISCAGWTSNHFSA
FT                   LAFPGRSDLTSAIGSFVVGTLGNIYGRFSNGSSFPVTVPGILIQLPSGLSNGGIFNFAT
FT                   ESSSGSSTAYSDGFSVAEQLVAVAIGLTVGLFVSAAVCHPFGGGRRRGAGIFAF"
FT   gene            816708..817990
FT                   /locus_tag="CND03010"
FT   mRNA            join(816708..816889,816951..816998,817052..817095,
FT                   817165..817271,817376..817447,817505..817586,
FT                   817648..817990)
FT                   /locus_tag="CND03010"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(816868..816889,816951..816998,817052..817095,
FT                   817165..817271,817376..817447,817505..817586,
FT                   817648..817689)
FT                   /codon_start=1
FT                   /locus_tag="CND03010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42887"
FT                   /db_xref="GOA:Q5KIG9"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG9"
FT                   /protein_id="AAW42887.1"
FT                   /translation="MWLSDGQKIGIALVAFGIFFQFLGIILFFDGPFLALGNILFLSGL
FT                   PLIIGLTKTFYFFSRREKWRGTLCFFGGIILVFAKRPIIGIIIEFVGFIGLFGSFFPVI
FT                   LQALRQTPFIGPILSLPYIRGAADRLAGVRQSAV"
FT   gene            complement(817838..818910)
FT                   /locus_tag="CND03015"
FT   mRNA            complement(join(817838..818679,818813..818910))
FT                   /locus_tag="CND03015"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(818128..818679,818813..818896))
FT                   /codon_start=1
FT                   /locus_tag="CND03015"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LJ32"
FT                   /protein_id="ALO60524.1"
FT                   /translation="MASIEDLIATISGGLHAGQQGNDIRDLHAKLAQTINNPLPPPVHR
FT                   PIPPCTTTSVSAAGMPPPAPASSWNTPPPNAGFLFSTSPISKINGAGPSAGGVSGGGGG
FT                   SAGGDFEVAHHVHEGWSVPMPNMGTSFTGRPIQPIVPNSNQQREEGQWRQRNQGFTGDE
FT                   PEERPYHASVLPIKASPKDTGGFAEDAFKPLWEDQGKDQWQGFNRQNR"
FT   gene            complement(819090..820665)
FT                   /locus_tag="CND03020"
FT   mRNA            complement(join(819090..819413,819487..819849,
FT                   819906..820116,820173..820665))
FT                   /locus_tag="CND03020"
FT                   /product="3-keto sterol reductase, putative"
FT   CDS_pept        complement(join(819135..819413,819487..819849,
FT                   819906..820116,820173..820636))
FT                   /codon_start=1
FT                   /locus_tag="CND03020"
FT                   /product="3-keto sterol reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43211"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG8"
FT                   /protein_id="AAW43211.2"
FT                   /translation="MRRTPSSQPDHDPHRVIALVTGANSGYGLGICHQLLSNLSLPSTV
FT                   PIPASTPQPTALAPSMRDSIPSNSLRPTKTSVPDTTLTLILACRSGAKAQEAIDMLWKK
FT                   HKSDLEKRKKKGLAVKKGWLEGLRIVWEGVNLDSPGGTNGILAFTERVKNRYPHITCLF
FT                   LNAGMGAFSGIDYCKFTKQIFTDGMSVALSQPQFNIEIKGAKSADGERGLVWGTNVLAP
FT                   YIMARELLPMLRRSPPELPFAPRVVYTSSGTATLSKLNNHPLDDYMLLDYDESYGASKY
FT                   MGDMVMLQLDREFNDETTKRDDDRGVRVLTIEPGCVATNFFNAGLGAWAWWIKFKWFWY
FT                   WLSFYICRLLGSPYHPVYADQGALPMLYAALIPAAFLLSPSQVPAQKFEVRAQRWGNTK
FT                   VGYGEIDRWEEADALGLPKGFADRCEVVRREWRRREGLE"
FT   gene            820791..822521
FT                   /locus_tag="CND03025"
FT   mRNA            join(820791..821948,822001..822232,822284..822521)
FT                   /locus_tag="CND03025"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(820827..821948,822001..822232,822284..822417)
FT                   /codon_start=1
FT                   /locus_tag="CND03025"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LIT1"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIT1"
FT                   /protein_id="ALO60525.1"
FT                   /translation="MNTLSRIDSYFSAIASPPTSHPPRTPPRRPRQTISSISVPPPTAP
FT                   LILRIALVLWSILLTVWRSFVGETRATRRRGRRSRRKRLTGLRELGERVMITAGIASLD
FT                   TPHEHTEGDEGSEDDKEDGWVDPVTRGPEGSASLEEAPPGEDEFVSATTAATGTGAAEV
FT                   EEEPEPDETTVAAKDDRLGGPDPNFTFRLRSAPKKELDGTETAVPSPGHKPIPSFQRPP
FT                   SPTSILNNPITPPPPPPKTAEPSPKRPSGTRLLANPISTSLLDPSVPAPASNADSSLFR
FT                   KPSPRPLRQPTTPFHLQKTLILDLDETLIHSTSRPIHYPGGSSGGGGLLGLSVGGVFGS
FT                   GRANEGHTVEVVVNGRSTMYHVYKRPYVDHFLKKVASWYTLVIFTASMPEYADPVIDWL
FT                   DGGRNLFARKLYRENCHVQPNGSYIKDLTLVEKDLSRVCFMDNSPVSYSWNKANALPIE
FT                   GWTSDPNDEALLHSIPVLDSLRFVNDVRRVLGIRGFS"
FT   gene            822612..825109
FT                   /locus_tag="CND03030"
FT   mRNA            join(822612..823316,823375..825109)
FT                   /locus_tag="CND03030"
FT                   /product="nuclear envelope-endoplasmic reticulum network
FT                   protein, putative"
FT   CDS_pept        join(822849..823316,823375..825012)
FT                   /codon_start=1
FT                   /locus_tag="CND03030"
FT                   /product="nuclear envelope-endoplasmic reticulum network
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43198"
FT                   /db_xref="GOA:Q5KIG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG7"
FT                   /protein_id="AAW43198.2"
FT                   /translation="MSPQEAADYVDRRRERLLLQQARAIDGLPGVVAEERLETVDEKKV
FT                   LRPFHPVLHNIPAAGPSQPEKRSTVTGPEHVAAPVAEAAAEPSVKHQREQVAGKSEPGL
FT                   AVSGKAKALSPAVTPSSSQAASSSKMDDLIEIMTEGAAAAAQKKGGAEKDETVFNEEGL
FT                   PFHEIRETLNGETIGSLPPPAAADLNADMEVLPKDEKDDYWSEDAVARRAALRKKIFHE
FT                   GEESDDEESIEQIQQQPQVPDSSLPSSPPSPKAELHLHSILRHHAPSSQQPKSILKPPI
FT                   RKKSVTFDPSIPPASPDSSDIAPSSIKPHKFGFPLPLATDDDQAWAPKPVPTISEPKPK
FT                   AKKDDGFAGFKKGFLGPPPKVLTAENAQPSFSSPPHPTAISEQGPPSESAQEAFKPKKK
FT                   SLFAQRLAHSEIDASAPATSSGTPATASPRGVNLPKMAESKGTSAIKGAVVEKSATMTP
FT                   ATNPSSSHAEVPDTERTDDDNGDDSFAEYSSGSEDEYDLDDALLAREVALEYHRRHAYT
FT                   SLNRDPRDAPYEEDDNGNGAGVMLGLPRISDLQGQDGRPVITNPTPDDLRRFIRVGRLE
FT                   NGNLVLAPGQEGLSDSEGDGEEGKEGEDDDEEVKEKKERRLEVKKRREQVRNRLLGLPV
FT                   EEGDLEPERKRDSVDDESLKATIPPAIQTEVAERHAQIDTSAESEETPVPKKKVSRFKA
FT                   ARLAGAQ"
FT   gene            complement(825074..826489)
FT                   /locus_tag="CND03040"
FT   mRNA            complement(join(825074..825264,825324..825872,
FT                   825922..826048,826116..826223,826282..826353,
FT                   826413..826489))
FT                   /locus_tag="CND03040"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(825131..825264,825324..825872,
FT                   825922..826048,826116..826223,826282..826353,
FT                   826413..826475))
FT                   /codon_start=1
FT                   /locus_tag="CND03040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43210"
FT                   /db_xref="GOA:Q5KIG6"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR033901"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG6"
FT                   /protein_id="AAW43210.1"
FT                   /translation="MPSSLDNTRRHVQVFAERVGAVAGSEFPGHYPGEDHSWNLQKFKQ
FT                   DLVASVQRLTPSTIEFDLVGVDASIANALRRTLIAEVPTVAIEEVYVWNNTSIMQDEVL
FT                   CHRVGLVPLKIDPRSLRYRPSANSQPHEHDTVVFDLRVRCDRRPNVDRSETDPKKMYFD
FT                   SNVYSGMLKWVPSGDQKKKFKGKAPRPVNDDILLVKLRPGQQVDLHCFARKGVGADHAK
FT                   FSPVATASYRLLPHIILRGPIPKEHQQKFKGCFPPGVIEIEKDENGEDQCVVKNPRKDT
FT                   VSREVLRHPEFQDLVQLARIRDHFIFNVESAGQYSPEELVPEAIKILLGKIKDVEEGLD
FT                   KLFATEGQAA"
FT   gene            826770..829201
FT                   /locus_tag="CND03050"
FT   mRNA            join(826770..827096,827161..827363,827417..827801,
FT                   827860..828021,828080..828188,828245..828327,
FT                   828378..828604,828671..828804,828854..829006,
FT                   829049..829201)
FT                   /locus_tag="CND03050"
FT                   /product="expressed protein"
FT   CDS_pept        join(826792..827096,827161..827363,827417..827801,
FT                   827860..828021,828080..828188,828245..828327,
FT                   828378..828604,828671..828804,828854..829006,
FT                   829049..829114)
FT                   /codon_start=1
FT                   /locus_tag="CND03050"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43199"
FT                   /db_xref="GOA:Q5KIG5"
FT                   /db_xref="InterPro:IPR026749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG5"
FT                   /protein_id="AAW43199.1"
FT                   /translation="MSPTSPQPPHSPTTPPSPSASPTHSILRRTASLSAPSHPHKKMLR
FT                   FTQLHRDSDTLLSSVGQNEDVYYHGRTMEEGLYTDRVTTDQRRYLQSDPGTPNFQETAD
FT                   QIRRTLSLASVDSLLLLSANQSERTKFLAEVSRAGRGLVWRDEGEQCLLPQDNERAVVL
FT                   ALKRGLRSFILAFSVRSGINVLLLLFRLLRKHAPKLSLPLLHRTIFGPEPFRFGGMIGT
FT                   FTFLYTFTLHLLRLAPPLSYFRRRIRAGLWNKTTFGPPEREGNEGERRWQAAAAGAVGS
FT                   LGLLWESKSRRTGVAQQMFVRGLQASYNQYTPRFGIHIPHGDLLLFGACCGQIMFAFLM
FT                   SPETIPKEYNNWINSASRVPSFAILANRTQVRQGYIQDALVQEALNYKGITATNRIRLE
FT                   NVLRKIRDGQQPVAVPCGMVHPWCNTCTETNFRRFFAVCRFMLPVYSALHLIPMLVLRR
FT                   HHVKRDPIRMMARALWGIGRSCSFLGAFVVIYQVLFCARVQALEKSRGPDFMRSLLKRK
FT                   EVFWALGFTTCLSLLVEEKKRRAEIAMYVLPRALESAWSGARKRAWVPLVPFGETILGA
FT                   GAMAMVMDAYKHQPDAMSGIVRRLLFQMVGPA"
FT   gene            complement(829169..829932)
FT                   /locus_tag="CND03060"
FT   mRNA            complement(join(829169..829298,829357..829535,
FT                   829590..829824,829877..829932))
FT                   /locus_tag="CND03060"
FT                   /product="ribosomal chaperone, putative"
FT   CDS_pept        complement(join(829253..829298,829357..829535,
FT                   829590..829824,829877..829896))
FT                   /codon_start=1
FT                   /locus_tag="CND03060"
FT                   /product="ribosomal chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42885"
FT                   /db_xref="GOA:Q5KIG4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG4"
FT                   /protein_id="AAW42885.1"
FT                   /translation="MQIFVKTLPGKTLARDVLPTSTVSSVKEMIASAEGIPASEQRLIF
FT                   AGVQMDDERALAEYGIQKESTINMVMSLCGGGKKRKKKNYTTPKKIKHKRKKVKMAILK
FT                   YYKVGSDGKIQRLRRECPAPTCGAGIFMAWHKDRQACGKCGLTYTFEPGTKPTTA"
FT   gene            830137..831868
FT                   /locus_tag="CND03070"
FT   mRNA            join(830137..831118,831176..831354,831409..831868)
FT                   /locus_tag="CND03070"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(830250..831118,831176..831354,831409..831458)
FT                   /codon_start=1
FT                   /locus_tag="CND03070"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42883"
FT                   /db_xref="GOA:Q5KIG3"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG3"
FT                   /protein_id="AAW42883.1"
FT                   /translation="MADSSPADNLSPKAVQEQLPSPDAHGAEHQLSLRSLVSTKEAGII
FT                   IGKSGATIATIRDSTGVKAGVSKVVQGVQDRVLSVTGDLEGVASAYAEVARLLLETPLS
FT                   DSSLPPPPVGSFTSIRLLISHNLMGTVIGRSGLKIKQIQDMSGARMVASKEMLPQSTER
FT                   VVEVQGSVDAIKTAVLEIGKCLLEDWDRGAGTVLYHPGAAGDAGVLAGGLGAQAVTGST
FT                   GGIRRTSVAAGFGGYSGDRRPSRGGSISGPSGVSGERRPSEGPQVNLNDPNLRTQNISI
FT                   PSDMVGCIIGRGGSKITEIRRLSGSRISIAKVPHDETGERMFTIQGTPEATERALMLLY
FT                   SQLESEKERRVNGSNSEVPASADFA"
FT   gene            complement(833160..835667)
FT                   /locus_tag="CND03080"
FT   mRNA            complement(join(833160..834396,834462..834623,
FT                   834673..834765,834817..834877,834924..834975,
FT                   835026..835072,835132..835292,835348..835433,
FT                   835495..835527,835577..835667))
FT                   /locus_tag="CND03080"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(833280..834396,834462..834623,
FT                   834673..834765,834817..834877,834924..834975,
FT                   835026..835072,835132..835292,835348..835433,
FT                   835495..835527,835577..835600))
FT                   /codon_start=1
FT                   /locus_tag="CND03080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42881"
FT                   /db_xref="GOA:Q5KIG2"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG2"
FT                   /protein_id="AAW42881.1"
FT                   /translation="MQRRALKQLNKVTQWTSEKVFSGEKTQLSSDFLEFEKEIEIRRIG
FT                   IERLHATSLPFYEQLAKVKSTADPYPPPGSGKDKISYTEALGLVMIDYGDEIGDDYGDA
FT                   LSKYGRARCRLASAQEEFASRLGDSYIAGMESGLAAVNEYKSLRKKLDSRRLALDAAIS
FT                   KSQNSKKDTGVLEEEVSIARIRFEEIEEETHSRMVNIQEAEDEQYALLTDLLEAEVDYH
FT                   NKCKEILEDLRNSWGTHSSRKPLNTRARSSTVTSSRSLGRTVISRSHSSKHNAVPSSED
FT                   DAPSSRSRSQSNASSSGKSKDKRSMIPSLGSFGRKSGLSTVTSSKKKEKREKYSESRTA
FT                   LHSEEEDEDEGLRWPAPTDRSQSQLSSSVTSYKSSRYDPPPSLRRTVTSPPTPAARYPD
FT                   PNGRYVKALYDYQANASDELSLRVGMVVKVQTQVNDDWWIGEGEIEGEFGLFPRGYTEE
FT                   YIPSPRAAVPFVPSLPTRRNVPPPVGQPTTATRLPPSPNLSLNSDFSESDNGFYDGDNN
FT                   FTASLAASPQPTATRLAASGKKMPPAPPASRRAASSSNILDLSRDMSDSHLSPPIIPYG
FT                   RARSGTTGTVRGSSHEASPFGGSEDDETDDIRRGY"
FT   gene            835930..838224
FT                   /locus_tag="CND03090"
FT   mRNA            join(835930..836327,836374..836580,836630..836790,
FT                   836842..836878,836929..837299,837353..837521,
FT                   837573..837784,837851..838224)
FT                   /locus_tag="CND03090"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(836051..836327,836374..836580,836630..836790,
FT                   836842..836878,836929..837299,837353..837521,
FT                   837573..837784,837851..837985)
FT                   /codon_start=1
FT                   /locus_tag="CND03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42879"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIG1"
FT                   /protein_id="AAW42879.1"
FT                   /translation="MTSPRSLPFRLQPPQEPGHIHDCAIMDSPVPESPTARKNKDLSYL
FT                   IISGGTGANSIAGAFGRSPSFVLPVSDDGGSSSEILRCFGGPSIGDIRSRLIRLIPVVR
FT                   HPVTKEDKERAAIYQLMAYRFPSDAAEKVVRDMWMDIVEGKSHLWSGIGEDKKECIRAF
FT                   FVHFETQCLKRAHKRFSFRNFSLGNGFLTGARDLFGSLPSAIFLFKSIAGVEHGAQVIP
FT                   VINTNQTVTIAAQLANSTTLVGQCAISHPRPSASQDSSMSTPLHGLSSATLPSIHPFLR
FT                   IHFRRDSRTFDTPDESAPPTRSHSSDRLEATTSGAEGHDGEGNLAYRKGEDEAPLEAKI
FT                   ERIFYINLYGQEIYPEPNTDYINAIQNRDILVYSCGSLWTSIVPCLALKGLAEQIARSQ
FT                   TLKAKVLLLNSSNDRETTGYAASEYVATILAMLRHYDKPKRNRTREQLLPGPEWKAANL
FT                   ISHVVWLEGAKIEIDEDQILESGVKMVCVPASVHGAQHGEIPLFSNEAVEWAMERVLED
FT                   VNHNA"
FT   gene            complement(837943..839622)
FT                   /locus_tag="CND03100"
FT   mRNA            complement(join(837943..838896,838947..839102,
FT                   839159..839622))
FT                   /locus_tag="CND03100"
FT                   /product="adenyl-nucleotide exchange factor, putative"
FT   CDS_pept        complement(join(838297..838896,838947..839102,
FT                   839159..839542))
FT                   /codon_start=1
FT                   /locus_tag="CND03100"
FT                   /product="adenyl-nucleotide exchange factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43373"
FT                   /db_xref="GOA:P0CN68"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013918"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN68"
FT                   /protein_id="AAW43373.1"
FT                   /translation="MPDINELLRWSIANSTAPDTDASEQLQIRFNPNSTQSGTSTLHAS
FT                   DSGPPDISPASTPGPVTPDDGSSLPLPPGTEVPVTKKEDLTTEMLDLILGKGDSITMKE
FT                   KMAFATDENNSVEDRVEALDDFEMLIELIDNANNMPILKLWDPLLTLLSSSHPEIVAHT
FT                   CWIIGTAIQNNIKAQAAFYIHETFSRILEIIYPPSSISSYPPSVRAKATYALSAALKHW
FT                   PLASYALYTATSSAENGYSVLRRGVNDPQAIVRRKMAFLVGTLAMQSGERYEGEIPSEV
FT                   RNYIEENEKNAPSESLVEGLKREGVFTALVDGLKQGVDDVEYEENAMRALVRAHQKGGL
FT                   TVSEKSDLKTIWEKWGKQGRQERGLDGEDGKEVSETLSS"
FT   gene            complement(839737..842769)
FT                   /locus_tag="CND03110"
FT   mRNA            complement(join(839737..840755,840805..840857,
FT                   840908..840999,841061..841473,841529..841776,
FT                   841831..842022,842079..842195,842252..842769))
FT                   /locus_tag="CND03110"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(839932..840755,840805..840857,
FT                   840908..840999,841061..841473,841529..841776,
FT                   841831..842022,842079..842195,842252..842589))
FT                   /codon_start=1
FT                   /locus_tag="CND03110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42878"
FT                   /db_xref="InterPro:IPR011205"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF9"
FT                   /protein_id="AAW42878.2"
FT                   /translation="MLAESEVPQLSKWALPSAFLGLLDLPPGQAIDQLIPTRSQPPFTQ
FT                   SAEVPGTSSHPFIEALKNIPDTLTEKGALAHKTTDSPLVDLFFDLAPGIASDRLYKLLE
FT                   AAWTEDSLATLKIIFHSRSIHEGKGYKDGFYRALAWLWDEHPRTFIENLHLIVDHTCPP
FT                   PISEKKVSRKRQKREKQQLKEGDILELDDEGNIDLGEEIPNQYSSRPHGTFNDLLDLLI
FT                   LHINNQLSTSFSGKLTAVDETLAPNISADLFKQSRIQGRTTSKRDRQGFFKIIVEAKKR
FT                   EKKDADDFQAKLWKAPTLSDKHHLLSSRLQDALTNDKKFQALYITVLRIFHRYLEEDLK
FT                   LLVKYNEQDCLGGDHVIVAPHISNMSFAAKWAPTPGKSADKQLHIATALAILFYPGDDV
FT                   SWARQKLQKEVLTPLRKALAIPEVAMSNRSWKFDYNRVPSRSMARNAEAFMAHDQQGFT
FT                   AYLDRVSQGLATVSGASLMPHELLYNAIRGKSPVAKRLADLQWSTLVDSIRSSSSDDIS
FT                   NCIAIADVSGSMGSLDQGSPQNPPPLLPCIALTLLLSELASPPWQGRFFTFSTDPACEY
FT                   IDPDLPLAERASQLSKAHWGMSTEFYKTYELILTTAKKNELAPEYMVKKLFVFSDMQFD
FT                   QAVKGKYGETEHETMKRRFEEAGYPLPEMVYWNLASRAEGTPKPTKSDVEGVTLFSGFS
FT                   GALMKFFLGDGLADDALERQFEDIEISKEGESCVSEKERKKPNPLEQVHRAIGGQHFAG
FT                   LKVVD"
FT   gene            843084..844348
FT                   /locus_tag="CND03120"
FT   mRNA            join(843084..843181,843243..843375,843436..843672,
FT                   843725..844348)
FT                   /locus_tag="CND03120"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(843162..843181,843243..843375,843436..843672,
FT                   843725..844288)
FT                   /codon_start=1
FT                   /locus_tag="CND03120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42877"
FT                   /db_xref="GOA:Q5KIF8"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="InterPro:IPR039770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF8"
FT                   /protein_id="AAW42877.1"
FT                   /translation="MSMLRTIKPKNARVKRALEKREPQIVENDKTAIFVRGQNSSDKVR
FT                   NVMKDLYSLKRPHAINFSRKNDIHPFDDASSLEFFAGKNDASLFVTGLHSKKRPHNLVF
FT                   SRMFDGRVLDQIELGVEGFKAMSEFPTLKSSLGVKPMMVFHSDLFDTHPTYQQLKSQLL
FT                   DLYNGHPITEAPLLTTLEHVISITAGPVSDTTPLPQVHFRVYTVKLIPSGTRVPRIQLT
FT                   EMGPSIDFVVRRLQEPDEEMMKAALKRPKIAKSDVEKGLGKKRKNIETDEMGDKVGRIH
FT                   IGKQDLAKMQGRKMKGLKVRDGKKRKTSGADGMDED"
FT   gene            844532..845888
FT                   /locus_tag="CND03130"
FT   mRNA            join(844532..844676,844734..845434,845489..845707,
FT                   845761..845888)
FT                   /locus_tag="CND03130"
FT                   /product="peroxin19 Pex19p, putative"
FT   CDS_pept        join(844595..844676,844734..845434,845489..845707,
FT                   845761..845805)
FT                   /codon_start=1
FT                   /locus_tag="CND03130"
FT                   /product="peroxin19 Pex19p, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42876"
FT                   /db_xref="GOA:Q5KIF7"
FT                   /db_xref="InterPro:IPR006708"
FT                   /db_xref="InterPro:IPR038322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF7"
FT                   /protein_id="AAW42876.2"
FT                   /translation="MDESSKHQYRDPQVDEEEEEEDLSDLDNVLESFQNSRPSASTLQR
FT                   DASLPSATQPRPSTPPPGEDDEDFEASLMQGMESLLRQLAGDHPPGVMPDIGGDGSSKP
FT                   TDPRMGSSGSVEPSPLSKEAEEAAWQNAVDTLLSGEGLAALGLDEGKSSRSKEKASSEH
FT                   SLNGTAPKPSYEDTLRKTLESLKSAGRNSGARSSAAKDGQNDIASLFASLGGDPDLLKG
FT                   MNLGEEGGEEDFEGILEGMMTQLMTKEVLEEPMSELAVKYPPYLKSPPPDTSPEDIAKY
FT                   HQQYTLVTQIVETFKKPGYTDEKDGKDIARLVSEMQDLGGPPKEVMGDLPEGFDLGILG
FT                   NEDGCTIM"
FT   gene            complement(845813..851707)
FT                   /locus_tag="CND03140"
FT   mRNA            complement(join(845813..846153,846206..846427,
FT                   846485..846613,846663..847462,847517..849250,
FT                   849302..849354,849402..849871,849921..850758,
FT                   850809..851179,851236..851395,851450..851707))
FT                   /locus_tag="CND03140"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(845932..846153,846206..846427,
FT                   846485..846613,846663..847462,847517..849250,
FT                   849302..849354,849402..849871,849921..850758,
FT                   850809..851179,851236..851395,851450..851634))
FT                   /codon_start=1
FT                   /locus_tag="CND03140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43209"
FT                   /db_xref="GOA:Q5KIF6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF6"
FT                   /protein_id="AAW43209.1"
FT                   /translation="MDISHSIHSEVSSLSFSFLSADDIKAISVKKVDNPILLDNLNLPT
FT                   RGGLYDPKLGPMGSRDLCETCHLSYFACPGHFGHIELPTPVYHPLFMNQCYHLLRGVCL
FT                   YCHHFKMPEIVATSYVARLRLLDAGLLTESHEVAALFDNAIGKSSRHRDTDEDEDAEGD
FT                   VDMDAPAPQTIESAAEFMVRIEAYVYHHLKLAKQNAGGSDSKVEDGYKDGLVFEERKKL
FT                   LHEFGKKIWNRCTRCTAYGNTFRKEKAIKIIEYDLTPKQKLANKLSNLRRPDVLAASGK
FT                   YSSKQRRSEGDIDEGIEMDSDKSSVSEGEGESLDEEEEEEQDVGQTVAKTASGQVKGTR
FT                   GRHERVMSPAEVRAHLRLLFDKEPRICRLIYGRHGNPAALSSVAPPPLADMFFMEVVPV
FT                   TPTRFRPAARMGDELFENSQNSLLTAVLSTCQRIQKLNQDLINQAKAERGEHVLDAVAK
FT                   AQGGRTFELLLEALIKLQHDVNSFVDSTKNPAVMRQGKLPPPGVKQLLEKKEGLFRKHM
FT                   MGKRVNYAARSVISPDINIETNEIGIPPVFAKKLTYPEPVTQQNVAELRQLVINGPKIH
FT                   PGAALVQNEDGTQISLDKLTLDQRISLANQLLTPQGSEDNIGAASIGPAAKNKKVYRHI
FT                   RDGDIVILNRQPTLHKPSMMCHRVKVLLGEKTIRMHYANCNSYNADFDGDEMNIHFPQN
FT                   EVARAEAQMIANTDNQYLVPTSGGPLRGLIQDHVVAGVWMCNKSSFFTREQYFQLIYGA
FT                   LRTENNYTGRSRIITLPPAIFKPKPLWTGKQIMSTILTNLTPSNAKGLNLTSRNKVQNK
FT                   LWRRDDSSDPAMSEENVIFLDGHLVCGVLDKSQYGASGYGLVHSVHELYGPYIANRLLG
FT                   VLSRLLTKYLQHDAFSCRMDDLILTAEGEKIRKDILDKASGDGAIAAMKYVGLPEGSKI
FT                   EDPDTAKNLAIRLEEILRDDHLMAGLDAVMQSAFNKTTSKINNDVLPDHLVRPFPDNNM
FT                   QMMTISGAKGSKVNASQISTLLGQQALEGRRVPTMVSGKTLPSFKAFDTSARAGGYVAN
FT                   RFLTGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLIKHLEGVKVHYDHTVRDSDS
FT                   SVLQFLYGEDSLDVTKQTHLNKFDFAAANHLSLLNKVRPGDIAGKVSDEALSHMKKALK
FT                   KPHKHVPALSEYSPSRYIGSMSEAYAKKLNNYIEDNKLGYITKKGESKASPYTSERVPE
FT                   KEFLGLARARYMRSLVEPGEAVGLLASQGVGEPSTQMTLNTFHLAGHGAANVTLGIPRL
FT                   REIVMTASSKPTTPTMKLPLREHISDKDIETFVKQVSRLTLSEVVERVTVTERLSSKSS
FT                   ESDSRQRKYTVLLEFYPPEEYGTEYEITSEQLHESLAWHFAPRLKKEIQNEIRRVAKTK
FT                   EQEAQVGKGRKVRVGGDEGDEEEVDREPDVRRRGRDDELDNDDEDSYQLKRAAQAKQHE
FT                   YEADSDADSGVADLEDFVEKELEEDDEEDVEDDAAEKAKKDQKADDWAELFKLASKYAT
FT                   TFSFDGHSGKSAQFDLEFPASAPKLLLVDIIERTCRASVVHEIENIGRCMKIFSDKGEF
FT                   TRSLITEGSNLRGMWALADELVDLDRLSSNDIYAILQTFGVEAARRAIIDEVSSVFGAY
FT                   GIAVDYRHLTIIADYMTHAGGFRPFNRTGISAKSSPLLKASFETTVAFLSEATLHGDFD
FT                   DLTSPAAKIVMGKPSASGTGAFDIRAPTRL"
FT   gene            851849..852921
FT                   /locus_tag="CND03150"
FT   mRNA            join(851849..851982,852042..852151,852218..852378,
FT                   852433..852609,852663..852921)
FT                   /locus_tag="CND03150"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(851911..851982,852042..852151,852218..852378,
FT                   852433..852609,852663..852817)
FT                   /codon_start=1
FT                   /locus_tag="CND03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42875"
FT                   /db_xref="GOA:Q5KIF5"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR010908"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF5"
FT                   /protein_id="AAW42875.1"
FT                   /translation="MVRSTTIFRVHDALPLAASVDDESTEKALTEYKQQSKLIFRRLNA
FT                   NSEPACSIESGAYTLHYLIVDKVIYMCICDNSYPRKLAFSYLDELSKEFQRSYGDKIDG
FT                   ATRPYAFMGFDTFIGKTTRLYRDSRSLTQGGGPAAPNSRLDQLNENLKDVTQIMTKNME
FT                   DLLWRGDSLDRMSQLSTSLRSESAKYRKAARNINLEALIRKWAPIGGIAFFIILFIWWR
FT                   FF"
FT   gene            complement(852467..854722)
FT                   /locus_tag="CND03160"
FT   mRNA            complement(join(852467..852823,852877..853986,
FT                   854048..854126,854174..854310,854375..854445,
FT                   854504..854536,854609..854722))
FT                   /locus_tag="CND03160"
FT                   /product="long-chain fatty acid transporter, putative"
FT   CDS_pept        complement(join(852959..853986,854048..854126,
FT                   854174..854310,854375..854445,854504..854536,
FT                   854609..854637))
FT                   /codon_start=1
FT                   /locus_tag="CND03160"
FT                   /product="long-chain fatty acid transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43208"
FT                   /db_xref="GOA:Q5KIF4"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF4"
FT                   /protein_id="AAW43208.2"
FT                   /translation="MDSATAGLDAQFNRAVDIVQSLPKGGTIQTTYEDKLWLYSLYKQA
FT                   IEGDVAVPRPGMLDLLGKAKWDAWNRQKGIDKPQAKRLYVSALVKILRKCADAKDVQRY
FT                   LQILEHESGYEYPLHIPSCPASPASSASSYHSSQASPALLPQSSNSPIVPPHDISPLTP
FT                   SLPPPDDAPNFIPPSSHHSRNPPSLSSMQEQRNEVLDAVGRTGRDGNMRDQRPSSAQNL
FT                   TSESQIHAAMPLDRITGIEREAVSGKSGSVHSPRRQRRDSQASARLASPLPHPTVGSRD
FT                   FLGTPETISSPFLGLNQPTPMYSRRPGSTSTFSNSQATNIPYTLQQIQTSLTALHERLS
FT                   TLERTQALILRRDERRKSWFSWEGHESEELDNCENDQAKEMWGRTGVTTVTKVNAKKKS
FT                   ISMRVLWFLVKTLRRALMDVGIGMMVTLIVIMVLNGGWGRARWMILKYKERLRRFLTEQ
FT                   "
FT   gene            854869..856070
FT                   /locus_tag="CND03165"
FT   mRNA            join(854869..855387,855454..856070)
FT                   /locus_tag="CND03165"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(855101..855387,855454..855988)
FT                   /codon_start=1
FT                   /locus_tag="CND03165"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR017359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIX7"
FT                   /protein_id="ALO60526.1"
FT                   /translation="MITPEDNISTELELISASLLPAESLHCLSATGLYPQEFDITNSDS
FT                   GRSMHVEIHEDYPKKGSVKVEMKGNSMGRDEALGLKKWVDEKMLDWDDAQEYPLYQILT
FT                   TQFLSLLTPSAMSPSLSPSTPSETITSSIPYHALLVSHHLLSTTKRKNIVSLSSTLSLI
FT                   GFSKIGHPGVMYAIGDEADLMEWIREIKSWNWLALRVKMGPEPIPEEKEQEAERRGREE
FT                   GARGGRGRGEWVEVEKVGDALSWLRERGGEKRARILTDVGVGGGTRPKEGT"
FT   gene            856073..860089
FT                   /locus_tag="CND03170"
FT   mRNA            join(856073..856300,856345..856609,856657..856858,
FT                   856901..857063,857107..857344,857397..857552,
FT                   857593..857925,857967..858121,858182..859546,
FT                   859598..859756,859819..860089)
FT                   /locus_tag="CND03170"
FT                   /product="expressed protein"
FT   CDS_pept        join(856172..856300,856345..856609,856657..856858,
FT                   856901..857063,857107..857344,857397..857552,
FT                   857593..857925,857967..858121,858182..859546,
FT                   859598..859756,859819..859878)
FT                   /codon_start=1
FT                   /locus_tag="CND03170"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42874"
FT                   /db_xref="InterPro:IPR017359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF3"
FT                   /protein_id="AAW42874.2"
FT                   /translation="MPSTDIQLTPPEIRQSIYHRAIIDLRHTVGVEYVAWMEDTAARVF
FT                   DQFALLDTTIFPETFGPRDEDPFIRFGEWLNASSQNKYHVHDHFETRKQSLEADKRMKD
FT                   RLRQEVVSRHKEARAKGPAERMTLRAVDQPFPSYLHSQDVLMTATAMRETPSFDQGGNV
FT                   GPKEYADLGEEGAFRFLVNLKNPMPKERKIEEADALHLHLNFAKKDLKKAADMVRTLEY
FT                   KLQNPLRGADGTSLQSAIWDKWEKDTKAKFQHLPEPLSPKLFPRCLTNPGPNQLHTFKD
FT                   IEQLVAPTDASGLKLPIPTGAITQGSNRGWAMEDSNDFVEEALSLKNLDDFDGVPFPPL
FT                   TPNSVNKYSRIRASVSQRYNQLPMSPPATVERKSKMPWDQDPRLELPFMPARVNSPYMN
FT                   SGSINDLFTPVENPSPPTQVRSFEVRSEAAVQSCSFKDDDEDVDRPFEARIFYDLLANE
FT                   DTQVRMNGNGSHGKAEEEALAYAMEEQLDTSKTSHMRVLNIKYEAYGDPSNDLPKSFCE
FT                   LLESSRNKGLEADKQMFIKYPGLNTALASELHWSPFSTTNDAALIENGAKVPPMGNDLP
FT                   QSLTFPPADLLPQTIPHPSETSLRKLVERSPKSMTPARPRWLTIQDVDKLQEPAGDVKS
FT                   GESLLAPSLALTSTPRKKRKEVPQRDPDEVDELFEDGSNLPQKPTAANDSPEKAMRVNL
FT                   RKKTKMKDVLQSNNQEATLNDIIDIITSRGGTRGQAVIRNIQGTSSTLLDAIPRDDKYD
FT                   LSTIKGFLHLQKLDHLLTEEQEPTYKFPSNQSLSPIFEEKEPMDWRLDPLLTNPEWFIQ
FT                   TSAAQTQSFETPMPIMAAVSLFQNRPLIRMLESRGFCLLDSFPSLQGADLVISPTIALV
FT                   FRPLSSLPDIHVGLLEELKLVATYYQRVILVFETISYAASERYAVASNNFNPLGTAVIH
FT                   ALGSLSRGKKAAWSMNDIIGELDIVFAYKGAGEIADSVSKVLREDEERLRENMGEEGYL
FT                   QYKGREWIGHEPIVEHENTMVEMFGINTFGARYALAAYGGAERLAYEMTEDERMEQLGP
FT                   IWGQITTARFNDILREMLDGSKDVDF"
FT   gene            complement(859598..861775)
FT                   /locus_tag="CND03180"
FT   mRNA            complement(join(859598..860675,860752..860998,
FT                   861052..861263,861319..861775))
FT                   /locus_tag="CND03180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(860886..860998,861052..861263,
FT                   861319..861320))
FT                   /codon_start=1
FT                   /locus_tag="CND03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF2"
FT                   /protein_id="AAW42873.2"
FT                   /translation="MSPRYYTVDDSQWSTPALSLSPGWNMLRVNGSDEYINQTEVDSMR
FT                   PLLEIFWNNSISWTTTLGSWTSIYFNGTSISAFGLAGPNQGKFTAVLDGEAMGSYTAQQ
FT                   DNVD"
FT   gene            complement(861828..867448)
FT                   /locus_tag="CND03190"
FT   mRNA            complement(join(861828..862276,862331..862630,
FT                   862684..862730,862785..862819,862871..863191,
FT                   863250..863676,863737..863854,863908..864067,
FT                   864124..865395,865448..865924,865985..867021,
FT                   867095..867448))
FT                   /locus_tag="CND03190"
FT                   /product="membrane protein, putative"
FT   CDS_pept        complement(join(861999..862276,862331..862630,
FT                   862684..862730,862785..862819,862871..863191,
FT                   863250..863676,863737..863854,863908..864067,
FT                   864124..865395,865448..865924,865985..867021,
FT                   867095..867401))
FT                   /codon_start=1
FT                   /locus_tag="CND03190"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43207"
FT                   /db_xref="GOA:Q5KIF1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF1"
FT                   /protein_id="AAW43207.1"
FT                   /translation="MTSPPTPPPIPDNIPSAISVSRPTAVGPQRPLRIPDQERNTIPPP
FT                   QNPQDGQQPPEPSNYDYTENAPQAVVDAVAIERAKREQEGPPEMMVGSWTSWAGSDNAD
FT                   TGIFPSSITRSHMRVGSRRTSIASRHSVASIARPPSVFRRQGSSQIDLVQSPGSAVFAF
FT                   DAAEDETTAEHGAYHRRISSRRDSRRWGRRDSSAQPGSYFSSREHDRGREDEGRFSDEE
FT                   EDFEPQPVSPQRPSTTALGRIASFIGLTRHDTEDEEAALVHSVDELRRRSSSRSRSRSR
FT                   RASSGSRSYARSPSPSPSEEDWEYGEDDYMDSYGEDGEGYSSSLADDTSLPPQSRPTSP
FT                   SIPLVPSATDGIFGEPHVRLNDLVEPRDFVSVAVPSRQTIVLPDEDLSIRFTCYRTDPF
FT                   RNILWWLGCILTLGALGLLGRWMPKIWVKFLGKETSFEEAKEGSWLVVETPYGDLHVIP
FT                   LHIVPYPYPLSTVFPQSIPPPASATSANGYFGLSSSSTPAQPLHSLNGEPAGGVGGAKD
FT                   LMSDVEPGKTVWEETTGLLKIMEYRYTKFALDPSAGRWAMIRDWRDPKWTSSRAVAQGL
FT                   DSAVRKQRLVLMGENIIDIASKSVVGLLVDEVLHPFYVFQIASIILWSLDDYYYYAFAI
FT                   ALISITSIMSTLIETKRTIERMREMSRFHCDIKVLIDGEWVMKDCSELVPGDIFDSSDP
FT                   NLSVFPCDALLLSGDAIVNESMLTGESVPVSKIPAKDETLRALSRESKQGSSEIDSDLA
FT                   KHYLFSGTKIIRVRAGAKPVWAPKSESSIALAMVTRTGFNTTKGALVRSMLFPKPMGFK
FT                   FYRDSMNFIGVLAIIAGFGFAISAVQFVRIGIHWHTIMLRALDLITIVVPPALPATLTI
FT                   GTTFAIDRLRKSGIFCISPNRVNIGGKINVVCFDKTGTLTEDGLDVLGARTIDRQNSRF
FT                   SELHSDIADVPIEGGVNGKTPLLYALATCHALKLIDGEIIGDPLDIKMFEYTGWTLDEG
FT                   QSRPVTKGNAEGARPQALVQTVVRPPGTDRWRMEDALKQGSKHAHFLELGVIRTFDFVS
FT                   ALRRMSVIVKRLKSTCMEVYVKGAPEVMPEICDPSSFPHDYDDMLSYYTRNGFRVIAIA
FT                   GKSIEGLTWLRAQRMRRDVAESDLQFLGFIVFENKLKPGTAPNIHTLRAAHLACRMVTG
FT                   DNVRTAISVARECGLVSHSASVYIPTFIPGTGVHDEARLDWSSVDDDRLKLDEWTLKPL
FT                   TNQVGVAMDTAEAEMHDYQLALTGDVFRWMLEYAEFETMERMLVKGVIFARMSPDEKAE
FT                   LVERLQSLGYTVAFCGDGANDCGALKAADVGVSLSEAEASVAAPFTSQIPDISCMVEII
FT                   KEGRAALVTSFSCFKYMALYSMIQFMTVTLLYSFASSLGDFQFLYIDLFIIIPIAVTMG
FT                   RTLPYPKIHPKRPTASLVSRKVLISIIGQILINAAIQVFVFVWVRKQPWYTKPDTDVDK
FT                   LETFNFENSALFLVSCFQYILVAGVFSVGPPYRKPLYTNPSLVICLTVLTSFSAYILLS
FT                   PAASIAAILDITDLKFTFRLQLLAVAAVNILASFAFERFAERPISRMIVFAKRWKGRRG
FT                   KRRDYRLPPSTGI"
FT   gene            867606..870307
FT                   /locus_tag="CND03200"
FT   mRNA            join(867606..867672,867733..867876,867930..868401,
FT                   868462..868670,868718..868742,868786..868866,
FT                   868922..869290,869351..869623,869688..869849,
FT                   869909..869984,870043..870128,870193..870307)
FT                   /locus_tag="CND03200"
FT                   /product="expressed protein"
FT   CDS_pept        join(867632..867672,867733..867876,867930..868401,
FT                   868462..868670,868718..868742,868786..868866,
FT                   868922..869290,869351..869623,869688..869849,
FT                   869909..869984,870043..870128,870193..870222)
FT                   /codon_start=1
FT                   /locus_tag="CND03200"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43200"
FT                   /db_xref="GOA:Q5KIF0"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="InterPro:IPR027415"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIF0"
FT                   /protein_id="AAW43200.2"
FT                   /translation="MGSDEQPPWAPLPRSNQQSVDHDDEDDEQLRIAIALSQAEARETK
FT                   RARREETPDDEKHMLAEAIAASLAEAGPSANPEATVSQQPVASLAIPVVAPVVEVPSSL
FT                   RVGSQTYDRAQMNKERLQRQAAREKSEAEQSRREGISTFEQTTPRLPQARKAASAQWPP
FT                   PTGAHPFQGTAPFPRDAAGEYYLEGELRHTGNMWASEGPIGNIRQPTFSLTHVVGDHSQ
FT                   ISLIITSAYCIDDSWLNEAGILPDPVDVPVVMIRPYPKDLRHRLNGKVASQLNGEVWCY
FT                   PDMKDNWGTMHMKFFWIFYKTGRLRVCISTANLVPYDWSMIENSVFVQDFLPLNTPIQG
FT                   LSADAPTHDLALQFRTLFKHIGVDSALTLLSKNHPQGNRIPFSGQNDFSDLRRWDWGKV
FT                   RFRTVISVSEKLSGAGDVDLFGIGRLGHVLNTEGWVPDKEQKAVIEYQGSSLGQYSLNW
FT                   LHNFYSFCTGKKVSSLVTNSKPSSWPPIKIIFPSLSTVDSSVGGRDGGGTIFAGKGWNA
FT                   NTKYLFYDSNSKRGGILMHAKMMIAIFHPKAETPSSQTPSSTSLGKRKALEPDEVENRI
FT                   GGWVYVGSHNFSPAAWGTLDTKKSPVTLSIKNYELGIVFPLYGQQSNVAADKVAPYKRP
FT                   PKKYSVGDEPWDQKKHGFGL"
FT   gene            872426..874012
FT                   /locus_tag="CND03210"
FT   mRNA            join(872426..872746,872797..873628,873679..873832,
FT                   873884..874012)
FT                   /locus_tag="CND03210"
FT                   /product="Ran GTPase activator, putative"
FT   CDS_pept        join(872561..872746,872797..873628,873679..873832,
FT                   873884..873926)
FT                   /codon_start=1
FT                   /locus_tag="CND03210"
FT                   /product="Ran GTPase activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43201"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE9"
FT                   /protein_id="AAW43201.1"
FT                   /translation="MSKVFSILGKNLKANTKAELEPYISQLEEMEDVEEVHFGGNSLGV
FT                   EACEAIASVLKKKTNLKVVDLADIFTGRLISEIPQALSALCNALSDHTSLVELDLSDNA
FT                   FGGRCADALVPFLQSNTHFQIFKLNNNGLGPWGGSVVAKALLDNAAKCEKEGKESSLKV
FT                   VVCGRNRLENGSAPDWAEAFGKHRNLKEVKMPQNGIRMEGIQALAEGLSNCKELEHLDL
FT                   QDNTATKTGTRAIVKHLGSWPNLKHLNLSDCLLGSAGGIALATSLSLGSNPKLESLKLQ
FT                   YGEMDKRAIELLSVAISQHLKELTVLELNGNRFSEDDECVEELKKALELWGHEEALDEL
FT                   DDMEEPESEEEESEKEEEREEEETGEPDDGVDKGASGEDKLPPASDKQTDELADMLAGV
FT                   HVGKQ"
FT   gene            complement(874001..874708)
FT                   /locus_tag="CND03220"
FT   mRNA            complement(join(874001..874170,874308..874396,
FT                   874500..874619,874685..874708))
FT                   /locus_tag="CND03220"
FT                   /product="mRNA processing-related protein, putative"
FT   CDS_pept        complement(join(874131..874170,874308..874396,
FT                   874500..874619,874685..874699))
FT                   /codon_start=1
FT                   /locus_tag="CND03220"
FT                   /product="mRNA processing-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42872"
FT                   /db_xref="GOA:Q5KIE8"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="InterPro:IPR034100"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE8"
FT                   /protein_id="AAW42872.1"
FT                   /translation="MSAIAPVNPKPFLQDLTGKVVYVRLKWGLEYRGYLVSTDGYMNLQ
FT                   LANTEEIENGKSNGALGEVLIRCNNVLYIREFKDRAGGMDQD"
FT   gene            874885..877503
FT                   /locus_tag="CND03230"
FT   mRNA            join(874885..874908,874954..874989,875093..876759,
FT                   876816..877015,877074..877503)
FT                   /locus_tag="CND03230"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(874905..874908,874954..874989,875093..876759,
FT                   876816..877015,877074..877419)
FT                   /codon_start=1
FT                   /locus_tag="CND03230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42871"
FT                   /db_xref="GOA:Q5KIE7"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="InterPro:IPR025574"
FT                   /db_xref="InterPro:IPR026010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE7"
FT                   /protein_id="AAW42871.1"
FT                   /translation="MAAPNPFAGFGSKPQPSASGTSLFGNTSSQPASGSGLFGSSSTTN
FT                   NSSATPAASGGGLFGGGAQTSGGLFGNNTTGANNNNNNSNAAAANSSTPAAPSGGSLFG
FT                   GFGTGGFGTNNTATGSTTPASKPAFGGFGQSTTPAAPPPASTGTSLFGGAATGTSTGGG
FT                   LFGAKPAEGTGAPGAASTTGGFTGFGAKPAGTTSAPATGGLFGSKPAESTPAASSSPAP
FT                   SSGGGLFSFGAKPASTTTPAAPSLFGSAPAKDASSSTPTSGTPPTTSGGGPFGGGGLFG
FT                   AKPAAPATEAPKADTATTAPAAPTSGLFGGVGASKPAEAPKPAAGGFSFGNLGAKPATP
FT                   STTEAPKTGGFSFGASAPSADKKDEMPAEAPKTGGFSFGAPAAAASNEEKKTDKPAEAP
FT                   KPGGFSFGNIGTSATTASGDDKGKAPEAPKAGGFSFGGLGAKTDGDKDKAPAAPTPAAP
FT                   AAGGLFGAKPADAGQSSTAAPSASGGLFGANPNTTAAASTTTPAVPTAPIASAPANVEK
FT                   PSEPVPNLLRGKALDDIVEGWNKDLEEQVKEFERQAGEVREWDKILVRNGNQITALRRQ
FT                   VLEAQQTQAAVDEPLNYFEAQQNQLESMLDVYEKEIAKMSNDSTRPLAAKMPADREREK
FT                   AYTLAEDLNKQLDDLSRNLSQMIEQVNKISTSQSSLDASTSSLTNRPGTPSASAADAAS
FT                   QMPDDPVSQLSAILGAHLRALSSIDSSAGKLSTKVGELETKMGSSGSARGWGLPRR"
FT   gene            complement(877484..878770)
FT                   /locus_tag="CND03240"
FT   mRNA            complement(join(877484..877800,877857..877999,
FT                   878051..878166,878226..878382,878475..878550,
FT                   878611..878770))
FT                   /locus_tag="CND03240"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(877507..877800,877857..877999,
FT                   878051..878166,878226..878382,878475..878550,
FT                   878611..878661))
FT                   /codon_start=1
FT                   /locus_tag="CND03240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43360"
FT                   /db_xref="GOA:Q5KIE6"
FT                   /db_xref="InterPro:IPR005037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE6"
FT                   /protein_id="AAW43360.2"
FT                   /translation="MSATKRGATAVHGSNPQYLIEKVIRARIYDSLYWKEHCFALTAES
FT                   IIDKAIDLRAIGGVTDRQTPTPFICLVLKLLQLQPEKEILIEYLLAEEFKYLRALAAFY
FT                   VRLTFRSLEVYEILEPLMKDYRKLRVVHAGGYSLTHFDEFIDELLTQERVCDIILPRLT
FT                   QRSVLEETEGLPPRKSLLEDQESEREGSRSPSPPRYTSRSPSRTPPSSPGSRGRSRSRS
FT                   SASSGNRYVSRSPSLSGSELGGEEGDTRDRYISRSPSVSPDRVLEVAEDDVLEGDV"
FT   gene            878859..879658
FT                   /locus_tag="CND03250"
FT   mRNA            join(878859..878961,879022..879087,879166..879260,
FT                   879320..879388,879449..879658)
FT                   /locus_tag="CND03250"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(878892..878961,879022..879087,879166..879260,
FT                   879320..879388,879449..879562)
FT                   /codon_start=1
FT                   /locus_tag="CND03250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43202"
FT                   /db_xref="GOA:Q5KIE5"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR042225"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE5"
FT                   /protein_id="AAW43202.1"
FT                   /translation="MTGNGKGEDDVSLPKATVLKIIQEMLPEDISASKEAKDIIFDCCT
FT                   EWIKLISTQSNMVCEASSKKTISPEHVVEALKQLGFEDFVAEVEESNKDFKQAQKERVR
FT                   SQPDTKGMTEEELLELQERLFASSHARFAAGQQ"
FT   gene            complement(879626..881079)
FT                   /locus_tag="CND03260"
FT   mRNA            complement(join(879626..880725,880783..880851,
FT                   880909..881079))
FT                   /locus_tag="CND03260"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(879663..880725,880783..880851,
FT                   880909..881057))
FT                   /codon_start=1
FT                   /locus_tag="CND03260"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43206"
FT                   /db_xref="GOA:Q5KIE4"
FT                   /db_xref="InterPro:IPR040009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE4"
FT                   /protein_id="AAW43206.2"
FT                   /translation="MPPPHPELRHLLATSRRIPSKTSRLLSTSASTLRPTDEEPHFTRA
FT                   PKSTPVKSQTDSLQHTQFNDLWSQLHQEWPKQSNNKGAPQSISSFLDLSSSNVIPRPMK
FT                   GARNRLARASGVTPPEAEVFNEVISSILTSFPSTPSDPFLATKSGVTGYGSNEWGDGAK
FT                   QLRTMFDRNRSEDDNLEEYEMLAEEMDMVSSDLELVEWAKKRVFTPIDPLKPDEGTEKV
FT                   KASVEDETSATPESSQSTAATSPHQNTYKPPANLLPLLTFSPVYPKILTRVLKTLRENF
FT                   NSPHLVLALFHHAQSSSLESYLFGCLTGAYNEVLTCRWESFRDLDGVQRGIREMEMMGV
FT                   KWDKDTNRLVSRVVDEAGREILQGGRWGEDALQTLQQLERKLESDVIEEERYHEFERKK
FT                   RKRERERREGGADGEQWQTERGALGML"
FT   gene            complement(881189..883747)
FT                   /locus_tag="CND03270"
FT   mRNA            complement(join(881189..881338,881402..881539,
FT                   881621..882591,882672..883179,883241..883747))
FT                   /locus_tag="CND03270"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(881297..881338,881402..881539,
FT                   881621..882591,882672..883179,883241..883660))
FT                   /codon_start=1
FT                   /locus_tag="CND03270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42870"
FT                   /db_xref="GOA:Q5KIE3"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE3"
FT                   /protein_id="AAW42870.1"
FT                   /translation="MPHHDTVPAMPPSDAAKPDDLAIQDLSREVTSTGNIRLAAKRLAQ
FT                   SAQAEKLRNLKERASTRPQVAPPYARWADDPEEAEYLQSNVHAQAAHVEDQVLVSDEED
FT                   EEEKEAMGHMQEVVDGLWVGDLVAANDDDELEKNGIKNILSALRPSLKFSDKYAVYPLE
FT                   IDDAADTDLLSHLPSCVAWIKEILDLRQKAAEPSSQQKNGTGNGESLKRSPDIDTVAQR
FT                   GKPGGVLVHCQAGMSRSASIVAAYLMTEYDIDPMEAVAMIREKRPVIEPSATFWHQLGL
FT                   FYNTDGKVSLKDRSTRQYYMERTTTQFINGDGTAPSVEKMAKYPASPSPSNPPTPKDHA
FT                   RRKIRCKMCRRHLAVREHMMDHILDQAPAVPASRPRTPSGASISSQRASFSSNAGMRFT
FT                   DVMEEAGAGLLTDRERRGSQVSDVINPLTGLPGALSRRSSAGAGSNGALSPRATQTLYE
FT                   RDTVTSPLSISHNNNNNNNTTHLASRRESLLRNHSEPAGTMPPPVPSPTSHSTTSVPAP
FT                   APAQRALQSADQLNARLPPQLLALRMAGMGGAGASAPASPGTNTPEKERRDQSPSSANT
FT                   NGGTGAAARRLSSLAMTSKDEKEATKLYERRASAGEGMYGPPPILVNPKCSGYFVEPLT
FT                   WMEPVLSKGQVAGKLVCPNEKCGVKIGNFDWAGVQCGCKEWVTPGFCIHRSKVDEVF"
FT   gene            complement(884169..885144)
FT                   /locus_tag="CND03280"
FT   mRNA            complement(join(884169..884234,884292..884342,
FT                   884391..884442,884494..884786,884834..884990,
FT                   885034..885144))
FT                   /locus_tag="CND03280"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(884224..884234,884292..884342,
FT                   884391..884442,884494..884786,884834..884990,
FT                   885034..885096))
FT                   /codon_start=1
FT                   /locus_tag="CND03280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43205"
FT                   /db_xref="GOA:Q5KIE2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE2"
FT                   /protein_id="AAW43205.1"
FT                   /translation="MPAIARQLLARGYATAATAVKAPLQLNSLTGTYATSTYLAALKKS
FT                   PKELEALAKDVEAFDRKIRDDAKVAAFIQNPTLSASERAAALSSVVPSGASPILSNLLS
FT                   VLSENGRLSSAPKVFADFHSLMAAYRGELEVVVTSAEPLDSKSLSRLDKALKGTEIAQG
FT                   KTLKVVNRVNASVLGGLLVDFGDKTIDLSASSKVNRFNAALTQGV"
FT   gene            885244..886458
FT                   /locus_tag="CND03290"
FT   mRNA            join(885244..885423,885490..885947,886003..886458)
FT                   /locus_tag="CND03290"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(885276..885423,885490..885947,886003..886155)
FT                   /codon_start=1
FT                   /locus_tag="CND03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42869"
FT                   /db_xref="GOA:Q5KIE1"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE1"
FT                   /protein_id="AAW42869.1"
FT                   /translation="MAASLPIFHLLPNHHPAYPPSPTFSDPAFSAQYDSAFPANMDLSK
FT                   SSQHPLNGYPFPAPPGTSAPQYSSRHIPSYPNLVPPNFSRGSYPAVQGGEDPTTFLDLD
FT                   LSQPGPSTYHQQQPQPQSAAHHYHQPDHEYVQSDAEDDESLVQVKEEQDERQEGEEQDA
FT                   DVDNEEPLYVNAKQYHRILKRRMARARLEELNRLVRSRKPYLHESRHRHACSRPRGKGG
FT                   RFLTAEEIETLKRQEAEKASKGEDEAQASA"
FT   gene            886865..889207
FT                   /locus_tag="CND03300"
FT   mRNA            join(886865..887522,887618..887942,887998..888052,
FT                   888119..888203,888262..888403,888467..888559,
FT                   888608..888667,888763..888834,888913..888963,
FT                   889027..889207)
FT                   /locus_tag="CND03300"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(887014..887522,887618..887942,887998..888052,
FT                   888119..888203,888262..888403,888467..888559,
FT                   888608..888667,888763..888834,888913..888963,
FT                   889027..889068)
FT                   /codon_start=1
FT                   /locus_tag="CND03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43203"
FT                   /db_xref="GOA:Q5KIE0"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011943"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIE0"
FT                   /protein_id="AAW43203.1"
FT                   /translation="MSQDEPTRRSPHLHSDATGNSLSAQDTSSKDFEGMKTVNARSDAE
FT                   TAASGKRVKVFHASTPEEEQARRHRALGNEDAMVREEETSAEAEGNEQSNKDEDASTAT
FT                   TSSAIHQRERDQGADLADSNDVNMDDDESPKVSTVPLAEETDEEWWDLKMQWGGKVYDI
FT                   HVGGNDMVYDFREKIASLTSIPPDAQKLIGLSPTVKGKLNASHDAMRFAHLGVRKGGKF
FT                   VLVGTKVEERFVDPIKEQEGEGGEGEFDVDYKGIGPGNDPRNKRKIQEIIDKVPITVMN
FT                   APREGKKLLVLDLDYTIVDTKSLLNGTLPSSECARPGLHDFLELVYPHYDIVIWSQTSW
FT                   RWLETKLVELDLFNNSRGYKISFVIDRTCMFPVFSQRNGQPYKHEVKPLAYLWASFPQW
FT                   SAKNTIHIDDLSRNFALNPGEGLKIRAFNKAGSPDGRRDRELIKLGTYLIGIAASESDF
FT                   TTMNHKYWSGRVKGRRGRH"
FT   gene            889278..892089
FT                   /locus_tag="CND03310"
FT   mRNA            join(889278..889590,889653..889721,889782..890157,
FT                   890211..890324,890380..892089)
FT                   /locus_tag="CND03310"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(889319..889590,889653..889721,889782..890157,
FT                   890211..890324,890380..891951)
FT                   /codon_start=1
FT                   /locus_tag="CND03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43204"
FT                   /db_xref="GOA:Q5KID9"
FT                   /db_xref="InterPro:IPR025256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID9"
FT                   /protein_id="AAW43204.2"
FT                   /translation="MRILILLAAAALLGTTLASAHALAPIPSLNPPIVRREDTNETAPG
FT                   NNTQTWTEGDDWVPFNIVIDPAYGIAGAVLILSGIPVAVLGGKNRWSSLAIASGQALFL
FT                   FALVMILRFGVQPNLVPPSPHPPSPTLRGLYLLACLISSFIGAGLGIFFFNFTKYAISA
FT                   AGGFTFGWFLLALREGGLITSVVGRWALLGALTVVAFIASLPKWSNDLMTLVSTAWIGA
FT                   TSFVLGVDCYTRAGLKEFYIYNLGFHDLFPTLGGAKYPLTQTMIIELGILGAVVLVGAA
FT                   IQFRVIGLLQKRMNRLRAEEEARMEEDEISKAAERFKNVGAELVEWEEKYGNKPRSESE
FT                   HNGTEKCGSVRDVSSPSGPYAISLTADRSSVLLPQLEFNDSQESEILKKRPSNNLSLLG
FT                   NDISPQIRPSSSFSLVRVASESGKGHENINPDKPTNTMFLGIEKLKPDEPSSGLGRDSS
FT                   DLESKLRLLEEVRKARESVQGSLELLRSRTPSETQSFAGPSGADTLSGSGLEGRPRRYS
FT                   SMSSRLLDEAKVRPVSSASNPSPLQSHMTEMPQQQSEWDTYVAERRIVSPVASSPPSFA
FT                   SLSVDRQRQYTTVPVSVAKGIESRRERTISMLETRVSDFGPAQQERAHGTFPERSPITY
FT                   VSDIERKGSAAHHDYFERGIPSPPLAANRPQMSYTSPPRVITGGASDRHPASAPKTMSM
FT                   EELAERHRQRLSKMQQPVTFKLKESERVEEAKKKWEKQRAHEREEMRRRQTERARENEN
FT                   SQGKIREVVRRTDQWRRSIAVDPEPQVGGEKTSNGEKAQKQGRTIVN"
FT   gene            892268..899959
FT                   /locus_tag="CND03320"
FT   mRNA            join(892268..893227,893282..893434,893490..894288,
FT                   894352..894436,894488..894671,894727..894902,
FT                   894954..895285,895345..895431,895483..895524,
FT                   895581..895694,895748..896124,896178..896876,
FT                   896928..897287,897358..897588,897635..897958,
FT                   898024..898233,898278..898385,898440..898537,
FT                   898593..898675,898724..899049,899101..899258,
FT                   899323..899653,899708..899778,899831..899959)
FT                   /locus_tag="CND03320"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(892320..893227,893282..893434,893490..894288,
FT                   894352..894436,894488..894671,894727..894902,
FT                   894954..895285,895345..895431,895483..895524,
FT                   895581..895694,895748..896124,896178..896876,
FT                   896928..897287,897358..897588,897635..897958,
FT                   898024..898233,898278..898385,898440..898537,
FT                   898593..898675,898724..899049,899101..899258,
FT                   899323..899653,899708..899778,899831..899883)
FT                   /codon_start=1
FT                   /locus_tag="CND03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42868"
FT                   /db_xref="GOA:Q5KID8"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID8"
FT                   /protein_id="AAW42868.2"
FT                   /translation="MSHSRNHSLAISTSASIHTSASPSPVSPASPASASAGLSRRHSWN
FT                   ITDENQEIPTFNDPSSPSRHINDSLTPKRAIPLHSTPLGKSGTAHSHRLSERDITWADA
FT                   NDGRDIWGDPNQTTPTQSRTRPFIDTYQSTTSLQSTISPLDDNGRSSDDRERLTTGHSH
FT                   VMHYNGIGMGTPRRSPRKPYNESGSGLGRSSTLRNVSQSLRKASVRVVNIMGTERGGGR
FT                   ERLGSDDEGEEVLQDVEIDGNQGFAMSSTNDNRETLPSPRQLPTSSRREEVGHRRLRGR
FT                   TMCLFGPMSRVRKSMDRLMRYPWTEPAILLLIITNVVVLAIQSAPTLNSPRTGNGYFQG
FT                   WEDAVLLVLFIVFTLEMFARIVVTGLLLDPETSLRESLFGQDGVVPVLQRYLLITKSNI
FT                   QSNLRRKATKRRAPWRSQEQNDATHNKGSKTMATSALRSLTGLSEAPFQKAMAKQKGLS
FT                   DQGRPYLRHSWHRIDMIAVFAFWITFFLALTGHEATANRHVYIFRALSVLRAGRLLVIT
FT                   SGTTTILHSLKRAGPMLITVSYFLIFAACIFSIIGVQSFRGSFRRACVLTDPHNSSNVI
FT                   QLERQCGGWLDPTSLESVSYLNSDGTPSAVPPKGYICPLGQTCMTTDQNPNNNVNSFDN
FT                   VFSSLVQVIIVISINTWAPVMYMAMDSDFFGSSLFFIAGVIVLNFWLINLLIAVVVNTF
FT                   SDIRAETKRSAFGAGETFLGTEPHWAAEDEKTKNNRLLAFYQKTEIFWVILIVADLVTQ
FT                   GSKTSSSSESMLRLLDRLELAFTLAFDLEIIIRFLAYLPDWRSFFYRKRNCFDLFLAIA
FT                   CSIIQIPAISNSTIYPWLTVFQLIRWYRVILAFPRMKPLLVTVFGSFSGLLNMVIFLFL
FT                   MNFLGALMALQLFRGDLEAGEPITFSQTYNSFLGMYQIFSSENWTDIVYDTMGAEAQYK
FT                   QNIIAAIFLCGWFLFSNFIVLQMFIAVINENFAIAEEQKRKQQIQAFIHRAEAPSAHAS
FT                   WIDRLNPYRLMAARPRAVRVKTLPPNLILPLKQNTGIDLSDVSSSLPMDDGKGTKGAVK
FT                   RLLGRDREEGQIRLKRLKRPSPREVTDDVEDEDDDRGLTDLLPPLNAAVSKDEHMDALR
FT                   ERRNQQADFIAAHPSFDKSLWLFKQSNPVRKFCQACVPPAYGERIFGRPANPTLELIVK
FT                   TVVFLAVVASIVVAAIASPSYRREYYADHGISRGTWFDLTEVTLGLIFVLEAAMKIVAD
FT                   GFIFAPNAYLLSLWNVLDFIILITLLINITTSLIFIGGLSRVTRALKAFRALRLITLFG
FT                   RLRDTLHAVLFAGALKILDASIFMILYLIPFAVWGLNIFSGLLYYCNDDDSTGLTSCIG
FT                   EFSTSPVDDSLTYLVPRVWVNPTVDESIWSFDSFRESILILFEIVSLEGWIDVMASVMN
FT                   IVGRDQQPEDQASQWNAIYLVIFNLFGGVIILTLFVSIIIKNFSTRSGNALLTSEQRQW
FT                   VDLSKFIKAQTPSQLPKGRPKLLFRAWCYDRTVNKNGFWAVGFTMIYYLHILLLMMEDF
FT                   SENLLNEVQLDWIFLFLTVLYAIDLLVRFYGLGFKSFRSNGWNIFDLIVITGSFATTIP
FT                   ALQADSSGGTANQVNVQLQKLFLVSISLKLVQRISSLNQLFKTSVASLPAIGNLFLLWA
FT                   TIFIFYAILYLEVFGLTKEGNNAGTRFQNYYTFGNALLMLAFMSTGEGWNGYMHDYTIQ
FT                   VPRCTENGNFLESDCGSAPGAYVLFISWNIISMYIFVNMFTGVVVESFAYVYQMPGKSS
FT                   LNREEMRAFKQLWAEFDSQRVGYIKRRDLIKFFSRLTGVFEVRPYPIEFSIHNIIHHSR
FT                   PDQPDNASSRSYVITGVKHAVDIRRVAEQIAQIDYRQVRERRQLFSRLYNEARISEEPG
FT                   KGISFTAMLMMLAHYKLIDDESALELDDLLLRRARTERVTDLVNLDRVRGLLRTIYWRK
FT                   RFLATRDARKLTLNAEAEGIPAIVLDPTPITPPDYSDQSRYDPSYSPQVHEKEESTPKR
FT                   ILSTEIISPTSYFPSGKTHALPVSDLSNSNSLPSPSFYNSPTRSTPRPESLGRQPSNSS
FT                   YLSSDDAHYRRDSKPDENLHAKDYDEGMSDSMWGDMMREAVDQEGIENEQG"
FT   gene            complement(899905..908162)
FT                   /locus_tag="CND03330"
FT   mRNA            complement(join(899905..900193,900248..900327,
FT                   900375..900581,900638..900705,900765..900997,
FT                   901058..901228,901280..901545,901593..902855,
FT                   902911..903376,903432..903490,903540..903706,
FT                   903758..906011,906068..906867,906920..908162))
FT                   /locus_tag="CND03330"
FT                   /product="1-phosphatidylinositol-3-phosphate 5-kinase,
FT                   putative"
FT   CDS_pept        complement(join(900066..900193,900248..900327,
FT                   900375..900581,900638..900705,900765..900997,
FT                   901058..901228,901280..901545,901593..902855,
FT                   902911..903376,903432..903490,903540..903706,
FT                   903758..906011,906068..906867,906920..908056))
FT                   /codon_start=1
FT                   /locus_tag="CND03330"
FT                   /product="1-phosphatidylinositol-3-phosphate 5-kinase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43260"
FT                   /db_xref="GOA:Q5KID7"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID7"
FT                   /protein_id="AAW43260.2"
FT                   /translation="MPSSSYSEHSIPPSSHLTTFPNPFQDEPEQGILPAFLSKVKQTFA
FT                   SGISQPPTQNSHASSDRLPLSIEGENKFAHDRDSNPIAPPREGGQTEAQAIAEAVMKNR
FT                   IQTAAQGALPNSAVEQQQRMHGQSAGSISAVVATAAEALPSTQSTAHPSNLSIHTSHDQ
FT                   SLNPPIGPVNTFGSSNSHPPVPASVASSQVSISGPKRAVASGGPHWRPSGVAPAQVTIS
FT                   PVTTTVQTASKEPISSPARPIPFPSAKVPHRGNVNRQNSISSSSRAPTPLPHHIHTNPL
FT                   STGQNKRLRRSSVATLPDSPSSLSISGMIAANAELTQSHSYVPGFPLAQDDTRSVRSMG
FT                   AVKRLNSVSRIIKRMKGDGLSKQYWMADEHCKECYDCKSVFTAWRRKHHCRICGQIFCS
FT                   RCASNIIGARRFGQEGVVRVCNLCLKIMEEYKDDDDDDRRSINSFSTSVHRYPSISDRA
FT                   FLNTAMSPEMPYAKSPFAASQLFSSHPNDSLMAIDEASVPMQWDDGRLDAERAFILNEV
FT                   GGPPTPTGDDRIWAGRPPTVAPFRRPVELDQKVAADQEEADGDGRVSTPVLETSGSALH
FT                   ATHRDATSSPFPRTNTMSTDDDVERAPLSREDSGHPLIGLKTRMNQAVLTALLDSEKSE
FT                   GLWRARSHSFAHQPEMLTGASLQHFKLMLSQAIARAELPKADEWHRILTNLILKVPLNL
FT                   QPNVRAGDDIDVRAYVKIKKVPGGKISDSEYVDGIVITKNVAHKAMSRRLVNPRIMVVT
FT                   FPLDYHRVDNQFMSLDPILAQEKDYLRLLTKRIVDARPHIVLAQSSVSRIALDYLLEAN
FT                   VALARSVKASAIQQVARCTQADIVASMDRLVLEPRMGRCGEFRIQSFDHELIPGRRKTL
FT                   MRFEGASREQGCTIILRGADLPTLRKVKVITDFMALVAYHLRNEVIMYNDEHNIPPPKP
FT                   VLPTEYRELLDLLDSDRSPTEGSPSCDTPSQLSHSTATLKPITSPDNIEFVSESSSTPR
FT                   PNLNPIQLDDKQLEKRDALEVTKQIAKSLEPYLTVALSSSAAIMFPPPAILAKMAALDR
FT                   RLSELRVNRDEAEAAQILEEETKVAEVSKDNAPTVGTTDSETASLAPTSISEAAGTSSE
FT                   VPINDAMSAYPTTSTSKPPIRDPYHILRKPQEVSQESALAQVEHAHQEQIRLWQWYTRR
FT                   FAEELRPENYQGIVYLSSLGCEGAEKPCVEPSLQHIDYYQPGDQTVGQFLESLAIVAPD
FT                   QCTSKNCERLLLFHYHLLVHGQRRLQIAVDQFPCPSPGHEDQIITWSYCRQCATPSPTT
FT                   IMREETWKMSWGAYLEQCFYPPEIRAGFSCPHDAFRDQIRYYAHRNLAIRIHNEQIDLF
FT                   EPVRPSIKLQIKAETKVILKNREYDSALAKIYAFFDSVASRLRTIDVEGVQSDKVSRLN
FT                   ANVESMLVRAASDREEIINLLNRTYKLTPITDVLSLNIVLRALQDKVVQWDVDFADIEK
FT                   AFMPTEKDLKKMTASHLKRFFANQDAPGSLERSALAGTPSVVSEEHETKDDVAPTQAPS
FT                   DKQTTIIGLSSDTTTDGAAAFADIATAKLDDASVTPTAGILQPMSNPYSRSVRSSSKET
FT                   EDDSDSTVFATHDDLVDKGDGKATIEPSTENDTSQFVSRLPRRAAPAPSIADLVQRFNE
FT                   STQLALPGLTCSPEHTRSAGGSRRQSPRQYSSHDISDSDHSSRNRPRLRRGKTEQPSHR
FT                   QRDASRPGLMSDGDRSYATNASRISSSSHLHRSVGESKNNDYPTVRPSMGSRAPSYTSN
FT                   IPPRSGRASPKLRYPVVTHVQSLFDLEEGKPRVAGKGKSPRRPESTTPIVGKNVGRRSQ
FT                   SGTSRVNSIARHFDRLSREAEKERQKRISVVRGKRARPVSVTKAKVQVFDNLRDAFKDE
FT                   FDTDSSEADNEEDELGSDDSLGSADEPISRTKAESFSNNSSPTRPIGSSVPMATSPSLL
FT                   PEASLSKDDLVTMSPPIASETTTSILSDSKSEKSFTDRLKIELPSFETSAPLPSHPATP
FT                   QVHTDTTTADEALGAVSASQTSDVETSTANEKSSLLKSLSGLWAFRAADFAPLEYPLSA
FT                   SEHIFADSKVIIRETEPTSIIAFTLSSKTYRDNSKAWSTSRQEEGRFDTFMPEEAMSAN
FT                   HPAAWDAVSLEDVDETARQERGTHMKYDFESGASTIFCRIFFAEQFAALRKACNCEDSF
FT                   VESLARCIQFDASGGKSGSAFLKSRDDRFIAKEITRYEMDALTKFAPAYFDYTRKAFQG
FT                   QRPTVLAKIYGFFKIGFNNAITGKAMKMNVLVMENLFYERRFAKIYDLKGSTRNRLIQP
FT                   TGRINEVLLDENLMEIVYKHPLYLREQSKRVLRTALFNDTLFLSNLNVMDYSLVVGVDT
FT                   DKHELVVGIVDYIRTFTWDKKLESWVKDLGAGGKGEPTIVTPKQYKLRFRTAMERFYFP
FT                   SVPDRWTVVVPDEAQVEEDEPGVGATG"
FT   gene            908806..909732
FT                   /locus_tag="CND03335"
FT   mRNA            join(908806..909036,909116..909243,909300..909357,
FT                   909458..909732)
FT                   /locus_tag="CND03335"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(908986..909036,909116..909243,909300..909357,
FT                   909458..909574)
FT                   /codon_start=1
FT                   /locus_tag="CND03335"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIJ1"
FT                   /protein_id="ALO60527.1"
FT                   /translation="MTQCSKDETLIQEIHVRIVERQGHEESSWDGCISVYSQLKSIFEV
FT                   WNDDVHEDEDIDSYRFTVYLEGTGKPGTVVNGDESCMSLGIHDQGIIFASRIEVPEHRP
FT                   QQMATSTRVAMRI"
FT   gene            complement(909713..911028)
FT                   /locus_tag="CND03340"
FT   mRNA            complement(join(909713..909914,909968..910194,
FT                   910247..910382,910440..910836,910889..910900,
FT                   910953..911028))
FT                   /locus_tag="CND03340"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(909812..909914,909968..910194,
FT                   910247..910382,910440..910836,910889..910900,
FT                   910953..910998))
FT                   /codon_start=1
FT                   /locus_tag="CND03340"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43258"
FT                   /db_xref="GOA:Q5KID6"
FT                   /db_xref="InterPro:IPR006822"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID6"
FT                   /protein_id="AAW43258.1"
FT                   /translation="MEADPLYHVKQLFYQASYQACISEASEYPHTPSDDPSSLHRALYI
FT                   ARSHLALPSPSPSSAHAILAPFLSLSPVPLSARAVDAFASIHEAEEDAREEKVEEVRDL
FT                   VLECEGGNDEEEEKTVRAIAASVFILVGENEEAVATLTEGAAKDDLECIAILVQLLLSL
FT                   NRRDLAQATYNSAKKFGSDSMLIQAMEAWIGLKTGSQPLHQSYYFYEELYQLPNGRTAP
FT                   VLASHAAAHLLLGHVDEAKADIVEASQSKAGQSSSDVLAVGASVGAEGFAEKLVTTAKQ
FT                   HPYALDLIEKNKLFDEAAAKYAVSA"
FT   gene            910616..910997
FT                   /pseudo
FT                   /locus_tag="CND03350"
FT   gene            complement(911137..912653)
FT                   /locus_tag="CND03360"
FT   mRNA            complement(join(911137..911361,911418..911539,
FT                   911628..911728,911783..911886,911934..911980,
FT                   912040..912139,912211..912226,912280..912323,
FT                   912377..912653))
FT                   /locus_tag="CND03360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(911281..911361,911418..911539,
FT                   911628..911728,911783..911886,911934..911980,
FT                   912040..912139,912211..912226,912280..912323,
FT                   912377..912625))
FT                   /codon_start=1
FT                   /locus_tag="CND03360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43363"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID5"
FT                   /protein_id="AAW43363.1"
FT                   /translation="MPNSVSINSSPTTTNVLLNPPLRSPSYSEVELIRTPPARSFTPTP
FT                   PVSRSLSANGSPTASTPGRLHGESDLSLLLRTLDFAARKHSCQRRKDVDQSPYINHPIS
FT                   VANYLSSTGITDVHVLQAAILHDTVEDTCTTIEEIADQFGIDVARIVEECTDNTALDGL
FT                   QRKVEQLRAAPSKSKQAQQVKLADKLHNLESIRRSPPVGWGMKRVQAYFIWAKRVTDIC
FT                   APAHPPLAERLQRLYETAHTRVNGTYFPCHPEVCGPLTEEEKELVDKRLRELKEGDTMC
FT                   PEPLFF"
FT   gene            912779..916098
FT                   /locus_tag="CND03370"
FT   mRNA            join(912779..912859,912900..913139,913192..913385,
FT                   913441..913772,913825..914327,914383..914586,
FT                   914636..914817,914879..915271,915333..915471,
FT                   915530..915603,915669..915887,915939..916098)
FT                   /locus_tag="CND03370"
FT                   /product="expressed protein"
FT   CDS_pept        join(912802..912859,912900..913139,913192..913385,
FT                   913441..913772,913825..914327,914383..914586,
FT                   914636..914817,914879..915271,915333..915471,
FT                   915530..915603,915669..915887,915939..916034)
FT                   /codon_start=1
FT                   /locus_tag="CND03370"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42867"
FT                   /db_xref="GOA:Q5KID4"
FT                   /db_xref="InterPro:IPR019183"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID4"
FT                   /protein_id="AAW42867.2"
FT                   /translation="MSRQLLAWETEERKLQSVYDDISLHRIVPAQQTIARYLKKHPKSQ
FT                   PALIVNMYIMQKTGAEESDILQVYKQIQALAGPKKEMTGRGVWWCTLTLRNMGRLDLAQ
FT                   KVYQDLYDLHPETYQLLEQVFLHSAAAWDVSTMVQSSRKMFNATRDPKWARLAAWAEWV
FT                   QKAPQPTPSNPYPCPAPANSLKIAQVLLSTTGNTCETSDIFWLRAQILLSSDQPGDLLT
FT                   LARQQAQEGSLARLWWRMETVKAAVARCGKEGQKEWEAEREWVAGMLQKDDGSQRNYAF
FT                   YRYLLLATQNSTDPDSMRSTTALLKSLVEQIGQKERAPQLAQLEFDMVLHDTKFASETD
FT                   ISSHLMDDEEWLDKVEQYWNRWGSKGSIVTELIAISRENEKRKTMVENFLKARAVQQHH
FT                   DETSFKEISNAYIILLMEKDADWMPTNEDIEKYWRLYLEGLQYGRNLAKTDVQSSDPIG
FT                   LLTVNLLLIMWHSSPKNMVPLYKSILCLEKICQESPICMHAHYLLIRLYRLIGAASLIG
FT                   PHLTTLGLSEIQLDNLLHVIVERGAIEALMAKNVGIWSSHTDKALNMYQRTASDFPEYV
FT                   KECLGNETYSKITSIRHLASSLHDSLSSHVLAIEQARLHAFNSPTVPFPPQLTRRLQKS
FT                   LKAEMIDLRNWDLIQEIGGKRKLTKDITELGGRPIADDWVKIMGRFWLVVGEFINNGQV
FT                   LDLEFEGLEALLDHEQALVESGSNVLKAASKALKPSTEAAESEEQEKSLKGIFSENIRI
FT                   CCGDHTSRWSLIQSYISLAQLIKITDLVLSRATEAAKPVKGKKKPTQLSAFIADLRNEI
FT                   QDLKNTTMVELNKRLDAVRGEDEVKWDCLSSLFDEDVYLQDVFENLMNARKASLDNLKP
FT                   LLTTKK"
FT   gene            complement(916239..918044)
FT                   /locus_tag="CND03380"
FT   mRNA            complement(join(916239..916448,916522..916596,
FT                   916660..916755,916827..917267,917351..918044))
FT                   /locus_tag="CND03380"
FT                   /product="alpha-1,6-mannosyltransferase, putative"
FT   CDS_pept        complement(join(916412..916448,916522..916596,
FT                   916660..916755,916827..917267,917351..918021))
FT                   /codon_start=1
FT                   /locus_tag="CND03380"
FT                   /product="alpha-1,6-mannosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42866"
FT                   /db_xref="GOA:Q5KID3"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID3"
FT                   /protein_id="AAW42866.2"
FT                   /translation="MPLATRPHPRLLSPILALLFIIFALSSLFSLFANSTSILNFVPTA
FT                   LVKGERTPGCRGNAAISIQNLLDAGARHVAESNRLFDATGAKRDLGIDLGENWTLQSYA
FT                   SYLENIWQEFLQEPQGSNADHPTLQTVLSYTSLLPREQGSETAIPKFIYTTDLLEPQQL
FT                   PEQFQSWITQNPEWTTMFVNDAEIDTWLEDRLGAGEVKTKAQEELLALKESYGVVRADL
FT                   FRYLVLLLNGGVYTDTDTASVLPIAQWARSPTVAPVAPLLTAIPQLISIIQDPSSQTLP
FT                   STPSTSKPSLVVAIESDALSTGANWREQSFARSIQIVQWTIMANRGHPVLLDVIGMALK
FT                   KSEEIRLMKSNNDQVRKEDVNILNWSGPGAFTDAVFRYLFVRYGFHPAQASGLKEPLQI
FT                   GDVIIMPVHSFRADASEGFQGEHRVVWHGFFGRWKGKTDK"
FT   gene            complement(918114..918927)
FT                   /locus_tag="CND03385"
FT   mRNA            complement(join(918114..918405,918462..918545,
FT                   918599..918630,918680..918709,918763..918785,
FT                   918831..918927))
FT                   /locus_tag="CND03385"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(918325..918405,918462..918545,
FT                   918599..918630,918680..918709,918763..918785,
FT                   918831..918853))
FT                   /codon_start=1
FT                   /locus_tag="CND03385"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR012420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIH5"
FT                   /protein_id="ALO60528.1"
FT                   /translation="MAAVRWAKFTVYSSLIIGAGVWLQSKTVPSEKELYSQLSPQLKNK
FT                   MDQIVRHREGSQTMKERLEEAGEKDQVVWGDQLNTKRKPLFPDRH"
FT   gene            919034..920391
FT                   /locus_tag="CND03390"
FT   mRNA            join(919034..919103,919156..919297,919348..919710,
FT                   919778..919903,919961..920391)
FT                   /locus_tag="CND03390"
FT                   /product="6-phosphogluconolactonase, putative"
FT   CDS_pept        join(919040..919103,919156..919297,919348..919710,
FT                   919778..919903,919961..920150)
FT                   /codon_start=1
FT                   /locus_tag="CND03390"
FT                   /product="6-phosphogluconolactonase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42865"
FT                   /db_xref="GOA:Q5KID2"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID2"
FT                   /protein_id="AAW42865.1"
FT                   /translation="MPPQPPAPPVFYSFPDTEVLVDSLANFVVKAQRDAVDKRGKFTIA
FT                   LSRGSLAANLRGLVGQQNVQWDKWEVFFVDEAAVPLEDEDSNYRSNYLSFLSHVPIPRE
FT                   QIHTIDINQLDDLEELADQYEKQLVNHFAASNAARYPTFDLMLLGIGPDGETASLFPGH
FT                   EILSEKDAWVSFIDDAPRGPARRITMTFPVLNHCYRAVFVATGKEKTEMLHTILDQPEA
FT                   GLPCSRVRPASPGLVFWFADAAAASATQYPPTTFRWIDNEKEAQEAVDAAKRRAARKLA
FT                   EADSEAEVLKKSV"
FT   gene            920465..922873
FT                   /locus_tag="CND03400"
FT   mRNA            join(920465..920846,920925..921297,921382..922093,
FT                   922152..922271,922337..922873)
FT                   /locus_tag="CND03400"
FT                   /product="mRNA polyadenylation-related protein, putative"
FT   CDS_pept        join(920678..920846,920925..921297,921382..922093,
FT                   922152..922271,922337..922759)
FT                   /codon_start=1
FT                   /locus_tag="CND03400"
FT                   /product="mRNA polyadenylation-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42864"
FT                   /db_xref="GOA:Q5KID1"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014891"
FT                   /db_xref="InterPro:IPR025829"
FT                   /db_xref="InterPro:IPR033489"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID1"
FT                   /protein_id="AAW42864.1"
FT                   /translation="MSTVFYRWGAGRDESRVTFDGTHISVFDLKREIILNNKMGNGKDF
FT                   DLSIYDNVTGEELKDDNQQIPRSSSLVARRLPPSLGKGRGSAADYIAGTTAAEALTGDH
FT                   RVESHARQAMLDKNLTKGIRSAGGTYGSLSKRFDGKEEKPAEKVQVSTGDKDEDAKIQA
FT                   ILAQGAETWEQMQEDMSAGYRAPAARAARANKPSGSAVAGASQKYDFSLGPEKEPPVGY
FT                   ICYRCGQKGHWIQNCPENDDPAAAERKRFVRVTGIPRSFLKTVETPVGAEGSSGGAMLT
FT                   ADGGFVKAVPDQRQWQKQAAVKPRALTGADVRDQEPLEADLTCPLCKKLVWEAVRTPCC
FT                   NTAFCEECVQTYLVDHDFECPHCESKVPSLDRLKPDEDLRKRSRNYVDHELQKNKDAKG
FT                   DSADGDVKEEAENDKNADDSEEGSLTPKEQNKNQILGADGQPLNSDLLDPHMIQNYLFG
FT                   AKKMLLNPDLNPAARALLTTQMQTLQANLLQMQMMAMMNGMGMGVGLPLMGGQNNVGGG
FT                   QTGIGLNGAIDNSMAMRGRPGFRGGFRGRGMATGQGFQRGPLGPAAQGGMGMGMMNRPN
FT                   VPAKRGADVELGGEAKQPRTGV"
FT   gene            complement(922850..930018)
FT                   /locus_tag="CND03410"
FT   mRNA            complement(join(922850..923051,923116..923224,
FT                   923290..923348,923403..923426,923484..925118,
FT                   925173..925730,925787..925898,925951..927173,
FT                   927231..927657,927711..928117,928187..928619,
FT                   928680..930018))
FT                   /locus_tag="CND03410"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(922944..923051,923116..923224,
FT                   923290..923348,923403..923426,923484..925118,
FT                   925173..925730,925787..925898,925951..927173,
FT                   927231..927657,927711..928117,928187..928619,
FT                   928680..929947))
FT                   /codon_start=1
FT                   /locus_tag="CND03410"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KID0"
FT                   /protein_id="AAW43257.2"
FT                   /translation="MLPQPLEQRPSILPVSPCSPSLSMQLPVPSPAITYLPSRRHVMST
FT                   CSSPPANQPSICSFKAARKRASNWHAGTDKSNIKSEEDELEPEGSSSLRLAGRTLPRGI
FT                   VTPGSRLSASQPQYSSSSSADDASSASPGTPGLSSELTSSLTEKAYHLDLQHRKRMADT
FT                   ALLPNPKRPRIDIRTSSIPSILPNVISNGSMSRNLGLAGPQKKAARKKAMDLVIDLTVL
FT                   DSDDDSLIIDSSDASDEAADEKDREDGDSYDFSDRTGRHTGSLASGAGEDTDEEEIEVM
FT                   YLKAGSVKEKEGNMVNGSACQVSPSSTRHAESRPITPIEKGPSPLREVRDLPPLNGTQI
FT                   NAGRFLQDSSRNEACSPVVFDNRPLTTHLLDATNARSRAQTAVDLGTSSQNLNPTWLDS
FT                   LASAKWSPVTLSIQGDLTEMTQNWTPEERSAHRRLVLLRRDLQGKLLQVEAHAISEMEA
FT                   VNHRSSCLPCFFWKERNIYVFPATSVSSVFQVLLGFDRLANVQANWLGNHYKKRTGIIV
FT                   LRDNEDGARFLGRIAEMSSPLNVGKKIETGSEFYLWEDLGSIIEDIIKNLVVRLPRDGE
FT                   GDHCPPVLAPHDAPLSQLFSTRVTLSNEATLFLPPQGINPTSSTQNLLPSPMPSSCSYQ
FT                   QLPPSDQPGSYTSNLRALDDDAQRFPLTNEDRQTKEFGTEEQHAEGRFTWSSIELRFEP
FT                   DLKAVTKDWTLEERSAGRRLIQLSPHWDGAAITVKLRIITRTEWSPFLTHIISCIYWEE
FT                   RDTCVIADDDILNALEALLDVGRLTVPLKTWINNNVDKHLSMIQRRDGNNEKFFSEIQN
FT                   MSNPHLGRSGSFIANVYPWDDLKSMIQRIFGRLLLRIPVDGDRSRPVLTPFDGLRSQLF
FT                   NPHPRESALVPLASSEHFTESHHFPDRPHPPHSALDTSEPGSRPSASMVGSEQAGHLLV
FT                   ARQYTLGLRTNAEGALKSTPGDSILDGAQLQSILQTGATEDQNGSISPRDRINGLNTVG
FT                   DPRLLIDAFEPEAIVENSQVHLSTIGSNIAEASKVGRNRSVEVGETVSKQIEETSQPDN
FT                   DRSSSVSGSQSSNLDMEAASQLPVISSALISVPQTVHEHSHTNDIPSQLPISSDLLPSL
FT                   DVSKLSLMNLSQDSAFSHRVPEVQNDIHLIPRGFAPQSKLSIFSRRLLHNQPRHPFASE
FT                   YISRHHPVTTRKPFLPRNVRAGLSGLASNEFPNKPSSVKFQQRLKEGQVRELCMRIKKG
FT                   EMTLDMRNVGFGTLKRDLVARESQLKTMRQGRLINITISRIVPVDGGSGLVAGLDRARI
FT                   RVSWESDPKPLHDVTLPLRDMALYQTPLPLILDGTFLRANRSTHLQLRFHVDLYVGQDS
FT                   QGSYISSPMSITSPDGFLLPIADIAHMRDRNGALCFNLALESNISLDPAALPLEPLSNR
FT                   VIPRRPRILNLLYIFKDVQGNATQEKIVDGWKCGLCGLEEDVGDLNDMSELAVHIKHYH
FT                   KYECAVLISGNGAEMVITLPDCVIFVKRHDASQVFSTIAGDLTHLTGQVSPHTGGTPSH
FT                   LLNNLPETLSVQDSPVSFENRLPASYTDDIASTDEFTKFTRPPILTVPGQLSSPQVCVS
FT                   SSEPLKKSSSVTRSPSLSANLAQPPPPTLATQDVQIEKITSFPIPFAETVLSNFDALGV
FT                   GSPLPPAAGNCINTESSDSTACPLYSLPSISLSPRSTHQSNGVFKSISSSTSSQKSPQL
FT                   YEPPGFASALKRDTTFSIVESSQGRSAASTSPQSPCTNTEGQCLGTIGGASMSQLDDQP
FT                   MSPGPCQSQSVIARRFSALEGSGSGSPSCQQLDDLSLRRLFTPELEDVRLLSDFETDVS
FT                   RDARTESPSIGPITTSAWQMPAPSPSMSPRHDDFQEPCVLSKLMIPEQSLEPILSSSTG
FT                   NAKVPLEESSIRLADTSEPVSDSKFTEAKANLAFMNAQPASHFDDSSNDESITILAGPE
FT                   TSISNHSHQSPTNISGQSRSQLRDSPPAIEDLRPFTKTGHAGPYMGKRVNQWTEWSSSL
FT                   EPGTLIDFMGELDKVWDGGRVRHLIRHQESLIWIQHHLSHKRRFLACCWNRWVHQKGPI
FT                   PAYNKAGYLKLWLDSYGVIMSRAKLSYEVKDYLHLHFQNRHILLTDYIGACQYWNRLRR
FT                   SYFDEPSRET"
FT   gene            930151..930913
FT                   /locus_tag="CND03420"
FT   mRNA            930151..930913
FT                   /locus_tag="CND03420"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        930221..930865
FT                   /codon_start=1
FT                   /locus_tag="CND03420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43215"
FT                   /db_xref="GOA:Q5KIC9"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="InterPro:IPR036774"
FT                   /db_xref="InterPro:IPR039799"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC9"
FT                   /protein_id="AAW43215.1"
FT                   /translation="MTTDIPAQPLKTTKETHPDLPPGLIIGPDGKPCKVCNSWQDWAKI
FT                   KVKKKAASGGEDAEKKNVSGSGAAVGMAGFGSMLSGAGASKAPTNAPLDRTPDRSNCPP
FT                   DTAALGRSTWTFLHTTAAYYPINAPPQTQSSMLNLLSSLSLLYPCSWCATDFQKDMRRH
FT                   PPDVSGRESLMKWLCERHNEVNEKLGKEKFGCDIKNLDVRWKDGPEDGSCD"
FT   gene            complement(930878..932053)
FT                   /locus_tag="CND03430"
FT   mRNA            complement(join(930878..931050,931102..931261,
FT                   931320..931421,931472..931588,931651..931793,
FT                   931843..932053))
FT                   /locus_tag="CND03430"
FT                   /product="prenyltransferase, putative"
FT   CDS_pept        complement(join(930925..931050,931102..931261,
FT                   931320..931421,931472..931588,931651..931793,
FT                   931843..932034))
FT                   /codon_start=1
FT                   /locus_tag="CND03430"
FT                   /product="prenyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42863"
FT                   /db_xref="GOA:Q5KIC8"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC8"
FT                   /protein_id="AAW42863.2"
FT                   /translation="MRSLPSTLVHRLFSVATSLLLFLLALGPIPHHVAFVMDGNRRYAR
FT                   ELGQQVESGHAEGFNALRRTLEICLRLRIRAVSIYAFAIDNFSRSEKEVGALMNLAKQR
FT                   LAELCEHGDLLEEYGVKIRFIGQLDMLPPDVLQAVRDMEAMTQDNKNGVLNVCCPYASR
FT                   DEITTAMKESVRRAYEGELAPSDITAKDVFDSLGVSKAINTVDKSLFVNPEEPEKLDIL
FT                   VRTSDVKRLSDFMMWQASDDTQLHFVKTYWPEFGLSDMLPILLGWQQKAWMRKLGWC"
FT   gene            932225..933582
FT                   /locus_tag="CND03440"
FT   mRNA            join(932225..932448,932539..932923,932984..933582)
FT                   /locus_tag="CND03440"
FT                   /product="expressed protein"
FT   CDS_pept        join(932258..932448,932539..932923,932984..933502)
FT                   /codon_start=1
FT                   /locus_tag="CND03440"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43217"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC7"
FT                   /protein_id="AAW43217.1"
FT                   /translation="MIRRRLSSGLLRAATPSRPSPATPPARTLASAVLLTSQTKWKTET
FT                   VVTLKAELKKRGLSQQGNKATLVSRLESAETSSLLPPVPPIPSSVRSISSTTSLSRSGK
FT                   LSDAPKTGTSSKDAEVDPNVAPGVSVTGPGPQVISQRTSAVNPDTVPPEQVTVAPGLPE
FT                   SKVGTEGAGETLDVRMPSVSADEEIDQVIPLIPDNFSAHSYPSSASTDPKVLTVASAST
FT                   HPAGGPVHASHDQSDAHSLEFAVEKLSSSVPSLESIATSVFSAPAAAWTSLGLQLPKVG
FT                   VPQGGSSEYKYNSRGLNQDEKRGAWILAGVIGAGLLLGGPKKDKTSAAHAESHAETQGK
FT                   RVVGDAKWAQASGAGVVGHGARKD"
FT   gene            complement(933898..935406)
FT                   /locus_tag="CND03450"
FT   mRNA            complement(join(933898..934101,934165..934183,
FT                   934242..934322,934379..934422,934478..934542,
FT                   934603..934626,934684..934762,934841..935406))
FT                   /locus_tag="CND03450"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(934043..934101,934165..934183,
FT                   934242..934322,934379..934422,934478..934542,
FT                   934603..934626,934684..934762,934841..935228))
FT                   /codon_start=1
FT                   /locus_tag="CND03450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43256"
FT                   /db_xref="GOA:Q5KIC6"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR034120"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC6"
FT                   /protein_id="AAW43256.1"
FT                   /translation="MLFGVGTFSLLLAVLSTSSALPADKNCTRKLDADIGTTALVADVT
FT                   ASPTSVQSTQGVVLANVQAVSSSSVISASGTSAGAETVQTASQTNTTPSSSSASSLAST
FT                   SSSSSSASSDSQTFLDLHNEFRALYDADAVTWNDTLASYASDAASACNFAHTGGPYGEN
FT                   LAAGVGAGYNITSGFNSWTNEASDYDSSNPQASHFTQVVWQSTTQIGCAVTNCADGTVF
FT                   TGYGTDSVNIVCEYYPPGNVIGAFASNVAA"
FT   gene            complement(936121..937326)
FT                   /locus_tag="CND03460"
FT   mRNA            complement(join(936121..936285,936342..936713,
FT                   936771..936935,937271..937326))
FT                   /locus_tag="CND03460"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(936250..936285,936342..936713,
FT                   936771..936935))
FT                   /codon_start=1
FT                   /locus_tag="CND03460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43364"
FT                   /db_xref="GOA:Q5KIC5"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC5"
FT                   /protein_id="AAW43364.1"
FT                   /translation="MGIDIRRHHVKKGNRSAPKSEDPYLLLLVKLYRFLARRTDSKFNR
FT                   VILKRLFMSKINRPPVSLSRIVKETKNSNPDNSKIVVVVGAILDDERLPEVPKLSIAAL
FT                   RFSTAARERITAAGGEALTLDQLALRAPTGSNTVLLRGKRNVREAVQHFGGPLKGGKPY
FT                   VASKGRKFEMARGRRKSRGFKIKSTHK"
FT   gene            937584..942114
FT                   /locus_tag="CND03470"
FT   mRNA            join(937584..937916,937970..938856,938907..938972,
FT                   939023..939280,939352..942114)
FT                   /locus_tag="CND03470"
FT                   /product="expressed protein"
FT   CDS_pept        join(937822..937916,937970..938856,938907..938972,
FT                   939023..939280,939352..941810)
FT                   /codon_start=1
FT                   /locus_tag="CND03470"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42856"
FT                   /db_xref="GOA:Q5KIC4"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC4"
FT                   /protein_id="AAW42856.2"
FT                   /translation="MLIPLYLAGLLLLYIPFLARTQASPSTQIPSRWGHASSYLPSPPT
FT                   LVIHGGKTDPDSAYSYSSAPNVGSTLFLPLNATFIAQSAPVTEIKSPSGPALAWHTLSQ
FT                   FAYSNGTWQILSFGGDSGTSQPSQTSNNSVWLDNFDLQNYSSLQYVNQPESWGSQPSNR
FT                   IYHSAVTGIDDKVYITGGLKDDGSNTAFADVYLFDSSHSYFTPLPSLPDCHYHHESILL
FT                   GNGSILVLGGAFTSQITSNVDVHPYTNFRRLDLSSNSASGWVEVAVTGDAPQGRRGATA
FT                   TATGDGDKVILLGGASSDLQTVYDEIWTLDLNTLTWEKEKVAEAGTGPGARFDHSAIAV
FT                   DENQIIVFGGYTQTGPADGGIYIYNTVSNSWVSNFTVSAGFNSTAKKSDSEVASSTVAT
FT                   GSAMAKIPCTLSSSGTMVDLVSSCVLSENSDSSSQSNALAVPSSTIAINSGDSGAYSHS
FT                   LTVPLVIGLTIGSVGLAGALLAVCMWRARRRLTRRKAYGDPSYASSPRSRTFNPIRRHS
FT                   PVEEEGPKLIDEMMDEKGTNVHKEMENPRTEAGTLSAVIAFRLEVGAVGRGFSSISSRI
FT                   RGSRWDSRPYSELTDYSPNDAQAMPHPPAPARQMGIGIHLLGPPLRRDKSLYYSPSNST
FT                   AHVTSVAQDNRIGIFCDEDSTRSEHHRRDPVHFEELPGTKECGVLRSHAGKWYSANSNN
FT                   GAEEKEVGAPSQLPSQTEAVPMPQISITKANKYGSYCSPYESLQYRLPNFRPSEPLEFP
FT                   GVTNAFPIPGYGSLRSNPHSAHIHESLTSRHSDDMDESGQDVHVAIENQPSPTIQNPLH
FT                   RKGSIFKRMAEASASVLLGRRPSQASGRLSMNQLEIRDPAPQPTLWPVLSQVQLCSVGI
FT                   ATPSLVAHENRQHPPVSWRDNVSQGLLPNDSYGPSISSLKSFRSMRDMIIVQKEETQDN
FT                   IETFRIIDEDDSGGSPEPKAAGLTTHLQRRESNENMCTPKEDHGEIDGFTCKQEPSREG
FT                   WEATILMDSLAFEPRVLDLSLKAIVDPGAFTDSSAILKTAGLLDTESVAETESGLSDSL
FT                   SHGSDKNSSLEEAASGTPQTDPSIFSHSPGETKPPHEHVTPLSAESSFDFCATSAGKAR
FT                   RRPVREVVNSINKRGDNTPMGLLAPRSFYSPAPGSSSGGMKVHSGPISKSTMSSDDADP
FT                   SGICNPFVTSESEYVSQSMRPTSTSPTFKGPIAPHDTAIIPKQRETPVGQVKTKTMWEM
FT                   VKREETLRIANPDAASVSESKKPLPDFHG"
FT   gene            942290..943435
FT                   /locus_tag="CND03475"
FT   mRNA            join(942290..942337,942411..942844,942912..943087,
FT                   943159..943435)
FT                   /locus_tag="CND03475"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(942521..942844,942912..943087,943159..943339)
FT                   /codon_start=1
FT                   /locus_tag="CND03475"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR029615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIJ5"
FT                   /protein_id="ALO60529.1"
FT                   /translation="MSFFSVLFFVLVAPLVFANTLQYKLHHRFVPVQASAGSPPSFSPL
FT                   GHLVLSSAEDGSPINPQIIPLSTTAQVEPQETADSAGWYQVGLQVKEGDSDDDKDWLIA
FT                   STRASYLAGPLLVKLHMEGTQLVSLSVHPLTSRSYDDSLSTVSLPQDISIFQLTIMDSQ
FT                   KTRPPPMGTSMMIDNDTGAPVTPPPEKSFLQKYWMYIVGIALFFAAQMGPEEPRNQNKG
FT                   GSGK"
FT   gene            complement(943390..945643)
FT                   /locus_tag="CND03480"
FT   mRNA            complement(join(943390..943578,943634..943845,
FT                   943898..943926,943988..944080,944132..944464,
FT                   944524..944735,944790..945052,945106..945191,
FT                   945252..945416,945476..945643))
FT                   /locus_tag="CND03480"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(943445..943578,943634..943845,
FT                   943898..943926,943988..944080,944132..944464,
FT                   944524..944735,944790..945052,945106..945191,
FT                   945252..945416,945476..945607))
FT                   /codon_start=1
FT                   /locus_tag="CND03480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43255"
FT                   /db_xref="GOA:Q5KIC3"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="InterPro:IPR037458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC3"
FT                   /protein_id="AAW43255.1"
FT                   /translation="MLARVLTRARPQRNLLTQRFSTASAPRTKYTYRTTALLAGIASAG
FT                   IAVAYQSWNPVRADELSNAQAPGVSTVQPSGQKLVSFEEVQKHNKREDCWVIIDGKIYD
FT                   VTDFLENHPGGAEIIIANAGKDATKIFKPLHPPDALDMLDPSQHIGPVDPATMPEPEEE
FT                   EPTEEDLRMEEARKSMPGVDGMLLVQDFEDWAEKVMSGTAWNYYKSAADREKTAAENEK
FT                   AFDRYFFRPRILRDATTGSTETEFMGMKTTMPVFISPAAMAKLGNPLGEVNLTRGAGAC
FT                   GIVQGISINASCSLDEIMTARKEGQPVMFQIYLNKDRAASIALLKRVTALGANAIIFTV
FT                   DTAWRSKRTMDVRAKAHVAPPPSSSGQQKSASPLGVSQAISGYQDTNLTWKDIDFIREH
FT                   TNLPIIVKGVQCVEDVDLCAKAGVQGVILSNHGGRQCDYAPAPIDLLYELRCKRPDLFD
FT                   KIEVMMDGGVRSGADVVKAIALGAKAVGIGRSFLYANGTHGEEGVVRLCQILAEEITNT
FT                   MRNIGAPRLEDLKPEMVGPAGPWVGNNAPPYVKTQ"
FT   gene            complement(946255..948058)
FT                   /locus_tag="CND03490"
FT   mRNA            complement(join(946255..946790,946843..947060,
FT                   947114..947305,947356..947755,947811..948058))
FT                   /locus_tag="CND03490"
FT                   /product="chitin deacetylase-like mannoprotein MP98"
FT   CDS_pept        complement(join(946387..946790,946843..947060,
FT                   947114..947305,947356..947755,947811..947973))
FT                   /codon_start=1
FT                   /locus_tag="CND03490"
FT                   /product="chitin deacetylase-like mannoprotein MP98"
FT                   /db_xref="EnsemblGenomes-Gn:CND03490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43254"
FT                   /db_xref="GOA:Q5KIC2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC2"
FT                   /protein_id="AAW43254.1"
FT                   /translation="MIPSTAAAALLTLTAGVALAHPGCGGQEIGRRNVGGPMVYRRDVT
FT                   DEASAAASTDVNTECTAYGYAPVTEIASSFPTIWETASILSNDTEGQQLFATINSTLNT
FT                   KLPNDVPHGTPTGDWTGVNYNSSDPDCWWTHNKCTTPASDTGLEADITIVPEPMTWGLG
FT                   FDDGPNCSHNALYNLLSENNQKATMFFIGSNVMDWPLQAMRAHDEGHQICVHTWSHQYM
FT                   TALSNEVVFAELYYTQKAIKAVLGVTPQCWRPPYGDVDNRVRMIAQALNLTTIIWSDDT
FT                   DDWAAGTDGVTEQDVTDNYQAVIDKAGNGTYTTHGPVVLNHELTNYTMSVFMTMFPKIK
FT                   SAFSYIVPMCTAYNITQPYLESNVTCPNFETYISGVTNISSSTTQKDGSSSTNTSSSGS
FT                   GSAAGSASATSSSDDSSSSGSTSASSSSSNASSGALGMFDGLSGVGLVLSGVFAGVMLL
FT                   "
FT   gene            complement(949232..951060)
FT                   /locus_tag="CND03500"
FT   mRNA            complement(join(949232..949476,949534..949656,
FT                   949705..949879,949928..950143,950194..950385,
FT                   950445..950521,950586..950618,950674..951060))
FT                   /locus_tag="CND03500"
FT                   /product="arginase, putative"
FT   CDS_pept        complement(join(949355..949476,949534..949656,
FT                   949705..949879,949928..950143,950194..950385,
FT                   950445..950521,950586..950618,950674..950932))
FT                   /codon_start=1
FT                   /locus_tag="CND03500"
FT                   /product="arginase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42854"
FT                   /db_xref="GOA:Q5KIC1"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC1"
FT                   /protein_id="AAW42854.1"
FT                   /translation="MYGRLGVSILLMAAASNVLAKIQEDDGYSEQLDPWNDEYANTPDL
FT                   SFSGVASFAHLPHKRCLDVKDAAFDIALLGVPFDSAVSFRPGARFGPYALRSGSRRQRP
FT                   DRGYNSRLEVNPYSGDLSILDCGDVPVTPFDPATAVKQINSAYRSLLHHPVVSPEKMQN
FT                   LNMQRGLDGKIHPRIITLGGDHTIVLPILDAVHEVYGPVSVIHFDAHIDTWNPHRYVGS
FT                   VSVQASLNHGTFFWHAYEKGFIKPNSSIHAGIRTRFGGPQDLEDDVTAGFDLIHTFDLD
FT                   DFGIDWISEKIKNRIGDGPVVISLDVDVMDPAFVPATGTPESGGWTSRELRRILHSLIG
FT                   LNIVALDIVELSPAYDTNAEISAIAAADMVYDFLSILALGVEHRNDGVSGTKTLKDEL"
FT   gene            complement(954990..960025)
FT                   /locus_tag="CND03510"
FT   mRNA            complement(join(954990..955520,955569..955938,
FT                   955992..956084,956141..956634,956692..956879,
FT                   956930..957813,957862..958224,958275..958857,
FT                   958908..960025))
FT                   /locus_tag="CND03510"
FT                   /product="calcium-transporting ATPase, putative"
FT   CDS_pept        complement(join(955241..955520,955569..955938,
FT                   955992..956084,956141..956634,956692..956879,
FT                   956930..957813,957862..958224,958275..958857,
FT                   958908..959882))
FT                   /codon_start=1
FT                   /locus_tag="CND03510"
FT                   /product="calcium-transporting ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42853"
FT                   /db_xref="GOA:Q5KIC0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIC0"
FT                   /protein_id="AAW42853.2"
FT                   /translation="MSRDNPPPVIITTDPDSPPPRSAPSTPPPNERPTPTLVIPGSPSS
FT                   ESRQESPQGYDPFRLSPNARLYPPGSGHSPSSSYSSALTPPSPTLTSCSSVHFSDELPT
FT                   PSSPNPKTSLALRENHPDAHSGMETLETVDENDPQRRHARGWSIGTWSSAAPTTDGHSM
FT                   KKPLIRTAIEANEIDEDRGEGGANKKGKKGKKGKKDKEEPPSAHLDPDKDKTDPTPFRE
FT                   KPSRLAMLVDPKSLEDLEKIGGVSGLLEGLGVDGAKGLAVGTDEGNAENGAPRSSADMP
FT                   GGNGPQWRASMDHRREIYGRNDLPRRKSKSLLLLMWLAFKDKVLILLSIAAVVSLALGI
FT                   YQDLGTPPKIIYNDECPDGCEEAQVDWVEGVAIVVAIIIVVLVGSINDWQKERQFKKLN
FT                   EKREDRSVKVIRGGSEMVINVKDVVVGDVCLLEPGEIIPVDGIFLRGHNVRCDESGATG
FT                   ESDAIKKFSYDECIKERDHLQPGQKQKKDCFLISGAKVLEGVGEYVVIAVGPTSFNGRI
FT                   MMAMRGDADETPLQIKLNYLAELIAKLGGASGLLLFIVLMIRFFVQLKTNPDRSANDKA
FT                   QSFIQILIIAVTLVVVAVPEGLPLAVTLALAFATKRMTKQNLLVRVLGSCETMANATVV
FT                   CTDKTGTLTQNEMTVVAGSLGVHGKFVKDLSDNASRSNANEEGHSVRGDFAFDMDQLND
FT                   YASSSLQTLFNEAICINSTAFEDKNEEGKLNFVGSKTETALLRFAKDMEWPDYRQVRES
FT                   AEIVQMIPFSSELKAMGVVVRKGDTYRLYLKGASEVLSNNCTKHVVVHQDDNKGDDIET
FT                   TEFDDDAMSNISKTIIFYANQSLRTIALCYRDFKSWPPAGTEKDEADEVPYEAIAKDMT
FT                   LIAITGIEDPLRPGVKEAVEKCQLAGVAVKMCTGDNVLTARSIASQCGIFTAGGVVMEG
FT                   PVFRKLSDSDRLEIAPRLQILARSSPEDKRLLVKTLKSMGEVVGVTGDGTNDGPALKLA
FT                   NVGFAMGIAGTEVAKEASDIILMDDSFKNIVLAIMWGRCVNDSVKKFLQFQISVNITAV
FT                   FITFISAVASSSEESVLTAVQLLWVNLIMDTFAALALATDPATESSLDRKPDRKNAPLI
FT                   TVEMFKMIMVQAIYQIIVCLVLHFAGLKILGLENNDQNNTELGALVFNCFVFCQIFNQL
FT                   NCRRLDRKLNVLEGFWRNWYFIIIFLIMVGGQILIVEVGGAAFQVTRLGGRDWGITLVI
FT                   GALSLPIGALVRLTPTAQFARLLIKLRIYSDPNKLPEQSPEAEEEQYSYNPALSKVKDN
FT                   LSTYARIRGGRLRASSMVAKSRSSQLRDADIQLPSLLTMVPTVIAGTVGAGAHWVTPHN
FT                   SIGLSNPAGQDPSYSTAELYKGKVQLHPQTNPNDPLYARFGLQPPDSRGSSVSGAKMFS
FT                   SGDTNNV"
FT   gene            960763..966033
FT                   /locus_tag="CND03520"
FT   mRNA            join(960763..962016,962068..962297,962344..964218,
FT                   964267..964466,964516..965569,965630..966033)
FT                   /locus_tag="CND03520"
FT                   /product="bud site selection-related protein, putative"
FT   CDS_pept        join(960968..962016,962068..962297,962344..964218,
FT                   964267..964466,964516..965569,965630..965637)
FT                   /codon_start=1
FT                   /locus_tag="CND03520"
FT                   /product="bud site selection-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43361"
FT                   /db_xref="GOA:Q5KIB9"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR024982"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB9"
FT                   /protein_id="AAW43361.2"
FT                   /translation="MLPTSSRPIPFSSLLISFIHVSSITAVASTIAPASLPQVDFSKMG
FT                   TVALGGSFSGLDWWSSESPFASSATGNPTFSSDGDTLFHRPTDGQFRALATTNSGGVIN
FT                   ALCWSKDGSANNGTLYVGGVFESLSGVSASNIASLTLADNSVTALSGGLSGEVNTLYCD
FT                   DDSSQIWVGGLFEAPIGSGGNVALWSTSSSTWVTPEFGGFNGRVQSIVPSIDNSSIYFG
FT                   GDFTTRFVQNSSILFNSTSNTNNTFGNVTSTPSVSENVTTVGDSGYLTPLTVSASASSS
FT                   AAYSIQAGPSSTQSEYSDTNVLLCPGSGVWLAQEDTVSNVNLVGQGYLSATGIRVVNGL
FT                   VQGRGTTYFCLTILPTYTELNMTYTDPVTGELGTCTSHCPLYTNSSISAQDFIFTAGTQ
FT                   NLTGFEMQLKEWIGDGAALSSVALLSDGAYLSAVSDGGSSCTNGAKNGSVQTVGSWDAT
FT                   TVATNSATESYLSSSVSLGDSQRPQVTFYPYVSSAGNYDIYVFIPGCLNAGDCDSRTSV
FT                   DVEVFPFSGGLGWTSTISEQVDYDTKTLIYSGPVGATTDSFTPTISLALSSDPYKPARG
FT                   HMYTVVADRVQLTFIGTDGSVSSTPLLNNGTAPDDYTGSNATTVGNSSWTTNSSYNVAF
FT                   GLFEWPRSSKLNTNAASNALSNVTETALTRLGFALDAALNASGSSASSWAVNTIVSMDS
FT                   TVFIGGDFSSTNNYTNVLSIDASSGETSALASQGLGGIVNTAAVVDGYVFFGGDFTSTA
FT                   SSGGVALNYLARYDPATKAWAAVGGGVDGYVTDLMASPSSTELFVMGNFSHVINSDGSL
FT                   NETGGFGVWDISSERWTSSGVVFGNISAGEMISSSPSIAYLAGRVSGYADNSADGLAML
FT                   STDQNGLAKISSLTGASFSTTGSSSSLTTSRRRSLEIKSSYSSSWLSRFAGGLVERALP
FT                   GLAARATAPVIVTPSFPAPAVLAVDYWTNTSTSDSPSMMILGGNFTSSSANVRGMAFYS
FT                   TSQQTVDGPEPPVSGVVRALEVIDDRLYLGGEGVNVEGIGSGLLVYNLVNGTWMEGGMA
FT                   SLNTASDSNVTINQIRTRPTTNTLIVAGSFTSAGSLSCAAICLWDSTNAQWSTLGAGLL
FT                   SGEVRSIDFAGNNYDTLVAAGSFVLSDGTVASVASYDFDSSSWTALGSLSGPTLAVAVD
FT                   EKNVTNIFAAGYSASDGSPYLEQWNGNTWTAQNETLQSGSLVYQLAFVPMSSEHTAVGS
FT                   IEKDRMLMVSGNLYLDQMGNATSALYDGVNWYPYLVGTSAAGGIGAGASLFWSDSDFSF
FT                   KVKHYLARGLVVLVAIAIATGIVLLFILLALLVAYFNRRRDTQAAQDRQEIYGKEGSDV
FT                   SSTHQNVFANVQAALEASLAGGAGTMMGLGTSRNSAPSQARLSNPSSYASGAYPMASDD
FT                   EYDEEEEEGDERETTMRYDFEGPELQEGEMSMKAGQPLIILDDQQSHEWWYARDPATGR
FT                   EGMVPASYVW"
FT   gene            complement(966031..970171)
FT                   /locus_tag="CND03530"
FT   mRNA            complement(join(966031..966524,966574..966840,
FT                   966914..967019,967086..967253,967306..967663,
FT                   967722..967890,967957..968715,968766..968833,
FT                   968890..969423,969490..970171))
FT                   /locus_tag="CND03530"
FT                   /product="spore wall assembly-related protein, putative"
FT   CDS_pept        complement(join(966408..966524,966574..966840,
FT                   966914..967019,967086..967253,967306..967663,
FT                   967722..967890,967957..968715,968766..968833,
FT                   968890..969423,969490..970171))
FT                   /codon_start=1
FT                   /locus_tag="CND03530"
FT                   /product="spore wall assembly-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43253"
FT                   /db_xref="GOA:Q5KIB8"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR039486"
FT                   /db_xref="InterPro:IPR040345"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB8"
FT                   /protein_id="AAW43253.2"
FT                   /translation="MPPVPHPPARHPHSENSPTPLLKPSPAILTQVPPPRPPADPSLHV
FT                   LPRRFLGPIPGKVLNSSHLQEKRRHFYDLRRRAAYKVRHELIGRKDSLSGLEEDDPDEG
FT                   ILRRAALKIGIPGLGQNGDREEDFSPESDHESESYGPQTTVGKETWFGESFDIGREFES
FT                   EGHDNDEPSILATRDTSVRGSGSPDQNRRQKYTQQQRHLAPHRPSNATRSTEETFFTAR
FT                   SQNSEAIESSIDDCPTPVLEHSPDTQLSQSSSRQPLIRSAQNRADQHPPQWIDPNTKKG
FT                   KGPANQSLSSSTFTVPQKLKSAFRHTSESPVGAAEPPGIDKSRMRDLPQKTKSVQFPMD
FT                   PIHSVASETGKTKAKDRNSPIDPNMVLSREGEEVQGTSSGAAADAMVEGDKSQELLARQ
FT                   GNVLYKDRMLVRVGYHREENILSFDEASQRRNPCSKLDPFEEYIVVWRKGFVELYQEWR
FT                   MPLRERMTGSKRLCFAIPLMPHRSSLSIFNPDDLTLCLTTSVEKLQLEVEALLKSPKTS
FT                   HISDLKNRMAQSSQVQWLRGHKKGTQIFILKLPERSRALDWYWELWRDLGGQLPERFDI
FT                   SVPVVSTSIRMGIPRDVDNGQADSGQLLRHFCPDTVIRTCWEMLQKETAFNDIVQQGRL
FT                   QGIKDEVDLQLVWKAGDGMLDWVAYLETVEGKKRPWALLAGLARLQNNPSPRELQLRPA
FT                   RHHPKSMKLEDGTILEEPPGIEGYLFRIHGPTTRSTIYLASHDGCLFITNMKDSEPPLL
FT                   PNQEGSTPSKLFSEVHKEFLENERRRMASVIRRSAGCIDMRDIAMIQYPSPAGKDADGR
FT                   RDTFELRFTAGGPMKLEAHTPEIAQEWVECLEALKSYWNHQHRVEARQRMDAMSAASGR
FT                   THGDGIDEFLGEIWNWCTIRGCRPICLSGRLYMKQGAHEKFRLKYMALSQGSFVSFEVT
FT                   GKASFHVRKKNYPLFGAYTYSGLLAHDEIHEPHNRDAFLPQHRVYQDGLQSFDGPEDTT
FT                   FCVRLAISGSHSGANANDPWDSSDYRDHTSMKLSKSPTSLLIFRARSKLERDRWVWAIN
FT                   AEVERQARAHLDQQNLFRAYGKVIDRW"
FT   gene            complement(970224..974520)
FT                   /locus_tag="CND03540"
FT   mRNA            complement(join(970224..970426,970487..970644,
FT                   970701..970755,970802..972895,972941..973999,
FT                   974051..974367,974427..974520))
FT                   /locus_tag="CND03540"
FT                   /product="DNA-dependent RNA polymerase II RPB140, putative"
FT   CDS_pept        complement(join(970379..970426,970487..970644,
FT                   970701..970755,970802..972895,972941..973999,
FT                   974051..974367,974427..974436))
FT                   /codon_start=1
FT                   /locus_tag="CND03540"
FT                   /product="DNA-dependent RNA polymerase II RPB140, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42897"
FT                   /db_xref="GOA:Q5KIB7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB7"
FT                   /protein_id="AAW42897.2"
FT                   /translation="MDAADDYPLASQPLDDGFTYDPDYDYSQQTAPKGDEDEEKYDVDE
FT                   DEPISQEDYWTVINSFFEEKGLVRQQLESFNEFIENTMQEIVDDHSRLTLDQFTQYTGV
FT                   AGDETRRYEISFGQIYLARVNHTEMDGRTNMLFPQEARLRNLTYSAPLYVDIKKRTLTA
FT                   SGVDDPVEADWQPAVGDDGEVEGAEEEKTSIGKVPVMVRSNFCLLHGLPDDQCHEIGEC
FT                   PYDQGGYFIISGSEKVLIAQERMATNHVFVFLKAAPARFTYFAEINSQKEKGGRVANHT
FT                   EVRMYARASGTTGGVIRVSLPYTKVDIPLVVVFRALGIVPDRDVLSHICFGAEDEALLE
FT                   MLQPSIEESFAVQDRDTALDFIGRRGQHEKAPRAQRQRAAFDILHKEFLPHVSTAEGFE
FT                   SKKAYFLGYMVHRLCMAALGRKELDDRDHFGNKRLDLAGPLMAEMFNVVFGKLREDMYR
FT                   YLKKCVEQNKEFALNMAIRPNTITDGLKYALATGNWGKRDNTRAGVSQVLNRYTFASTL
FT                   SHLRRTNTPIGRDSKAAKPRQLHNTHWGMVCPAETPEGSACGLVKNLALMSYISVGSYS
FT                   APVMEFLEEWGLEDLSEYQDAPTATKVFVNGVWMGIHRDAPTLHNNLLQMRRGGQLKYE
FT                   VSIVRDIRERELRLYTDAGRVCRPLFIVDQPTQTLRLKRDHIDRIDQMADEGLLSGAWD
FT                   KLLSEGIVEYVDAAEEETILIAMTPEDLVNARTAHSKHELVRDRAAHNLESFDPAARIK
FT                   STVWSQQYTHMEIHPSMILGVCASIVPFPDHNQSPRNTYQSAMGKQAMGVCLTNYQLRM
FT                   DTMVNVLYYPQKPLATTRSMEYLKFSELPAGQNAIVAIMCYSGYNQEDSVIMNQSSIDR
FT                   GLFRSLYFRSYTDTEKMKGMVKAETIEKPDRNETLRMKHGTGDRYAKLDVDGLVAPGTN
FT                   VNGDDILIGKTAPLPEDSEELGQRTQLHTKRDISTPLKSTEQGVVDQVMLSTNGEGNMF
FT                   VKIRVRSTRVPQIGDKFASRHGQKGTIGITYRQEDMPFTAEGLVPDIIINPHAIPSRMT
FT                   IGHLVECLLSKVSTLTGAEGDATPFTELTVEAVSKVLRAKGYQSRGFEVLYHGHTGRKL
FT                   QAQVYFGPTYYQRLKHMVDDKIHARARGPLQILTRQPVEGRSRDGGLRFGEMERDCMIS
FT                   HGIAGFLKERMYDSSDAFRIHVCDVCGLMAVANLKKQEFYCSVCRNSTQISQVYIPYAA
FT                   KLLFQELQAMNIACRMYGETD"
FT   gene            974675..976331
FT                   /locus_tag="CND03550"
FT   mRNA            join(974675..975032,975082..975207,975261..975366,
FT                   975420..975441,975491..975640,975705..975844,
FT                   975892..976007,976063..976331)
FT                   /locus_tag="CND03550"
FT                   /product="rRNA processing-related protein, putative"
FT   CDS_pept        join(974700..975032,975082..975207,975261..975366,
FT                   975420..975441,975491..975640,975705..975844,
FT                   975892..976007,976063..976257)
FT                   /codon_start=1
FT                   /locus_tag="CND03550"
FT                   /product="rRNA processing-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43219"
FT                   /db_xref="GOA:Q5KIB6"
FT                   /db_xref="InterPro:IPR008610"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB6"
FT                   /protein_id="AAW43219.1"
FT                   /translation="MPISKKETRKLKSNKKLAPSKAEESKSLDKQSYVPDEQIESGDED
FT                   DQDVSEEGMKRLMELVDVDDLNEYERALLGAEQGEEDEEGGSEGEEFEISAGESVDEDE
FT                   EEQGQNKKQDNTIINEKPDDDVVSLDGLGSDVSVDEDAVPMQKVTINNKPALRALTDSI
FT                   RVTNMSWPEHLVLDSKETADVDPSDDLQRETVFYKIALGCIPQARKLASKHDIPFTRPG
FT                   DYYAEMVKSDEHMERVRTKLVEEAQGIKKSEDAKKQRQLKKFGKQIQHEKLRQREQDKK
FT                   SFEDRVQGLKRKRKEGMELGDEGEEFDIAVEDAMEEQPQKGGRAAPGKSKMPRHARDAK
FT                   FSLGGGGRRSKQNTRESTMDFGGGMSRGKGGKADKAGKVQSKGRPGKSRRQAGRV"
FT   gene            977354..978543
FT                   /locus_tag="CND03560"
FT   mRNA            join(977354..977558,977631..978543)
FT                   /locus_tag="CND03560"
FT                   /product="hypothetical protein"
FT   CDS_pept        977692..978315
FT                   /codon_start=1
FT                   /locus_tag="CND03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB5"
FT                   /protein_id="AAW43362.2"
FT                   /translation="MFCDTQQPHTSPSTYIHQHSTMSSHSHSQVSFPSSYLHHSQPHIS
FT                   SLTRPSFPPAHSSPNVLYSSQSNHASPSSYQAYTAPSSPGGSPSGATVSQSQQARRFAR
FT                   PKPLKKSSSTNGKHRNVQVSLEVKVEKAKGFHAFFVPHCKGGVPPAPPCSPVLGHGSLK
FT                   ERRDMDGGNEATSLDYFGTWSKHGEKESEQWVENVEEDMEVDRI"
FT   gene            complement(978477..980382)
FT                   /locus_tag="CND03570"
FT   mRNA            complement(join(978477..978619,978683..978706,
FT                   978769..979003,979047..979077,979132..979216,
FT                   979273..980382))
FT                   /locus_tag="CND03570"
FT                   /product="arginine biosynthesis-related protein, putative"
FT   CDS_pept        complement(join(978608..978619,978683..978706,
FT                   978769..979003,979047..979077,979132..979216,
FT                   979273..980316))
FT                   /codon_start=1
FT                   /locus_tag="CND03570"
FT                   /product="arginine biosynthesis-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42895"
FT                   /db_xref="GOA:P0CM20"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM20"
FT                   /protein_id="AAW42895.1"
FT                   /translation="MPPSIPVPSIVTRAIPSLARAASTTTKSTPSKEHHVHSYSPEVLP
FT                   LGYAVASTHASIKKKTGALDLGILVSTTDKPASAAACLTRNVFKAAPVTVTTQLLQSGG
FT                   GRARGFIVNSGCANAVTGKKGLEDAWEMSNTVTSQLPPGQRGIGTLVMSTGVIGQPLPI
FT                   SSIISKIPELVRSLDDSPKSWLDLSKSFMTTDTFPKLRAKSFRLGERLVRIAGIDKGAG
FT                   MIAPSMGPPQPPHATLLGVIATDAAISPPALQSALNYAVDRSFNNITVDGDMSTNDSII
FT                   CLANGAAGKLETQGRETAESMEEITEDGHPEEYKVFREELRSFAEELAQLVVRDGEGAT
FT                   KFVTIRVKNAPSYETAQAVAKSIANSSLFKTAMYGEDANWGRILCAVGYTPTAQAIIPN
FT                   HVSVSFIPSANVSDPTPLRLLTNGEPEANIDEDRASVILAEEDLEVEVDLGDGHEEAKV
FT                   WTCDFSHEYVTINGSYRS"
FT   gene            981983..984230
FT                   /locus_tag="CND03580"
FT   mRNA            join(981983..982100,982212..982289,982376..982531,
FT                   982596..982834,982898..983013,983078..983148,
FT                   983201..983380,983428..984230)
FT                   /locus_tag="CND03580"
FT                   /product="chitin deacetylase, putative"
FT   CDS_pept        join(982390..982531,982596..982834,982898..983013,
FT                   983078..983148,983201..983380,983428..983912)
FT                   /codon_start=1
FT                   /locus_tag="CND03580"
FT                   /product="chitin deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42893"
FT                   /db_xref="GOA:P0CP76"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP76"
FT                   /protein_id="AAW42893.1"
FT                   /translation="MYGHLSLSTLSLLAVVAAAPFPESWLQPRDSDVSQLFRRGAPDPK
FT                   ASDYLSYYPSPGSTPNVSTIPQAWLDKLATVQLPNVSVATANDGRPTYPNNENDGDSEI
FT                   CSFTDQCYVEDDLYSPPGEKVWALSFDDGPTDVSPALYDYLAQNNISSSATHFMIGGNI
FT                   ITSPQSVLIAIEAGGHLAVHTWSHPYMTTLTNEQVVAELGWTMQALSDLNGGRIPMYWR
FT                   PPYGDVDNRVRAIAKGVFGLVTVLWDSDTNDWAISDQPDQYSVASVEAYFDTLVTGNRT
FT                   QGLLLLEHELDNNTVEVFETEYPKAVANGWSVKNVADAFSMKWYLNSGKGNDDVVTTMS
FT                   VAGTLTTAKPTHTSTSVASATATSSASVTDSAGVSIASAASSQESSSWPIANRPSLFVI
FT                   ACGLALAAIMV"
FT   gene            987149..988785
FT                   /locus_tag="CND03590"
FT   mRNA            join(987149..987454,987510..987739,987792..988038,
FT                   988091..988237,988303..988389,988444..988613,
FT                   988675..988785)
FT                   /locus_tag="CND03590"
FT                   /product="enzyme regulator, putative"
FT   CDS_pept        join(987227..987454,987510..987739,987792..988038,
FT                   988091..988237,988303..988389,988444..988613,
FT                   988675..988690)
FT                   /codon_start=1
FT                   /locus_tag="CND03590"
FT                   /product="enzyme regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42891"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB2"
FT                   /protein_id="AAW42891.1"
FT                   /translation="MDQQQVSPSISSDVQQSANQHVPSQAKPRARLGPTEVVQLPASDS
FT                   EPDDEDGNNQETDAGGDGSPDFLKDYPEDTEDLQLLHLRLKTPLLVPLNFPRFGNHLKR
FT                   LCLRQNELTSPLPSGAFANLTELEELDFYDNRLGPHVRDEELAGCPNISTLDLSFNNIR
FT                   HAPSLPSLQHVNTLYLVQNKISRLEKGELDWCQDTMKSLELGGNRIRVIENLDKLIHLQ
FT                   ELWLGKNKIRVLENLSTFSSLRILSLQSNRITKLENLEGLVNLEELYLSHNGLQKIEGL
FT                   HHNIKLTTLDVGNNFIKEIENLSHLSNLEEFWASNNQIGSLHALESELRPLTNLCTIYL
FT                   EGNPCQKEDMGNYRRKIMLALPQVKQIDATYVKA"
FT   gene            complement(988773..991587)
FT                   /locus_tag="CND03600"
FT   mRNA            complement(join(988773..989320,989373..989785,
FT                   989832..990810,990911..991587))
FT                   /locus_tag="CND03600"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(988970..989320,989373..989785,
FT                   989832..990810,990911..991327))
FT                   /codon_start=1
FT                   /locus_tag="CND03600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43252"
FT                   /db_xref="GOA:Q5KIB0"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIB0"
FT                   /protein_id="AAW43252.1"
FT                   /translation="MSVAVPPPILLATRPTIMSKPSAPRIQSRPSPSSTSSLSTRPVAA
FT                   KSTQSPLNSAISSGSTPKVAVKSVATNIPTSARPSPAPRANSSSSTSTAVAATPIMGKD
FT                   TSSSAGKIFAKPSKEWVLPERAKPGRKVSNDEPDNKRQSQNRLSQRAHRARRTDYIQTL
FT                   EERLRQYEADEIHSNVRLQEVARALKADNERLKAEVNELKNKCMEYNGEKDVWEMERRT
FT                   LKEAVRDMRIEIEALRAGSGMETIVRMDIDQSTIDSLVPGPSIPRRQSAHRLSPRSASR
FT                   PGNVTLQDCPICPNPDPDCPCQRPHARQEQYPPEHLTLAPSAAEDHAVACGLCHSTDEC
FT                   LCRAVDEDVKPDISSPSHDLKTLDDDRCGLCTGGDFCACREAAAAASVRTSVTSDTKTT
FT                   VATTTAVSGIVTASSSSAALPLRLRTKGNGSAKASIWSLNAAPAVSREAICTGDPSNCD
FT                   ACRDDSFGREFCQHLFEAAESSSSVKPCSSCPGNCMNVKAGLSPSPGITQASSSSSNQI
FT                   RTPPTPPVNQPSAVEDDTPLAPLQMVCCGNAELCGGSRGGGCTDDIIGIGGPSGALQAS
FT                   MSFPSVPEVDEDDNATLRPDQAWKQLKAHPNAKFASLALLADVVARRTKCLGPRVEMSP
FT                   TPASPAPTVSVPMSVPVIAHSASSRPRQPMLGSPDIPNTQQKRRNIEVETSAVRDALKL
FT                   LDKATPAPSPEPDRELKRRRIERIL"
FT   gene            complement(991999..997233)
FT                   /locus_tag="CND03610"
FT   mRNA            complement(join(991999..992456,992532..992573,
FT                   992635..992704,992797..994232,994303..995415,
FT                   995470..997233))
FT                   /locus_tag="CND03610"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(992361..992456,992532..992573,
FT                   992635..992704,992797..994232,994303..995415,
FT                   995470..997164))
FT                   /codon_start=1
FT                   /locus_tag="CND03610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43251"
FT                   /db_xref="GOA:P0CO26"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR024657"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO26"
FT                   /protein_id="AAW43251.2"
FT                   /translation="MAPHEKGVNPSESPSGSLKKAPPSGPKALRGFASPSAFRNADIGN
FT                   GLLQHRGEDERISFAFPRKGKESLDRNGERPAPMSLESRLGPPVSRFNRPVGGDSLERG
FT                   NGKGGWDNRDERTSASSSSIHRINKEKIRPRSDFIESSANLYSEDDRNRDRGRYHERDR
FT                   SRGTNGDRGGGEGHSHREPGRGKEHQNGQGRDRSLYRDHSRERESSRDERDRYSEEYKH
FT                   QRSKARFSPSPSPERSRLKSSLGRHRSPVSVSSSSSSSARSPPPVQNREPLRYNGSQSK
FT                   NGEKELSNGLLENSISRSGVSIAVPRKLETKQLVRPSPPHVNLKSTIQDNPSPPTGKYP
FT                   PSPPSLDILSKPSCNREPLPDQRPPTPPLPENSSPTSPSLESSRFDQNQHLLPDELPLP
FT                   PLSISFPQKPVSSSSLSRLSSLSAALSRPNPLDKDGTSMPPSFHFREISTRHQRLSPPN
FT                   NAENQLPETSIIPPPPSETVPEPPWIRPPYIPPPCTKHRPGIGNFFITNLREKVEDKSG
FT                   KEEKRVDGMEGGKVVQVTDPRLSMTEEQRGRGRGSSKQRAAFYELTYEWDLYSVTPKPP
FT                   SPPTAVLITGLGPLTTVDQITKFLRPHGRIKEIDSKVDRKTGMQLGICWVKFEGPPLGR
FT                   PGTAHDVASMAVKVCDGKKISMGGERIRVVLDGRGKRAEQAVKEEMERRYPPKKPSALP
FT                   SDMKVTPLSGTAMATTSRPPNAPNASTPLIDKQTFDTSAKAPIIRPGVLKPLGQKMYHR
FT                   PSAPPLVFNNHRFRDESFLNRPFNAGAGMISQQQMGYKILPGKPVQQLASSFTSAPFVR
FT                   HPRERREDSWTNERGRRLKGESSTRHWRARSLSRSSYSSYSSYSSYSEESEEERPRHPT
FT                   KVPYPQRKRLATGPSKEDEYKMEDVREAIRENGHPCVFIDAKSLPAAREYESYLRDHFK
FT                   AFRPTEIIHSHLGWYILFADDTTAYRVQRVLDTTAVQGHRLSLVVHTSSGPRAQTDASE
FT                   PVTGGVGESKKGNWRYLTITKKSRPMPAVKKSGKSATIRRKVYSPSVSGSDDDDEQVPV
FT                   MAQNRKRAPSYASSTSPLSEDDRPFARSVQREERDIDKEGKFSLIGKKEDVVSVKAAKG
FT                   PKSKTIRVDSDEVEENQGVPLASIGEVTKAEGKQDDSTVVKLETLLSESISELTKGKKR
FT                   PTKAKGGKATKKVRLDQEADDAATKIQIDEDIVPQPPKKKKVVKTEVDKLLASGVLMDE
FT                   EDAYWLGRVLAAQEDGLEPIWSDGEEDLVDEGHPLFHKSGAWRAEGWKKVAQVQKSRYL
FT                   PQRNRAVVNSEDVGGITTGRTARLAGRDQHRQTAAVAANNTVESDLFAFNQLRIRKKQL
FT                   RFARSAIEGYGLYAMETIHAGEMVCEYVGDLVRATVADVREQRYLKQGIGSSYLFRIDN
FT                   DIVCDATFKGSVSRLINHSCDPSANAKIIKVNGQSKIVIYAERTLYPGEEILYDYKFPL
FT                   ESDPALRVPCLCGAATCRGWLN"
FT   gene            complement(997533..999616)
FT                   /locus_tag="CND03620"
FT   mRNA            complement(join(997533..997801,997853..997918,
FT                   997967..998117,998173..998739,998790..999616))
FT                   /locus_tag="CND03620"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(997641..997801,997853..997918,
FT                   997967..998117,998173..998739,998790..999338))
FT                   /codon_start=1
FT                   /locus_tag="CND03620"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA8"
FT                   /protein_id="AAW43250.1"
FT                   /translation="MSKLAVTPVNKSTGLMRRHPSIRASDRSPFGSISEGVKVQLHYLP
FT                   PTAFIVDHSPPTFHRADTVGEPDREGAKITPFPDEQSLQIFENARIKVQDDDPFGAGHR
FT                   QLSKNKGPKTFSSVAPERSSHFGSRGSIRPQLSNHHSQGYRHSSASGPRDLQLLQQVSR
FT                   SASMEKMPPPSDIIQQKREHLSNNNHTNPHLAVQGHSGVSRLSQSGRDVSQSHPQIVCP
FT                   TNTFVDDCPQIIAEPSQYMSRDSETLDQPPNVTASQQRGQELNLHYDKHFHTPTTNRHQ
FT                   VEANINHPDHCGSSNVAGTHGHVHRPDASLDDEFVAKGSFQGLIFEDDSSMTDFDGTEQ
FT                   TPKRTPDKRRAMDNESENIFNFTPRAEGHPNPRKNKRCRFVIPKGFSDHLTIIKGVDPQ
FT                   DILFKRMKTTQVFDHGGKWTGPNEILEGQINQFESIRRRWEGFFGRLEDLVQTKDAVLQ
FT                   HKQELTKQYADAGEQLAEQCDEIQLATRHTHKRRRICIA"
FT   gene            999890..1002852
FT                   /locus_tag="CND03630"
FT   mRNA            join(999890..1000016,1000062..1002852)
FT                   /locus_tag="CND03630"
FT                   /product="expressed protein"
FT   CDS_pept        1000079..1002721
FT                   /codon_start=1
FT                   /locus_tag="CND03630"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43262"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA7"
FT                   /protein_id="AAW43262.1"
FT                   /translation="MSNKVNGLTCLSSALRNKRPKISLRLCKSQPLASEIPLPDGPGCS
FT                   RWLSCSCCRPNISKRTFFTSNHLSEASVVGSPLTKGLERPSPEEEQRPILFVPDTSVAT
FT                   PHLPLPPTLPYSPNSHPFRRHLSILSLSLLSTDTDKSWFVYTALHPSLRRHLPDEMFRA
FT                   LLTKQTGHGDGKEAWKRVRELLLLSKQCEMDLEEIGKEALEKCLTLGLDLALRVGKTDP
FT                   KTVKLLRKLWKSLASLSNNLETIPLHLRQDWLHLQAILLDLRQKHETRAWRLNRPSPME
FT                   ETILEMVERNGLSGLGPTVGRILLRMRGGSEEGLKQALRLVAWSVNKKAEVKMENVVEV
FT                   MTRLGAAWGTEGRDGMRTLELEIDTILKEVEALPCSPAEELFGQALRSVEGKINLLKNT
FT                   LSSLEDRTLDYESLTRKCFELCAKAKRVKENEILPIMEATLRLLEIALQYPEEDPIPLI
FT                   TSISKTLHQLLRSPLSPCVSPPIVRFTQLILQARILPALPPHVVVPLFRLIIAALPSDD
FT                   SYILSRKVYEFARTANPPFIWSESNSKQWRSLFQSALSRDRKHLHFASRLYADYISDGL
FT                   PVRRADALLMIRSIGSKPSPSRPILLERHIKDYLWFAYGRRPALVKAVVQGLTGAGVRD
FT                   SELALNLAQRLSLDKELQPLIILMIIGQLARSSQPAHRVKCFALLHQLSPITHPEETKW
FT                   AYNTVLSYLVSSALPFPQLGNTAHEEIMPLVLSVYKNMIDRGIEPDGRTAGTIIRMLTD
FT                   YGLIDEALAVFGSCLDRGLAPKSHAIGRMMVRLALAKRFEEALQVESRWREVTTGIDSQ
FT                   KKIRAYDKGVVGARVLVDVMMGKSVDLSAAARKGWKGNKEFLEFLESLKPKQDEAKEEV
FT                   ARIDAVEKR"
FT   gene            1003157..1004683
FT                   /locus_tag="CND03640"
FT   mRNA            join(1003157..1003463,1003534..1004296,1004345..1004683)
FT                   /locus_tag="CND03640"
FT                   /product="expressed protein"
FT   CDS_pept        join(1003282..1003463,1003534..1004296,1004345..1004401)
FT                   /codon_start=1
FT                   /locus_tag="CND03640"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA6"
FT                   /protein_id="AAW43265.1"
FT                   /translation="MSATSDELVRFFPSATHEALPISIRILSTLRNLTGPGKGNELKSE
FT                   ERAALVGVAAVLACEQIQSKDLPEQSAQKASSVSASHFRSALSLSRRLLSQQASMSPQD
FT                   SRNKRGDSEDAASLSSGGGLTTQEVLALVTPKTKRYSDFSLSESLANRPVRGSPLRQSV
FT                   ARVASSAPKGQLGPEVTPGRSETASTNHNTELTPTKSAKFVNPRGINLEHPQSSSIPHG
FT                   KRKRNEDASPFFALRPAMSSAAYPSRSATETNRVKGMDTEDGQNSSWLRRLPEPQISKV
FT                   QQQRTNAKRRRNKRDWTFSEHCEEWKEGKVSVDEIMIELSDWMKKQETNSGG"
FT   gene            complement(1004415..1005535)
FT                   /locus_tag="CND03645"
FT   mRNA            complement(join(1004415..1004596,1004658..1004779,
FT                   1004828..1005058,1005115..1005204,1005275..1005336,
FT                   1005440..1005535))
FT                   /locus_tag="CND03645"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1004463..1004596,1004658..1004779,
FT                   1004828..1005058,1005115..1005204,1005275..1005336,
FT                   1005440..1005472))
FT                   /codon_start=1
FT                   /locus_tag="CND03645"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LII8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII8"
FT                   /protein_id="ALO60530.1"
FT                   /translation="MATSKIRSSNAKSPTVLAPHLPIIDKLPNGQRYTISLLSPSSLTL
FT                   QSQDVLYRLLDHNMRSLQSNSSFPYTEISKKEEMFDPTSRFLLVLGETPMDTRDEVPPK
FT                   KRQIDIQEHELFGFCEFRFDVEETLSEKLAEVVYCYELQLRPSVRKQGIAKQLIGILED
FT                   IGRLRKMEKIMLTCLKNNASALSFYRRQGFEADEIDPTRMSEEEPENGEEVDYVILSKP
FT                   L"
FT   gene            1005632..1009946
FT                   /locus_tag="CND03650"
FT   mRNA            join(1005632..1005716,1005770..1005858,1005911..1005949,
FT                   1005992..1006092,1006150..1006294,1006346..1006798,
FT                   1006854..1007206,1007267..1007390,1007448..1008165,
FT                   1008228..1008506,1008556..1008660,1008717..1008835,
FT                   1008888..1008967,1009033..1009192,1009252..1009328,
FT                   1009393..1009946)
FT                   /locus_tag="CND03650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1006050..1006092,1006150..1006294,1006346..1006798,
FT                   1006854..1007206,1007267..1007390,1007448..1008165,
FT                   1008228..1008506,1008556..1008660,1008717..1008835,
FT                   1008888..1008967,1009033..1009192,1009252..1009328,
FT                   1009393..1009802)
FT                   /codon_start=1
FT                   /locus_tag="CND03650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43267"
FT                   /db_xref="GOA:Q5KIA5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR021841"
FT                   /db_xref="InterPro:IPR026825"
FT                   /db_xref="InterPro:IPR032878"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA5"
FT                   /protein_id="AAW43267.2"
FT                   /translation="MLSSNNSALHTRNGGLIGLAATAIALGQDVAPYLGQIIPPVLACF
FT                   QDPESRLRYHACESLYNIAKVSKGEILVHFNEIFDALSKLSSDSEMSVKNGAELLDRLM
FT                   KDIVAEAAPSYVSIYPDNRNPSLSLGSTAGNRSLTMDSKSHDGYQDMRDAEHFEDNRAF
FT                   SLERFIPLLSERVYVISPFTRMHLVSWLMVLDSIPDLELVAWLPEFLDGLLKYLSDNNV
FT                   DVRLAAENVLAEFLREIKYIAQVQDKQAENERTAKDARETIESKKREIGSKDGSVFQND
FT                   SESEEGEVQGEADEEHNWEGEGSGAWVPGQGVLVDHAAIMEIIIHNLSYDDELVQSTAM
FT                   EWILTFLEFAQDTVVAFTPQIVPAILPNLASSHPQIKMAAYDTNSSLYHVIQSIALQVQ
FT                   RPRSLTEAPYTAPLVGTNSSLAGSPPLSLTLTSASTKKDPIIEVNDSARSPPAAPVSDP
FT                   LEAATVPPVINTVSSPVTVSGGIAQRGPTSSMLTSGLGHKTRQSATISLHQVSEPVTPS
FT                   SNDAPAISIANPAKGAKVQSDNASATAPPVQPLTLTSSLLSPKAETQQTMEEDQDPFDV
FT                   KETVNVLTLQFLSDHAETRIAALEWLLMLHLKAPDKILSRDSGTFPALLKTLSDPSEDV
FT                   VKHDLQLLAQISSSSEDSYFTSFMIKVLELFSTDRRLLEQRGSLIIRQLCLHLNAERIF
FT                   RTIAEILEKDDDLEFASMMVVKLNMILITSPELGDFRRRLKNLDSRDGQMLFSSLYRSW
FT                   CHNAVAAFSLCLLAQAYEHASNLLQIFADLELTVQLLVQIDKLVMLIESPVFTYLRLQL
FT                   LEPDKYPWLSKCLYGLLMILPQSTAFISLRARLQVVHSSGYVPTTTKPPSTAAFGPTRS
FT                   KIGKDEIRWQELLSHFRNVQNRHEKARRQLNSTDIGSTQGSMHYPSPFQNYSSNTSVPG
FT                   PSAVGSSSKGTTRKKATTTTSNSKQGSTDIRSGTSPLNPKRGASNSTNGTGLVSLGGAV
FT                   ASMNATQGLGIRPTSPGRKRILGGLRKGGSRD"
FT   gene            1010093..1013205
FT                   /locus_tag="CND03660"
FT   mRNA            join(1010093..1010297,1010355..1010630,1010696..1011055,
FT                   1011105..1011183,1011230..1011742,1011804..1011875,
FT                   1011927..1012222,1012274..1013205)
FT                   /locus_tag="CND03660"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1010163..1010297,1010355..1010630,1010696..1011055,
FT                   1011105..1011183,1011230..1011742,1011804..1011875,
FT                   1011927..1012222,1012274..1012972)
FT                   /codon_start=1
FT                   /locus_tag="CND03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42888"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA4"
FT                   /protein_id="AAW42888.1"
FT                   /translation="MSACTVTFVFDSALPLQQYTKLVQPDGIIYKLIQRLEEKHGGNHY
FT                   LHVSVLITPPTSSNRSIKKSMSKAFRSEYGSASTFLAALPKLSVLFPPRSLTPHHWPQF
FT                   DPRILPSETRAKDVKRKRSEDVRILDGVVGGLELLERPQPIHGPSPSQAYMSLTPNTSA
FT                   PLLEYICTPSNAMQDSPLQRYLVMVSMATSAPSPSYDGSVDVFAHYNWDSIWDGRGWAA
FT                   LEQECKKGNVKCSCIIAGVTGNENRAKKIKELCEAVAEHVDEAWFKVPPTVELVLSGFV
FT                   IEADNTYTPPRDMASTTAEPTTAPVSLPPANKPDIRVLQQALSQSQSRSSLEAGLGSSF
FT                   NPATLSKMDPQLIASMLTAIKAQNEQQGVGDQRRSQVQQLLEMQQKVLAAKAAQSRGKN
FT                   GQGETVMAAIQQQRAQQAQASGQPTQVHSVQPRSQTIWSGAIVWGAPGGSGSNASGSVG
FT                   VEAQLFSGIPDSVMVSHWPKELLLRNLAIIHLPSLTEYAKENSCPIIAFMPSDKTPSGT
FT                   TPNPGMMHYNQLGTSLNAKSNMVVIPFPSIGPDRGLLIFSAPVGGTSAGRGFRLMGIAC
FT                   VHVSFPPLQMVNPRAAPTTMDPRRAPVNTSTLQQPPTGTSQNQQFRPSPVLQQDLVNQF
FT                   NQGQSQGQATPAAQFAALMQQQAQAQSQTQSRVLQSQPPQLTPQGQNPPINSSLPHPQN
FT                   TTRGITFQQYQQILSHAQKLGIVLPAFDYTSIPQDKLQTLINGLKMAEMKQRQHAQAQQ
FT                   AQAQQQQQQQQQQQQQQQEQIQAQMAQMQQMMAQQSQSGQGTSGAGIGLRNFQPGP"
FT   gene            complement(1013391..1016584)
FT                   /locus_tag="CND03670"
FT   mRNA            complement(join(1013391..1014713,1014765..1015482,
FT                   1015532..1016119,1016169..1016584))
FT                   /locus_tag="CND03670"
FT                   /product="RNA ligase (ATP), putative"
FT   CDS_pept        complement(join(1013431..1014713,1014765..1015482,
FT                   1015532..1016119,1016169..1016582))
FT                   /codon_start=1
FT                   /locus_tag="CND03670"
FT                   /product="RNA ligase (ATP), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43331"
FT                   /db_xref="GOA:Q5KIA3"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA3"
FT                   /protein_id="AAW43331.2"
FT                   /translation="MSPAPPPPQPSTYASKHPESTPRLLSALRDLHATDPKAIRTTVHR
FT                   YPAALYAHGQNEHARDRLITSWKMTEHMYFKKSLVFPTLARGLFTEEVLEGDPVPPLEA
FT                   CSGQIGSDPDAPRERIVLRGYDKFFNTGEVSWTEWDAMKQHTQGPYYLTLKSNGCLILI
FT                   SALSPTHLIVASKHSLGTTTAAEGVDLSGSEKLIDKEKPAQKCGDSALGPEISQIRTIP
FT                   SFPPTVGSLDKHFKDLTLEQSQANQSLSKNALKKAEKAALKYAQKVINEGKSEDSAQIT
FT                   AAEEKKEIKENEEAQQHAEVGRRWLKRTLESSGKTEEELAQKLWEKNLTAVLELCDDSF
FT                   EEHVIATPEHWTGLHLHGLNSNTPHFSTSSPSDVATFAKEFGFIQTKYIQLETLEQVKS
FT                   FTADLAQSGTWEGEMIEGFVVRCTVKNGQDGMSQGAPPYRANSPFFFKIKFEEPYLLYR
FT                   QFREITRVMLPLLENTNPQKREEIWKKVRSRAKRPEVKLYSTWVGEMMKKEPELFEDYN
FT                   RGVIRVRERFLKWAEEDGKKKWDDARAGKIDKEQRAGDRDGLPKKWIVVPAAIPGCGKT
FT                   LLGVALSRIFGLAHTQSDDITAKRTAPTFIKNVTDLLATYDVVFADRCNHIPKHYDELA
FT                   KIAEDKKLQKFDTRLICVTWDLDTFPYYRLLRILSDRVVARGENHQTLRPDPTLDAEHE
FT                   AVVGRFIRDYTPPDPAIFEDIISVSVMDSAKVTLTKVVRGLTKSLGLTMPSEDVINQGL
FT                   EAASLYKTTTPYHPVARQGRSTRYFAVAPEINLYELACGAIEPFRDTEKGQSAWSFLDE
FT                   LYKRGRITAKPHVTLSHENNVKAEMEVRNRTGAREGRDDSELAQSPGPEEILWETCKSI
FT                   ATSKYPPLYSFSLTHLVWDDRTMAFCLSGLSPVISPTPDEPDGAASPSLCPDLDSVLPQ
FT                   ATKTYLHVTVGTRDADVPAFESRSLVKIVRERLEAGEQEGEIEEVVANGGNVKWMKIGL
FT                   ARSEGRIRGMA"
FT   gene            1016815..1023594
FT                   /locus_tag="CND03680"
FT   mRNA            join(1016815..1017197,1017374..1017634,1017688..1017746,
FT                   1017794..1018572,1018621..1021164,1021215..1022766,
FT                   1022822..1022920,1022973..1023090,1023152..1023284,
FT                   1023338..1023594)
FT                   /locus_tag="CND03680"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1016992..1017197,1017374..1017634,1017688..1017746,
FT                   1017794..1018572,1018621..1021164,1021215..1022766,
FT                   1022822..1022920,1022973..1023090,1023152..1023284,
FT                   1023338..1023433)
FT                   /codon_start=1
FT                   /locus_tag="CND03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43269"
FT                   /db_xref="GOA:Q5KIA2"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA2"
FT                   /protein_id="AAW43269.2"
FT                   /translation="MDGAQDSRSQPPQPHSEQSSNPIHPNSNIRRSSRLSISTTAAELP
FT                   STASSRGKKRVTIDEASLHSTDRKQPPQPSSSSIPGPETDRKGKRRVTQLSSSAETPPT
FT                   KKPKRFSASSAGSTSTATKRYELRTKPEDQVSTSVKEEEKNKNFKNMPSKSNPRKGSGF
FT                   GNSSERGKKGETSARHLVSDEYDDEDDSLWIDEPEGDVTVAEESDMADDYDHEEDDEDD
FT                   EDGDGDENGDNDGPGGGFGNSAYDRLARLASESGVNLDDATAALFGSGFRAFGGVSSGL
FT                   SNRLRRLKKKLHSKRIATRLAALRECSELLLVSNEDTLGGTFSPTSFATEFVAILDGRP
FT                   NIEEGESDEEESVYDDMDEDAQLAAALALSSGDAPGTDGEEDEMECQLVACRCLAHLME
FT                   ALPGCGHALVQIGAVPILCSKLTEISYIELAEQTLSTLEKISAEYPSAVVREGGLGALL
FT                   NFLPFFSTNVQRTAVTAAANCCRNISSEHFSKIKEVFPILRDTLSSGDPRLVEQATLAI
FT                   VRTTESYRHNADHLEGLLDVPTVSAINALLLPSGGSPLITPSTYTHLLKALTTSARGSA
FT                   KVSIALLEAGMVNSIYQILTGVLPSSSEEGEHGDSSNAQGLAGSITDMAVLQNLSHRPK
FT                   EQVEEALALICELLPPVPKDGVFDAKAYSEKNLQRVKKGRKSDSPSDRPRRSSRVAEAS
FT                   SSTNTAGPSTPVALNKDSSDRSPSDLISALQANREAAAQRARKDAETQMQLRCDLCQSN
FT                   TELIGQFIKTVLPVLVDVYAASVVLRVRTKVLVGLVKAVSFAPEEQLNVTLKYVPMASF
FT                   LCAIISSKDNDAFVLHALQIVELLVTKLPDIYQVSFLREGVVYEIEALANSETKKEKAA
FT                   KEATKNKAGEVDNADSRPATPSNPPGASEIPGDLRSLLTLSGVSNQILFGQTSGQSTPR
FT                   KSSSHLDPHDANIIRARMLMAKKIFDTGGDNQKAASKVLANISDLVKRLCEPGASEADL
FT                   REALRETASQFSSVEQSLSSFELLQSGLVDGLLDFVKIQGQVSPADRQAMLFDIFSDKS
FT                   FSNPNPLTILVKRLHESLGRLESFDVETAFGGGSDPSRPSTSSVHRTMRIRLVADEGED
FT                   IPKNVSQLVITIQAIASIKSVHDYLRPRIADGNFGSGFSQMFAAYAAGRSGGAPGSSTS
FT                   RLLNALAGNPGSGASPGSHAAAPSVPARASSNAESGPSGGRSPQRRRSARLNPPGDAES
FT                   AADEAPTAAARVTSPSSSTLLSPTTLTTSERRPILPAMSMGMDFDDEEDYSEDEYDAPV
FT                   IDQVMEEDLAATGPSESVVNMDVTADGSRVEAKTPQGTRIATPQQNIPVTGPSTATFSR
FT                   IAPSRSSSYAGALKTEPTDWHLEFFLNGEKLDIHDTIYGAIYKHKHATGLSGVNDFVTT
FT                   PVIKFRKVEGPLPTKETVAERSSTTASSPLPSTFEPSVSSTSKILHLLRVVHDLSIDGR
FT                   DNLGDVKGSLDENLFVNNKLTAKLTRQLEEILIIASNCLPTWAIDLPKHFSFLFPFDTR
FT                   YNFLQLTSFGFPRLLLKVQQSSRSRDDMPNIANLLRRKVRISRTQLLESCAKVMEMYAT
FT                   FPGTLEVEYFDEIGTGLGPTLEFYALASKEFARRNLHVWRDEDPSIAGNYVHHPHGLFP
FT                   SPLPRASAELVASRLKWFKTLGQFIGRSMLDSRIIDISFNKVFLKLLLDKPIKKNLSTL
FT                   RAVDPSLARSLERLQGYYCVRKEIEALPIPASSRRTKLAALTVGDAKLADLALDFTLPG
FT                   YDIELKPGGAHIEVDDSNLGEYLEKVLDWTLGSGVAEQVKAFQDGFSSIFPIKSIKIFS
FT                   LDELYLLFGNADEDWSRETLEVAIKADHGYNQDSRAVQNLIEVMSSYNKEQRRQFLQFM
FT                   TGAPKLPIGGFRGLTPPFTVVRKPHEPPYKADDYLPSVMTCALYLKMPDYSSKEVLAAQ
FT                   FERAMRDGRGSFLLS"
FT   gene            1023842..1025390
FT                   /locus_tag="CND03690"
FT   mRNA            join(1023842..1024026,1024140..1024338,1024391..1024480,
FT                   1024545..1024691,1024761..1025390)
FT                   /locus_tag="CND03690"
FT                   /product="thiosulfate sulfurtransferase, putative"
FT   CDS_pept        join(1023910..1024026,1024140..1024338,1024391..1024480,
FT                   1024545..1024691,1024761..1025230)
FT                   /codon_start=1
FT                   /locus_tag="CND03690"
FT                   /product="thiosulfate sulfurtransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43312"
FT                   /db_xref="GOA:Q5KIA1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KIA1"
FT                   /protein_id="AAW43312.1"
FT                   /translation="MRLPSIANPYLRTARSFTTSAHLRVPLLLTPKQFNDLPKQTTLPL
FT                   DATWHMPNSPRSALAEYLNGPRIPNARRFDLDEVAELSVGKNPLSLTHMLPSAERFKKE
FT                   LEKLGIHKDTHVVVYDTIGIFSSPRALYTFKAFGHDKVSVLDGGLPRWIEEGNEVEMGE
FT                   AGEVGSSEYPKVQGPNKDWVRSYEEIVSNSQKPLSDPTAEIVLDHRPAARFLGINSEPR
FT                   PNLPSGHIPNSRSLPFTHYLVPATDKKPFTNYKPVPELKQVLVDGVGGEAMWDDIERRD
FT                   KPLVFSCGSGMTAAIGWLANELIRETEGKAPKSALYDESWTGYALREDSKIARNGHFKP
FT                   "
FT   gene            1025642..1026508
FT                   /locus_tag="CND03700"
FT   mRNA            join(1025642..1025861,1025946..1026024,1026102..1026231,
FT                   1026334..1026508)
FT                   /locus_tag="CND03700"
FT                   /product="protein transporter, putative"
FT   CDS_pept        join(1025837..1025861,1025946..1026024,1026102..1026231,
FT                   1026334..1026408)
FT                   /codon_start=1
FT                   /locus_tag="CND03700"
FT                   /product="protein transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42886"
FT                   /db_xref="GOA:P0CR98"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR027100"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR98"
FT                   /protein_id="AAW42886.1"
FT                   /translation="MSFLFGGNNRSVEGSVDPAKIEMAVAELDMITDVFNRLVNSCHTK
FT                   CISSTPLNHRYAEGDLLKGESVCIDRCTAKFFEVNKKVGERMSAMGSAAQATGSFGR"
FT   gene            complement(1026353..1027552)
FT                   /locus_tag="CND03710"
FT   mRNA            complement(join(1026353..1026854,1026909..1026962,
FT                   1027013..1027094,1027153..1027283,1027338..1027552))
FT                   /locus_tag="CND03710"
FT                   /product="protein-tyrosine-phosphatase, putative"
FT   CDS_pept        complement(join(1026690..1026854,1026909..1026962,
FT                   1027013..1027094,1027153..1027283,1027338..1027544))
FT                   /codon_start=1
FT                   /locus_tag="CND03710"
FT                   /product="protein-tyrosine-phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42884"
FT                   /db_xref="GOA:Q5KI99"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI99"
FT                   /protein_id="AAW42884.1"
FT                   /translation="MANKPPPQPLVQVPALFSIVEPGVYRSASPTPSQVPFLAGLNLKT
FT                   IISLTPEHPIKPLLQFVRTTGISFVHLGLTHWRRPGTDWRPVRYEIIKTALEAYILDTR
FT                   AHPVLLIDPLGVHQTGCLVGALRMMQGWNFASALMEYRAHAGSKHRYVDEQYIELFDSD
FT                   LINLPAPQYRPSWWLACDEADPQQVEALASSSGGAGLLADTNGRTQSIV"
FT   gene            1027747..1029744
FT                   /locus_tag="CND03720"
FT   mRNA            join(1027747..1028208,1028258..1028327,1028370..1028805,
FT                   1028864..1029358,1029411..1029744)
FT                   /locus_tag="CND03720"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1027831..1028208,1028258..1028327,1028370..1028805,
FT                   1028864..1029358,1029411..1029441)
FT                   /codon_start=1
FT                   /locus_tag="CND03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43313"
FT                   /db_xref="GOA:Q5KI98"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI98"
FT                   /protein_id="AAW43313.1"
FT                   /translation="MHLSALSPLLLALALANADANAQSFVPAHPRRHHARALAVADANR
FT                   PLLPRAGAVVDNGTLASIAADEAAASSTAATSTTAILSSVSSVSSGISATSSSTLASSA
FT                   ISSASSSETSSSIMTTSAVQSSSSAAVSSTTSSEEMVPSTTSSDIESSTSISSTEIIPS
FT                   TTSSTTSTSSVVSSTSTIISQTDVTSSSSSSSSPISSTAAHSTVVLVTTASRSATQSST
FT                   ASATSEADSSSTSSSGLSKSALIAIIVVASVVGLAAIGWTAFRKWKLRPRNRFDSKMMP
FT                   IDFSPQNDTMDDDFFEKTLERTTSQTSANRQRQELVAQLDDDPNRVAGVPEHDFTAGAG
FT                   VGAYGYHHDQYAGEQYEYDQYNAGYDNAYEHAYPPHPSHAMQHGYEYGQDGVLQQPATA
FT                   VTTDSEGYAELQRGPSIGSGSGHGHGQVPVMNDAGVHPGELQFPVADTYGLGRPTHGAD
FT                   GPYAQAANFRY"
FT   gene            1030166..1033805
FT                   /locus_tag="CND03730"
FT   mRNA            join(1030166..1030675,1030741..1030870,1030939..1031339,
FT                   1031407..1031705,1031760..1032161,1032216..1032494,
FT                   1032548..1032816,1032877..1032981,1033027..1033314,
FT                   1033384..1033499,1033551..1033805)
FT                   /locus_tag="CND03730"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(1030166..1030552,1030622..1030675,1030741..1030870,
FT                   1030939..1031339,1031407..1031705,1031760..1032161,
FT                   1032216..1032494,1032548..1032816,1032877..1032981,
FT                   1033027..1033314,1033384..1033499,1033551..1033805)
FT                   /locus_tag="CND03730"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1030824..1030870,1030939..1031339,1031407..1031705,
FT                   1031760..1032161,1032216..1032494,1032548..1032816,
FT                   1032877..1032981,1033027..1033314,1033384..1033499,
FT                   1033551..1033753)
FT                   /codon_start=1
FT                   /locus_tag="CND03730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43314"
FT                   /db_xref="GOA:Q5KI97"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI97"
FT                   /protein_id="AAW43314.2"
FT                   /translation="MHRGEECGESDGESPAKSRRLSFDSTASSRKLSLSSITTVSEAPP
FT                   LSNVMLSGPSHLLPPLHGTGLPIDPSEDSDPGRLSGGVQSILGLDTNLQRQQHGMFQSS
FT                   PSSSNAPSRATPFMGQSTPGSGFIDPANLNVASSSTIKNLIDIPNDDILSTPTIPSHPE
FT                   LLTFDPSWEWFGNLFGWGSDNNIDQDVGLQNSMFESNGVGPASSTDTLSAAWLLCTTPR
FT                   AGSPVTGEAVKAQGMADPFGRKDDTPWPNVFKPNVPDRPLTLGDVKASSNIRPPRTGPN
FT                   SISEASRNAMLSLIYLSHQPHWLMPDIDDFPDHDTLSDFVDLYFEKFHPMFPILHKPTF
FT                   LESDTPAVLLLSVAAIGATFADLKYRPLAVALCELVRRMIAWMRGSDQRAKFDRYALAA
FT                   FTLQTALGLACGSREMFYHAEIFRCSIVTTCRRLHLLRGLDTATDELYKRTEHPSNEER
FT                   YKAYLKDEEMRRLGWGVYFLDAQMSAMLLIPPIFMVNEARIHPPTDEALWEAPNAEAWA
FT                   SVIAKGEAPDPKLPTPRFLKLLSMSMAGQDGQIAMSDFTVGIVTYTIWRLLMDQRLLQK
FT                   AIGLGLSESGMDLASYPAQTDIFDTQPGYLLTRLATSTFPIRSPSYLRLTPAALYHHAR
FT                   LIFTRPGLIQRIKHVSGKYEPDMTEEGSLSWLKTWLADGSEVRRIIWHAGVLSELMAEN
FT                   PRGSIGELIWTFDCALLFWIVLKHAPQQLTSASPAAFFAANWLCITPPEMWISHGGQIT
FT                   FPLLGSSTTWTVSSMLRIFMDRLHKMPWGLAVQNRLVLNKLLEAEGAGD"
FT   CDS_pept        join(1030824..1030870,1030939..1031339,1031407..1031705,
FT                   1031760..1032161,1032216..1032494,1032548..1032816,
FT                   1032877..1032981,1033027..1033314,1033384..1033499,
FT                   1033551..1033753)
FT                   /codon_start=1
FT                   /locus_tag="CND03730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5KI97"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI97"
FT                   /protein_id="ALO60531.1"
FT                   /translation="MHRGEECGESDGESPAKSRRLSFDSTASSRKLSLSSITTVSEAPP
FT                   LSNVMLSGPSHLLPPLHGTGLPIDPSEDSDPGRLSGGVQSILGLDTNLQRQQHGMFQSS
FT                   PSSSNAPSRATPFMGQSTPGSGFIDPANLNVASSSTIKNLIDIPNDDILSTPTIPSHPE
FT                   LLTFDPSWEWFGNLFGWGSDNNIDQDVGLQNSMFESNGVGPASSTDTLSAAWLLCTTPR
FT                   AGSPVTGEAVKAQGMADPFGRKDDTPWPNVFKPNVPDRPLTLGDVKASSNIRPPRTGPN
FT                   SISEASRNAMLSLIYLSHQPHWLMPDIDDFPDHDTLSDFVDLYFEKFHPMFPILHKPTF
FT                   LESDTPAVLLLSVAAIGATFADLKYRPLAVALCELVRRMIAWMRGSDQRAKFDRYALAA
FT                   FTLQTALGLACGSREMFYHAEIFRCSIVTTCRRLHLLRGLDTATDELYKRTEHPSNEER
FT                   YKAYLKDEEMRRLGWGVYFLDAQMSAMLLIPPIFMVNEARIHPPTDEALWEAPNAEAWA
FT                   SVIAKGEAPDPKLPTPRFLKLLSMSMAGQDGQIAMSDFTVGIVTYTIWRLLMDQRLLQK
FT                   AIGLGLSESGMDLASYPAQTDIFDTQPGYLLTRLATSTFPIRSPSYLRLTPAALYHHAR
FT                   LIFTRPGLIQRIKHVSGKYEPDMTEEGSLSWLKTWLADGSEVRRIIWHAGVLSELMAEN
FT                   PRGSIGELIWTFDCALLFWIVLKHAPQQLTSASPAAFFAANWLCITPPEMWISHGGQIT
FT                   FPLLGSSTTWTVSSMLRIFMDRLHKMPWGLAVQNRLVLNKLLEAEGAGD"
FT   gene            1034050..1035622
FT                   /locus_tag="CND03740"
FT   mRNA            join(1034050..1034410,1034465..1034559,1034614..1034687,
FT                   1034739..1035399,1035464..1035622)
FT                   /locus_tag="CND03740"
FT                   /product="aldo-keto reductase, putative"
FT   CDS_pept        join(1034254..1034410,1034465..1034559,1034614..1034687,
FT                   1034739..1035399,1035464..1035538)
FT                   /codon_start=1
FT                   /locus_tag="CND03740"
FT                   /product="aldo-keto reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42882"
FT                   /db_xref="GOA:Q5KI95"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI95"
FT                   /protein_id="AAW42882.1"
FT                   /translation="MSGLSYCPRVGGYLKLSRTPTFTILPIFNSLIMSAPTSFKLNTGA
FT                   SIPAIGLGTWQAKAGEVRQAVAHALKAGYRHIDGALCYQNEDEVGLGIKDSGVPRSEIF
FT                   LTSKVWSSYHDRVEECLDTTLKSLQTDYLDLYLIHWPVRLAPNGTHPLFPVKPDGSRNL
FT                   DWDWDQAKTWAQMEDVLKKGKAKAIGLSNAGIPIIEHIIKTGKVTPAVNQVELHPYCPQ
FT                   HALLKYCKEKGILLEAYSPLGSTSSPLHEDPDLLAVAKKHNVPTATVLISYQVNRGVVV
FT                   LPKSVTPARIESNLKTIKLDEEDMNKLDKLAEGGKQTRFTAPPWGSDFGFPDWFGPGNK
FT                   DAPEGARLLAGKA"
FT   gene            complement(1035664..1040575)
FT                   /locus_tag="CND03750"
FT   mRNA            complement(join(1035664..1035973,1036028..1036549,
FT                   1036606..1038833,1038886..1039191,1039245..1040575))
FT                   /locus_tag="CND03750"
FT                   /product="GrfA protein, putative"
FT   CDS_pept        complement(join(1035896..1035973,1036028..1036549,
FT                   1036606..1038833,1038886..1039191,1039245..1040214))
FT                   /codon_start=1
FT                   /locus_tag="CND03750"
FT                   /product="GrfA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42880"
FT                   /db_xref="GOA:Q5KI94"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001331"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI94"
FT                   /protein_id="AAW42880.2"
FT                   /translation="MLYRPYNPQPMPSPQLPLAGPSLPSARHRPRTLSLHSYDSHPRHG
FT                   DQTHPPRKYTDPVPHASPSQREAQGQDQELDVDLDAYSAADFEADEDSPDRDPTLSFVT
FT                   ASTIDSVAGGPQVTTTYGHSSRMADAKGEQEPSLSMRSTSGRATTYSSAESSTGSGAFS
FT                   YHTYSDHIYTPPPPLPQVPDGYNSSDSPGMAADYPIPRSNADQSHARQIRPPLSPSHSF
FT                   THRPWKRDIVNRLRSDSASSAFTAASVSTDNSAASSSRIPLPDAAYHYAYDDFTLPYEQ
FT                   EQAEPEALAMIKEGREKLLNMEKIEAMGGAEALGDSVICSLAGVTHLLLPSCGRRILDL
FT                   LPRLLSVLAPSLVVLDLSDNNLARLPDSLQCCTSLEELNLSENPLRLLPQWMGNLTALR
FT                   VLVVDGCGLTVLPQGLCHLCFLHTICVRRNKLVCLPTWLCLLNQLETLKVDGNPFTPEW
FT                   AQIVPPILEGPFPMTASSSRRRNAHHRHLSINNGIRTPVSMASLESSDQEPNSASSSTP
FT                   NLDQSFGTASSSASQSTYLVSALSSIAENNLHSAPLPETHANGEALASPGPVTETPQSH
FT                   GGLRKMRSAGALLRSLDQSASNTTSNFTPPRPVIAERSATEGRRAASAMGNYHEEPQIH
FT                   PGKLVKSSTPKTTTPPTKTGRWGFLRKMSMNRLRPDKEKVAAIAASASDNLKSLPPLPP
FT                   IRHQHSEPIQHVTIRPGMVSTMSAATLPSRKIADFEGSEFGQMSSCSTPSALTMPISGL
FT                   PYQPSPMSIASIGFGSALRGKRRSFLPIDGPPSINVQIPTSAFSTAGSADNISQLATEA
FT                   PTSQTTALPYTPAQPMVGSPVTDTEYEERYTRGLETIKLILRDLHDLSRRSIMPRDGST
FT                   VMGNSSADSSYAGSTVPSEHPGSPLSSNRDSFINVRQARRPTLEGGDSRDSPAADSEEF
FT                   GEREPSLSGKKFKNDKSKRTRCIHEIWETERTYVRNLGELVTIYVRPASQPVNQSKSVV
FT                   ETVIPAAERKIVFGGVESILAIHRDNFLPALETVLKQLIENGDDEKGILSIDTAYSVGE
FT                   VFRTYIAYMKQYSTYITNFDNALARMKTWSLSNSGSSTPAFSGKSSAANASVNALSAGM
FT                   GAVSLSASAVPTTSGQSMSSSQRKRVKAFLKKAREHPMHSQISLESYLLLPIQRVPRYK
FT                   LLLTELAMCTPARSDGLRDALDDALTEISSLASLMNEEKRDADSRLRLLDWQKRFTNSG
FT                   RSPLVQPHRRLVMEGPLTLSRIVKKASTFVECETVVKGDGDHTIMPGKAVVPVDYVMPE
FT                   SVEREVMLILCSDMMVLATDRGEGWDGHVNVFNVLRMATMQEPASLTAGNILRVVDNNS
FT                   IYYFRGTSRENTLQWCRAINSARR"
FT   gene            complement(1040797..1044099)
FT                   /locus_tag="CND03760"
FT   mRNA            complement(join(1040797..1041330,1041390..1041495,
FT                   1041567..1041811,1041858..1041983,1042038..1042112,
FT                   1042175..1042262,1042306..1042393,1042448..1042505,
FT                   1042556..1042580,1042631..1042700,1042754..1042815,
FT                   1042865..1042992,1043044..1043921,1043973..1044099))
FT                   /locus_tag="CND03760"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1040977..1041330,1041390..1041495,
FT                   1041567..1041811,1041858..1041983,1042038..1042112,
FT                   1042175..1042262,1042306..1042393,1042448..1042505,
FT                   1042556..1042580,1042631..1042700,1042754..1042815,
FT                   1042865..1042992,1043044..1043921,1043973..1044030))
FT                   /codon_start=1
FT                   /locus_tag="CND03760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43330"
FT                   /db_xref="GOA:Q5KI93"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI93"
FT                   /protein_id="AAW43330.2"
FT                   /translation="MSNYPHSAAIASSLSTSPYALQSNLENLISRSRTHPHPHRVAGEH
FT                   SPPHHNNYAQQPSPSHPHPAEGSDDDLDKSTTGHTLAAHHAPGVGTIQEASLDEPLIFQ
FT                   DDEDSINTDRQRGERTSLLNHDWKRRVSRTARRSYGAASAPLGAYEGSRRVSSVDGLGA
FT                   GNSRSRSKARTPPRRESEHGRKNRDGDVAQPHGVPAQYSSDEDSTSTHRGRFQGQRPLS
FT                   YTSSPYSSPTSPFRSKTVRVADESSDEDEGGDLARGLLATSGTGVFAGSGRVGDAGLMD
FT                   LDPVEELDAEDLELPVGEDGTEVRDRTKAIKAELPIILRSALPVFFTQAAEWSLVLASV
FT                   VSIGHLGTTELAASSLASMTASVSCFSILQGLATALDTLLPAAWTSSDPSRVGLWTQRM
FT                   FIVMGFSMIPMYLLWWNISPILVVLGQEPEVSHSAGVYLRWLSIGIPGYGGNVLVKKYL
FT                   QAQNLMHVPTYTLFFVAPLNLFMNWLLVWGPEPVRLGFPGGAFATAMSYNLAFVISSLW
FT                   AVFCGPREAFHPIRFKYAFSKLGTVTSLGLAGTIMLSSEWWAWEACALAASLLGPTTLA
FT                   AQSVLLSTASTFFQVPASLGIASAVRVGNLLGAGRDWEAKWASRTCLFLSVTFALVNST
FT                   ICIIFRTNWGYLFNNDPEVVALVASVMPYIALFQIADGIAATSGSILRSLGLHTTGALI
FT                   NLTSYYIIGLPFGLWLAFTPTFSLGLIGLWLGLSVALGYASVLSAVLVWKANWVRAVER
FT                   VRERLGLGVHGVVGIDGKWDVREQAIEERQELP"
FT   gene            complement(1044210..1045200)
FT                   /locus_tag="CND03770"
FT   mRNA            complement(join(1044210..1044366,1044440..1044452,
FT                   1044514..1044551,1044613..1044688,1044745..1044787,
FT                   1044980..1044985,1045088..1045200))
FT                   /locus_tag="CND03770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1044352..1044366,1044440..1044452,
FT                   1044514..1044551,1044613..1044688,1044745..1044787,
FT                   1044980..1044985,1045088..1045094))
FT                   /codon_start=1
FT                   /locus_tag="CND03770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43329"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI92"
FT                   /protein_id="AAW43329.2"
FT                   /translation="MAPKAKTGGKKRSGQPSAYNIYMKVQLAKLKEEQEKSGKKADHKE
FT                   NFKKVAADWKTAPENPKNKK"
FT   gene            complement(1045633..1047420)
FT                   /locus_tag="CND03780"
FT   mRNA            complement(join(1045633..1045893,1045949..1046238,
FT                   1046289..1046680,1046729..1047000,1047059..1047183,
FT                   1047242..1047420))
FT                   /locus_tag="CND03780"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1045731..1045893,1045949..1046238,
FT                   1046289..1046680,1046729..1047000,1047059..1047183,
FT                   1047242..1047388))
FT                   /codon_start=1
FT                   /locus_tag="CND03780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43328"
FT                   /db_xref="GOA:Q5KI91"
FT                   /db_xref="InterPro:IPR007955"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI91"
FT                   /protein_id="AAW43328.1"
FT                   /translation="MPRVIKPSKPRHDPLHLELEGDESIRKFGRVTKPGKRKAKKEEAD
FT                   DDEPKAEDARMSKKILDLARDQQEEVARELGQDDDWEDEDEAEAEPSRRPRDIAQLPSD
FT                   DEEEEEFSDGEISGGEEYAELHIDPADHATLDALNRGSGTAPMGQDQGEEDGEPKTLAD
FT                   MIFSKMQGGAVSRGVVDEHEGPPDPRKGLNPKVVEVYSKVGFLLSRYKSGPLPKALKIL
FT                   PSLPHWAQLLALTKPTEWTPHATFACTKIFVSNLKPTEVRVFLEGVLLDKCREDMRMNN
FT                   GKLNVHLYEALKKGLYKPAAFFKGILFPLCETGCSLKEAAIFASVLSKVSVPVLHSAAA
FT                   LLRLASMDYSGPNSLFIRILLDKKYALPYKVVDALVFHFIRLANSPRSKDGEDKLPVLW
FT                   HQSLLVFVQRYASDLTPDQKDALLDVIRARPHPTISSEVRREIVNSVERGAPRPEDGED
FT                   VKMQ"
FT   gene            1047757..1050297
FT                   /locus_tag="CND03790"
FT   mRNA            join(1047757..1047843,1047904..1048403,1048456..1050297)
FT                   /locus_tag="CND03790"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1047799..1047843,1047904..1048403,1048456..1050229)
FT                   /codon_start=1
FT                   /locus_tag="CND03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42862"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI90"
FT                   /protein_id="AAW42862.2"
FT                   /translation="MPDDLDPASLASVLSAEYTLIDPALIAALLSDYPPNTLLQNLDQI
FT                   KEHLGILEATLVPDSDDPRSQESMGGEGESWSGSDVNSGNSARMEALSDKMGRIDISWE
FT                   KAKDKSSGRHMSGRNIRGHRELAGSGSAMSSSTSLEDTRQSQTWSRDSGDSREPVSECG
FT                   SELEFNDEIDLLKSLFPNLTHGEIQKALSSEQSLPGAIDHLLSLDLIRETEQRGYWIGE
FT                   SEEVLRPVVDNLEMVKDKKTKKKAGNVGSSLSSLAVSASASERKRKPKTSQTIPLVDTL
FT                   QRGARSLTPIPSIIRSVSSSSSSTSFSPAADTKEFSSATTSLATYLHELLPSLPISHFL
FT                   RYLQSSEHPSLYHATRASLTSIPRPRAPQFLALFNEDDVSSGLLQDVYGVSLEAEGNPW
FT                   SVPRVERERQKDLEMCVAIAGQDVATVMDLMDLLVDLRTFQSHEPVSEFDTSPPSTSPP
FT                   PAGEEQEDDGWAKPLAAPKRPVSSLPGPVTRPAPKASKSQKIRTVPGALPGSMANATDS
FT                   FGVASPSPGMIKPHAVGGPHPTNWQTVRSKSRTKDRGGQGHPLAGSIPAYSRGATPHDG
FT                   TPGSLYNHKSSINGGRAKTQMDEYLYQVQVERARREAAIRAAGRSFAGGRAVRGAVSGH
FT                   YAREAREAAERIRNLEMRAAELVIASQLESRPARPSREENRSKMIDLHHLTVNEAVSVA
FT                   EKAVDKWWINEREQRAEGWGAKGKQSQGRLVIVVGAGRHSAGNRGVLGPAVAGHLDKAG
FT                   WRVDKGETSRGYLVVHGRK"
FT   gene            complement(1050195..1051850)
FT                   /locus_tag="CND03800"
FT   mRNA            complement(join(1050195..1050612,1050665..1050823,
FT                   1050886..1051009,1051062..1051084,1051141..1051376,
FT                   1051427..1051456,1051523..1051573,1051623..1051659,
FT                   1051711..1051850))
FT                   /locus_tag="CND03800"
FT                   /product="GAMM1 protein, putative"
FT   CDS_pept        complement(join(1050301..1050612,1050665..1050823,
FT                   1050886..1051009,1051062..1051084,1051141..1051376,
FT                   1051427..1051456,1051523..1051573,1051623..1051659,
FT                   1051711..1051785))
FT                   /codon_start=1
FT                   /locus_tag="CND03800"
FT                   /product="GAMM1 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42861"
FT                   /db_xref="GOA:Q5KI89"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI89"
FT                   /protein_id="AAW42861.2"
FT                   /translation="MLRTASRNIFRTMSSPVYKKIKSTKVIGTHSGTFHCDEALAVFML
FT                   RLTDEYKDADLVRSRDPAKLDPLDIVVDVGGVYDPKTNRYDHHQRGFTEVFGHGGFNRT
FT                   KLSSAGLIYKHFGKEIIAKRIGAPVEDEKVEILWLQLYSELIESVDGIDNGVNISSSPL
FT                   AYTQRSDLSSRIKRINPNWNEPTSDEIYDQKFEVASKTTGEEFLSQLDYFAFAWLPARD
FT                   IVEEALKKRTEVHPSGAIVVFDKSCPWKDHLFTLEPTLPKTSSPILYILYPESESSSKW
FT                   RIQCVPESPDSFVNRKSLPEPWRGMRDSKLSEISGIPGGVFVHASGFIGGNETFEGTLA
FT                   MAKKALEA"
FT   gene            1052013..1055787
FT                   /locus_tag="CND03810"
FT   mRNA            join(1052013..1052157,1052387..1053448,1053498..1053590,
FT                   1053645..1053720,1053773..1054461,1054524..1055787)
FT                   /locus_tag="CND03810"
FT                   /product="transcription factor binding protein, putative"
FT   CDS_pept        join(1052022..1052157,1052387..1053448,1053498..1053590,
FT                   1053645..1053720,1053773..1054461,1054524..1055671)
FT                   /codon_start=1
FT                   /locus_tag="CND03810"
FT                   /product="transcription factor binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42860"
FT                   /db_xref="GOA:Q5KI88"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI88"
FT                   /protein_id="AAW42860.1"
FT                   /translation="MSHRRRQSTASAATPRSAREHSALKSFRSTSIASATTRMDEDDDS
FT                   GGPRRNTRHRNPLPPTTGPLFPPLPPKQPKSAHKEGSMSKSPAKAIGDATETQDDYNEE
FT                   QEKSGGSTAVADDEEVGEDGQVREGNGLPSGSNTSLTPPPTSPAARVDVDVPPNTETTS
FT                   LLHQDLEAEQVQDDMGQPKSINGGDNGGVDNDQPREEQEMDEDDVWETYRRHRAVKGFV
FT                   RKDDNVKSEFGEMERDDGDHLLDNPVHVNGDKSHDEHQHQHIDVLHDADEPEDSNHPPR
FT                   TRSKPIPRGMSAISASNGNTPASASGSDANLGRAGSRQGRRRRGEEQLLLDDHLLPAEI
FT                   RRTALAERAKKDVEKDEEEEVEVEEEEEGEEDEEEGDGLGEQEEDEEGRDITRCVCKRE
FT                   DIDVMMIQCDQCNVWQHGECMGIWGDEEAPDEYFCEECKPERHQALKKWLRSRGRNTSP
FT                   FIPPTPEILERLHSARDPYPPTQSKRWTEYSNSEPLPPKLLARSHHKKQQQQQQQQQQQ
FT                   GQEMLTGTTEGGDGRRTRGRQSSTREKPPSSASGVGHGGTPSTSSKKDGKRGGRKQSVN
FT                   GMESENESESSQNIGAGTSLSVKKRSTMNSRDAAYEEAVKAAMEASRKEMAPQEEGDVN
FT                   SETKEVEVKEKDRARPGKRRRNEDEELDEEEKEDEKDKPKKGKRKKEDETESDPTSAGP
FT                   SKPKHPNQYTYRPKPPSTTGPAASPSRRLGGTPGPTTIPTHHEHGTRRAGALANAPVVF
FT                   HPLSEEGASQLNWHLPDYLTQFNDVLPSDSPVALEVPAPRVMAYLPKNHFHNQRYGPFS
FT                   EERDATGKLILPDDQQDREVVGHPTTQLEPPTRIKFPAKRISAGDVKKRVRAVLEYVGK
FT                   MQADEGKRLRRAKTLGITPVSTAAIRWKERQRKEREREEGAGDDDVVMSEAYAEDGPFP
FT                   AELGLATNQPRSAHLMAELTEMLIGFQEAFSSNDFAAFENGATVGSAPPTPQIPDTSTV
FT                   PPTPVLPSLHSDHPHGSSAGVISRSAEREVDGTEETTTEEVGAGKGLDVYRAGIVNKVV
FT                   TINSTERDVVKKVEEITQA"
FT   gene            1055889..1060759
FT                   /locus_tag="CND03820"
FT   mRNA            join(1055889..1056029,1056208..1056261,1056323..1056410,
FT                   1056473..1058765,1058816..1060188,1060242..1060370,
FT                   1060426..1060647,1060700..1060759)
FT                   /locus_tag="CND03820"
FT                   /product="myosin I binding protein, putative"
FT   CDS_pept        join(1056001..1056029,1056208..1056261,1056323..1056410,
FT                   1056473..1058765,1058816..1060188,1060242..1060370,
FT                   1060426..1060647,1060700..1060720)
FT                   /codon_start=1
FT                   /locus_tag="CND03820"
FT                   /product="myosin I binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42859"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI87"
FT                   /protein_id="AAW42859.1"
FT                   /translation="MSYPYLARTTLKYKSPHATDLSFAKGETIRVTGQSPEDEDWLVGE
FT                   TLDGSHAGGFPKDFVEAIDEGSVEATENESKTGDNTAQQLQPVTQDSSKESERPNILSE
FT                   TDPKAVEVPSELDTGSSEAQAQAQAPAQAPVPASQSESHADDVSRPQSMKDRLAFFTAA
FT                   QNKPAPPPPVKPKPAAGGLTWSQRQKLRQEQEAKEREGTVAASPATSTPIAAPAPSVPE
FT                   TKPTDNAENKEEQGSAMSAADALTSISKGGSLKERMAALQGVGAFGGGEKKPPPPPPTG
FT                   KVWKRPTVQEKEPESQDEPEAENQSSDVHEPLPISDEPRALESDSKDEVAKEEETEEEQ
FT                   EKAKRAAIAARMAKLGARGPMGMVPPAKPVKKPTREMTTTAEDKSLTSSEAAGGDTDQV
FT                   AEAPTIDSKPSAASAKPESVSSPTDAPVTAPPKSIPIAAMPRRTAGPRRRTQTSSANPS
FT                   SDDVSSPPAETHPVPLAPTEAPASEGVAAPADTEAEPHDRLETVNSKGEPVPPKQMMVY
FT                   DEEAPLQKTEEQMKQEREAEERGRGIGGLEGAEAAGIAVYKTGEAREELAVESQASQDD
FT                   MTRVDEPPTGSDTSPNKPFGTDAVMTDSGSGDGKLFSGPRSGEQSVERGGEREDDMSFA
FT                   QGEVFQASESRPARAAENGIPGENVDPVDIVPLHPAADEGLPGEEDAPPPPPRRGTMTM
FT                   EDMPLDELEKKHLQEAREEPPAESPVSDDETHEEEEEGASPSPPPSAAHPRGEENLEEG
FT                   TSDRLEQEGSEMGSKGGDVVTSQAGEEPRVPPPPPRIRKATSSVELREESPTREEAPTS
FT                   EEEARAFVTETPHRSESHHSETHHSETPAKEAKELPETPAAVGETTVSQEEEEDAARRS
FT                   GIAARMAKLGGIKFGIPPPHPAKTHSVDTAPAGSDSIPSRSENLSPVEKEAPLAANLEP
FT                   ERPERGEGEGKTASSEEETPEQEAARRRATLARLRAGGALGFGMFNQPSQKEPEEVEEK
FT                   DATGGEEAFEERGPPPLPLGRPGQETPLSTDEDVGAREEQDEEQVEDVPPPPPARPVIN
FT                   TAYGEGDAHPLSQFVPPRPAVAPPGSAAVPLSPVDPDGMSRSPVESGEGDDIHKAGAAS
FT                   MDDRRLPPLPPAPAPALQQGEYTVGEESGDGNPPPPPPRAGGHRMSVQGGPERGASMSG
FT                   GSTSGAGRQASLEQPGSPSGSAAPAASQLRMSPEPFAAGGFVAAPSSQTMNLNKQVSSD
FT                   SQEAPVSSLGRHVSVRQGTRPGYDQLKEASATYGQGVVRAARGIFAQGKKGFYGDGSPS
FT                   GFVAVVMDSAGVSRPSEDSWGQVIFEQEGGSILRRYDEPRPGDIAAFYDAKLKGKKGLH
FT                   TYTQHVGSVEEPLVGIVGEFEDRKHKVRVLQVERGVPDEVSYRCEDLKGGKVVIFRAGV
FT                   "
FT   gene            1060859..1062207
FT                   /locus_tag="CND03830"
FT   mRNA            join(1060859..1060974,1061009..1061483,1061529..1061660,
FT                   1061707..1062019,1062073..1062207)
FT                   /locus_tag="CND03830"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1060875..1060974,1061009..1061483,1061529..1061660,
FT                   1061707..1062019,1062073..1062084)
FT                   /codon_start=1
FT                   /locus_tag="CND03830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43317"
FT                   /db_xref="GOA:Q5KI86"
FT                   /db_xref="InterPro:IPR001632"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016346"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI86"
FT                   /protein_id="AAW43317.1"
FT                   /translation="MADIQDKIAGARREADGLKDKIRAAREQTADTSLRAMASDTPPLP
FT                   RAALKARRTLKGHLAKIYALHWAADTRHLVSASQDGRLIVWDAYSTNKVHAVPLRSSWV
FT                   MTVAYAPSGAFVACGGLDNVCSVYALAPGGQAKVRRELSAHSGYLSCCRFINDRQIVTS
FT                   SGDMTCMLWDIEQGTRTMEFNDHTGDVMSISLAPNANLFVSGACDATAKVWDIRTGKAV
FT                   QTFTGHESDINAVQFFPNGDAFATGSDDASCKLFDLRADRELNSYAHDNILRGITSVAF
FT                   SISGRVLFAGYDDYNCNVWDTLKGERIGVLAGHENRISCMGVSGDGVALCTGSWDSLLK
FT                   VWS"
FT   gene            1062291..1065465
FT                   /locus_tag="CND03840"
FT   mRNA            join(1062291..1062388,1062439..1062954,1063010..1063213,
FT                   1063277..1063337,1063389..1063546,1063615..1063849,
FT                   1063903..1064987,1065051..1065465)
FT                   /locus_tag="CND03840"
FT                   /product="vacuole fusion, non-autophagic-related protein,
FT                   putative"
FT   CDS_pept        join(1062365..1062388,1062439..1062954,1063010..1063213,
FT                   1063277..1063337,1063389..1063546,1063615..1063849,
FT                   1063903..1064987,1065051..1065326)
FT                   /codon_start=1
FT                   /locus_tag="CND03840"
FT                   /product="vacuole fusion, non-autophagic-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43318"
FT                   /db_xref="GOA:Q5KI85"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI85"
FT                   /protein_id="AAW43318.1"
FT                   /translation="MKFGRRIKDTLYSEWADQYIDYGGLKKQIKANLPWNDTAEADFVQ
FT                   ALQNQLTKCETFQRNKSDELMNHIQQLEEEVKGLVEKAGYSDGGTSDEDDRAENEATTP
FT                   GDVERNVRDRRDDDAGSDDDDDDDEDVSSDMLIDAIEERFRELEEQVAVLVADVHDLAL
FT                   FTKLNFTGFIKIVKKHDKLTGYNLKNTFNRQVLEAHPFYRMNYDPLIVKLSKLFDLVRT
FT                   RGHPIEGDASAGGNQNAFVRSTTKYWVHDENIVPLKLAIMKHLPVLVFNPNKEFSMADS
FT                   AITSIYFDNEDLELYLGRLEKTEGAEAIRMRWYGDVTGNTIFVERKTHREDWTGEKSVK
FT                   ERFTIKEGKMNDFISGRYTMDDEFDELVKRNKKTEKEVEGMKQLANEVQYAIVTRKLRP
FT                   VMRTFYNRTAFQLPGNATVRISLDTELTMVREDNFDGVDRTHGNWRRTDLGINHPFDSI
FT                   PNSEKELFPYGVLEVKLATKVGEEPPQWIRDLINSHLVEAVPKFSKFIHGCASLLSERV
FT                   DLVPFWLPQMDQDIRKPVSAKSKILIERPQSNIHSNASMEGSALPSPAAKSSTSQASYH
FT                   EPVSEGEDDEEYLVHKAKNEEDHLRLPSDVAAQARAAREHREKYIRDEAARQVGITHGE
FT                   AQAQAEAEAESSAAVSSSRPARQSRNQQQYDASLRIDPLASSDRFDKNMQLLDDKSMKK
FT                   LQEAAKDRREDQVEEGEEEEEEDDEEEGDSERVIYVDQFRAPPGKKIAIPVRVEPKVVF
FT                   AAERTFLKWAHFAILLSAVSIGLLNFIDPTDAVGMVSAGCFTFTSLSAILYCGGMYAWR
FT                   ILKMRKREAVDYHDRWGPTALCAALLASVMVNLVLRLREL"
FT   gene            complement(1065443..1067286)
FT                   /locus_tag="CND03850"
FT   mRNA            complement(join(1065443..1065705,1065767..1065847,
FT                   1065903..1065950,1066015..1066572,1066625..1066746,
FT                   1066835..1067003,1067103..1067286))
FT                   /locus_tag="CND03850"
FT                   /product="isocitrate dehydrogenase, putative"
FT   CDS_pept        complement(join(1065480..1065705,1065767..1065847,
FT                   1065903..1065950,1066015..1066572,1066625..1066746,
FT                   1066835..1066912))
FT                   /codon_start=1
FT                   /locus_tag="CND03850"
FT                   /product="isocitrate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43327"
FT                   /db_xref="GOA:Q5KI84"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI84"
FT                   /protein_id="AAW43327.1"
FT                   /translation="MANILKRSALKLGMIPADGIGKEVLPAAQRVIEALGSSIPKTTFV
FT                   PLVAGWEEFNKNGKALPDDTVSALRECDGAMFGAVSSPSHKVAGYSSPIVALRKHLDLY
FT                   ANVRPVSSVPIPGQPSPKAVDLVIVRENTECLYIKQEEISGEGEDRVALATRKISAKAS
FT                   SRIGRMAFEIALRRGQEREAARAAGKDVWWKGEPKVTIVHKSNVLSVTDGLFRETVRAV
FT                   KEGKGGEKYAGVKLEEQIVDSMVYRMFREPEFFDVCVAPNLYGDIISDGAAALVGSLGL
FT                   VPSINAGDNFIMGEPVHGSAPDIEGKNIANPIASIRSAALLLSSLGYIEPAAKINAAVN
FT                   AVLVEGQYLTPDLGGKSSTTEVTEAVLKRL"
FT   gene            1068082..1069383
FT                   /locus_tag="CND03860"
FT   mRNA            join(1068082..1068317,1068364..1068406,1068459..1068521,
FT                   1068576..1068665,1068727..1068879,1068949..1069038,
FT                   1069091..1069178,1069249..1069383)
FT                   /locus_tag="CND03860"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1068232..1068317,1068364..1068406,1068459..1068521,
FT                   1068576..1068665,1068727..1068879,1068949..1069038,
FT                   1069091..1069178,1069249..1069295)
FT                   /codon_start=1
FT                   /locus_tag="CND03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LII7"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII7"
FT                   /protein_id="ALO60532.1"
FT                   /translation="MGIWQDTLVRLGVAQAGPKITTQDRAILDLKLQRDKLKQYQKRLE
FT                   VILDREHEIAREALKSGNKKRALTALRQRKYQEQLLSKTDSQLVTLQELVSTIEFTQIQ
FT                   NTVLHGLEMGSHVLGELQKEMSLERVDRLMDQTREGVEYQREIDEALMSKMSPEEEEAV
FT                   QEELERLQSEALPNVPESSAQVALPDVPVEEPSVPEPVEPSGSEVVVQEERVAVAA"
FT   gene            1069588..1073569
FT                   /locus_tag="CND03865"
FT   mRNA            join(1069588..1070832,1070884..1071316,1071370..1071702,
FT                   1071769..1072222,1072275..1072546,1072606..1072717,
FT                   1072770..1073130,1073186..1073569)
FT                   /locus_tag="CND03865"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1069677..1070832,1070884..1071316,1071370..1071702,
FT                   1071769..1072222,1072275..1072546,1072606..1072717,
FT                   1072770..1073130,1073186..1073379)
FT                   /codon_start=1
FT                   /locus_tag="CND03865"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LII6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027503"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII6"
FT                   /protein_id="ALO60533.1"
FT                   /translation="MLPLRAFARLAQRPRLSRPTQLARSSLPRPSPSRPAAHYLALAPA
FT                   PSTRFLHSSPPVLKEKRWLNNTPPEDDGEDGQNPKQDDQVEKPLPDAESSKSAEERAKS
FT                   QSSKPDIKASSSDSVSSSAPAPGSADGGSPPGAGGPKEVAKPVIPEIYPQVLAIPITHR
FT                   PLFPGFYKAVTVRSPPVIKAIRELQAHGQPYVGAFLLKDSTVDSDVVTDINQVQPVGVF
FT                   CQITSCFTSQEGEGKPEALTAVLFPHRRIKINELVKSSGTKGDGTVGVGGLVEGSQDSA
FT                   KGEGEVKSFESEVPGVEEVREELGTVSIDSEQPDVHKENRDLETKEVTQIDFLHSLLPQ
FT                   VSLTNVSNLSIEPYEKDSQVIRAIMSELISVFKEIAQLQPMFREQVTSFAISNTSSQVF
FT                   DEPDKLADLAAVVSTADVSDLQAVLSSTSIEDRLQRALVLLKKELINAQLQFKISRDVD
FT                   TKIQKRQREYYLMEQLKGIKKELGMESDGKDKLVEGFKEKASKLAMPEGVRKVFDEELN
FT                   KLVHLEPAASEFNVTRNYIDWLTQVPWGVHTPENYNISHAIKILDEDHYGLKDVKDRIL
FT                   EFMAIGKLRGSVEGKILCLVGPPGVGKTSIGKSIAKALGRQFFRFSVGGLTDVAEIKGH
FT                   RRTYIGAMPGKPIQALKKVATENPLILIDEVDKISKAYNGDPASALLEMLDPEQNKSFL
FT                   DHYLDVPIDLSKVLFVCTANVLETIPGPLLDRMEVLEVSGYVSAEKMNIAERYLSPQAK
FT                   VAAGLEDVNIELEPGAIEALIRYYCRESGVRNLKKHIDKIYRKAAFKIVTDLGESGLPE
FT                   PATPPAENQVEAQYPDIKPASELTYNVIPGTEVSGVDTKTDVTTVPREPMKVPAGIHVK
FT                   VTQENLKDYVGPPLYHKDRLYTHSPPAGVSTGLGYLGNGSGAVMPVEINSMPGKGNLQL
FT                   TGKLGEVIRESAQIAMSWVKSNAYLLGITKSEAEATLNDRDVHLHMPEGGIGKEGPSAG
FT                   TAILTAFVSLFTKTRVDPDIAMTGEISLLGQVLPVGGLKEKILAAHRAGIKKLIVPAGC
FT                   KPDIDENVPESVKGGIEFVFVEDVRQVLHEAFRGTEVEKRWQETLPMEEEPQRERH"
FT   gene            1073710..1074837
FT                   /locus_tag="CND03870"
FT   mRNA            join(1073710..1073883,1073943..1074077,1074130..1074291,
FT                   1074345..1074555,1074624..1074837)
FT                   /locus_tag="CND03870"
FT                   /product="expressed protein"
FT   CDS_pept        join(1073737..1073883,1073943..1074077,1074130..1074291,
FT                   1074345..1074555,1074624..1074748)
FT                   /codon_start=1
FT                   /locus_tag="CND03870"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42858"
FT                   /db_xref="GOA:Q5KI82"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI82"
FT                   /protein_id="AAW42858.1"
FT                   /translation="MSYLNSYQHPFSNLPKDIHLTTPPDQYDFNYVFEVKELRSDRVEL
FT                   RPLVPSLHAQLIYDGVTKYPEVLRWLGVKPFEDLGDVLVWIETTCRAPSDSQFFAIFSE
FT                   PPNSQDKTVAPEDYEFAGIIGMINSSYQAMISEPGYITILPPYHRTHVQTHCSGLIMHR
FT                   ILDHPSQGGLGLRRCQWLTTTLNSASQAASKRMGFSFEGVLRCMKVLPQGKEGIRDGRP
FT                   NVRQAECMVRNDWYSSVTWYEWEESVREHVDKLMARR"
FT   gene            1074854..1077005
FT                   /locus_tag="CND03880"
FT   mRNA            join(1074854..1075138,1075197..1075252,1075311..1075389,
FT                   1075450..1075737,1075805..1076107,1076168..1076226,
FT                   1076285..1076652,1076739..1077005)
FT                   /locus_tag="CND03880"
FT                   /product="expressed protein"
FT   CDS_pept        join(1074966..1075138,1075197..1075252,1075311..1075389,
FT                   1075450..1075737,1075805..1076107,1076168..1076226,
FT                   1076285..1076652,1076739..1076873)
FT                   /codon_start=1
FT                   /locus_tag="CND03880"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42857"
FT                   /db_xref="GOA:Q5KI81"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI81"
FT                   /protein_id="AAW42857.1"
FT                   /translation="MTYPVYHHISQPYTYHTYIPVDENGGTSPIYALLMLGLVLFMAAN
FT                   VMPALIPAVDRVWYVADPALKWGFFIIISALLVQMLGLLPGVPPIHVTYVHMVTAFLLV
FT                   AIVWNTFVPVPSTQVEENKTPSVKEDKPTAGKKREISKEETKKEEEISPWDDLRAHPSA
FT                   FLATRLNKMMPWPFPMGKAAREGKELWWEKGTHLQLGHFNRVRLGKVEEEEGSEKNMKP
FT                   KPETEKKLKGKTEKGESEKELGKDSMTAGKQKLSSKKGKASGEPATVTATPKREEGKRN
FT                   QEIAKINEGKANKQAVEDRQRRKLCRTKNLVTIIGISSMNMTLGFLLLIFYSFQIVSQE
FT                   LNHPIPQGEKLSTILSNSSSSSSSFSQTISNSDSTNEKELTKLKVVREKEVSNEKVSGS
FT                   KAPSVGPKKEPAISRSIQKAAGPITMTKVNPESGGTGSDVPYETEIGMHYIFNPDGKGE
FT                   NVEDPSMQIPSFGMSHPLMTTTYKQCAS"
FT   gene            1077198..1079116
FT                   /locus_tag="CND03890"
FT   mRNA            join(1077198..1077215,1077284..1077543,1077644..1077761,
FT                   1077823..1077960,1078008..1079116)
FT                   /locus_tag="CND03890"
FT                   /product="asparagine-tRNA ligase, putative"
FT   mRNA            join(1077227..1077543,1077644..1077761,1077823..1077960,
FT                   1078008..1079116)
FT                   /locus_tag="CND03890"
FT                   /product="asparagine-tRNA ligase, putative"
FT   CDS_pept        join(1077287..1077543,1077644..1077761,1077823..1077960,
FT                   1078008..1079036)
FT                   /codon_start=1
FT                   /locus_tag="CND03890"
FT                   /product="asparagine-tRNA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43320"
FT                   /db_xref="GOA:Q5KI80"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI80"
FT                   /protein_id="AAW43320.2"
FT                   /translation="MRSTQRRLSSLPPTIRSLLSSRRSTLPSVSSTTHLETVSCANEPV
FT                   EVNGWIKSVRAHKNVAFVEVSDGSTGENIQAVLKGKSKAEGLSIGASAKLKGRLEQSRG
FT                   RGQDVELVVEDAQVLGTCDAEAYPIQKKSLPASVLRDNAHLRFRTSQTAAVMRIRDALA
FT                   RDWHDWFESHDFVHVHTPILTGSDCEGAGEVFTIVDHPPPSSSSSPQPFFPHPVHLTVS
FT                   AQLHLEAPTHALSRTYTLSPSFRAEPSLTSRHLSEFHMLEAEVAWENDLDGLLSVVEEG
FT                   VKSTVGNILNGEKRGKRLRDDLSIVAKSLRDVDDLGSVIDPAQEFADPLYHLQLVMDKP
FT                   FTRITYTSALELLSSLHADSPSTISPPPLWGQGISTDHEKLLAAHFNGPVFVTRYPKEL
FT                   KPFYMLPTPSTIENEKTHASQGSTVECFDLLFPHWGEMAGGSLREHRLTELTHAIEEMG
FT                   MKKEEYNWYLDLRKYGSAPHGGWGMGWDRWVGWVTGLGNVRDVVPYARWKGHCKY"
FT   CDS_pept        join(1077287..1077543,1077644..1077761,1077823..1077960,
FT                   1078008..1079036)
FT                   /codon_start=1
FT                   /locus_tag="CND03890"
FT                   /product="asparagine-tRNA ligase, putative"
FT                   /db_xref="GOA:Q5KI80"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI80"
FT                   /protein_id="ALO60534.1"
FT                   /translation="MRSTQRRLSSLPPTIRSLLSSRRSTLPSVSSTTHLETVSCANEPV
FT                   EVNGWIKSVRAHKNVAFVEVSDGSTGENIQAVLKGKSKAEGLSIGASAKLKGRLEQSRG
FT                   RGQDVELVVEDAQVLGTCDAEAYPIQKKSLPASVLRDNAHLRFRTSQTAAVMRIRDALA
FT                   RDWHDWFESHDFVHVHTPILTGSDCEGAGEVFTIVDHPPPSSSSSPQPFFPHPVHLTVS
FT                   AQLHLEAPTHALSRTYTLSPSFRAEPSLTSRHLSEFHMLEAEVAWENDLDGLLSVVEEG
FT                   VKSTVGNILNGEKRGKRLRDDLSIVAKSLRDVDDLGSVIDPAQEFADPLYHLQLVMDKP
FT                   FTRITYTSALELLSSLHADSPSTISPPPLWGQGISTDHEKLLAAHFNGPVFVTRYPKEL
FT                   KPFYMLPTPSTIENEKTHASQGSTVECFDLLFPHWGEMAGGSLREHRLTELTHAIEEMG
FT                   MKKEEYNWYLDLRKYGSAPHGGWGMGWDRWVGWVTGLGNVRDVVPYARWKGHCKY"
FT   gene            1079659..1081326
FT                   /locus_tag="CND03900"
FT   mRNA            join(1079659..1079854,1079905..1080647,1080701..1080847,
FT                   1080911..1081150,1081198..1081326)
FT                   /locus_tag="CND03900"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1079725..1079854,1079905..1080647,1080701..1080847,
FT                   1080911..1081150,1081198..1081236)
FT                   /codon_start=1
FT                   /locus_tag="CND03900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42855"
FT                   /db_xref="GOA:Q5KI79"
FT                   /db_xref="InterPro:IPR003307"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI79"
FT                   /protein_id="AAW42855.1"
FT                   /translation="MSHTPTSTSSGNAPTTDKKPSLTGVRIKQRKGQAKATAKFEPEAF
FT                   RDALLLHLALLPHPITKDALVAKLVQAGSTLEFLKYSEQLFELLFVGGLLQPGGSYLDD
FT                   KRSPVYILQPDDAPDAFKDGVKGMIEVLKRVMQRYKYLQKPLEENFLPGVLSYLPKWDV
FT                   KSREKLAEATALLTIELQISSRCLQSLAKEHVVKDNVALNFLTAFIKTYLSRQSIDQFG
FT                   STLRRSGLKSILAVFPLQIRDRKHLEAHFREENLQVVNDWYAKLALGEVKDETVQAVER
FT                   MINDDETSDQIIEALKLQQSERPVSEADLSEWIWLALMGTVDWTARSDQIDTFVISHIT
FT                   RYASILETFCQSAKAQVNLINAVQVYCYTDTRIIKSFVQILKVLYNADVVSDQAIIYWH
FT                   QKGAKPNGKGHFLKVAEPLVKFLSEQESDSEEE"
FT   gene            1081865..1083236
FT                   /locus_tag="CND03910"
FT   mRNA            join(1081865..1082174,1082251..1082425,1082485..1082675,
FT                   1082741..1083236)
FT                   /locus_tag="CND03910"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1081973..1082174,1082251..1082425,1082485..1082675,
FT                   1082741..1083219)
FT                   /codon_start=1
FT                   /locus_tag="CND03910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43321"
FT                   /db_xref="GOA:P0CO36"
FT                   /db_xref="InterPro:IPR009360"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR037200"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO36"
FT                   /protein_id="AAW43321.1"
FT                   /translation="MARNSEKAQSMLYRFREQQAIDMGIGTRQKGDRRPRMASSCTSLR
FT                   EAERWRGDILRDISRKVSKIQDVALTDYQVRDLNDEINQLFREKRAWENQIINLGGANY
FT                   RRAAGVMTDDEGREVPGTRGYKYFGRAKELPGVKELFTRSTQQATEESARTASFQMFRH
FT                   QGPDYYGDEDELDKELIDTEDVEAREGWEDQVRKSASTLGISDETLLPRYPVSISSKLP
FT                   DASVDPTQLQENEEAPQKSEKALKGTGKSKRKYKGVNDLEEGGQKEEQEEAKKSKTDTS
FT                   VAINSVAEGQNIASETAVAAAQAQAAAFLGVLDAESLEFPTMPSKDEMAKVLLEVRKQA
FT                   LKEEYGVY"
FT   gene            complement(1083307..1085047)
FT                   /locus_tag="CND03920"
FT   mRNA            complement(join(1083307..1083638,1083693..1083743,
FT                   1083800..1084201,1084417..1084462,1084555..1084573,
FT                   1084627..1085047))
FT                   /locus_tag="CND03920"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1083479..1083638,1083693..1083743,
FT                   1083800..1084201,1084417..1084462,1084555..1084573,
FT                   1084627..1084704))
FT                   /codon_start=1
FT                   /locus_tag="CND03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43326"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI77"
FT                   /protein_id="AAW43326.1"
FT                   /translation="MNFKALFATVALLATAWAEDLTVNSPASVVVCQPVALSWSGGTAP
FT                   YIVAVIPGGQSSAAALETISDSESGTQVTWNADIDAGTSITFKITDASGSIQYSSPVTI
FT                   QDGDSSCVSSSSSNSTSAASGSDSSASSSATSSADSTGAAAGGAASGSSAAASDASTAA
FT                   ASGSSTAAASGSSDTASASTSASGSSAASSAADSTAAGSSGSAGTASGSGTAAASAADS
FT                   TASDSAAVPLAVQIPAVGLAVIGGLAALL"
FT   gene            1085524..1086950
FT                   /locus_tag="CND03930"
FT   mRNA            join(1085524..1085692,1085762..1085775,1085835..1085876,
FT                   1085955..1085965,1086022..1086076,1086136..1086293,
FT                   1086356..1086599,1086661..1086950)
FT                   /locus_tag="CND03930"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1085771..1085775,1085835..1085876,1085955..1085965,
FT                   1086022..1086076,1086136..1086293,1086356..1086599,
FT                   1086661..1086700)
FT                   /codon_start=1
FT                   /locus_tag="CND03930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43322"
FT                   /db_xref="GOA:Q5KI76"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR036875"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI76"
FT                   /protein_id="AAW43322.2"
FT                   /translation="MFGAAAVPGSRQGCFKCGNLGHIAENCQAPGRLCYNCREPGHEST
FT                   NCPQPRSTDGKQCYACGGVGHVKSDCPSMRGAFGPGQKCFKCGRPGHLARECTVPGFVG
FT                   AFRGRGGFGGAFGGRPRPPINPDGTPVKCYRCNGENHLARDCLAPRDEAAILASKKCYK
FT                   CQETGHIARDCTQENVSPPAE"
FT   gene            complement(1088100..1091408)
FT                   /locus_tag="CND03940"
FT   mRNA            complement(join(1088100..1088520,1088571..1089259,
FT                   1089307..1089651,1089691..1089943,1089999..1090177,
FT                   1090232..1090365,1090412..1090839,1090887..1091045,
FT                   1091103..1091290,1091328..1091408))
FT                   /locus_tag="CND03940"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1088167..1088520,1088571..1089259,
FT                   1089307..1089651,1089691..1089943,1089999..1090177,
FT                   1090232..1090365,1090412..1090839,1090887..1091045,
FT                   1091103..1091290,1091328..1091364))
FT                   /codon_start=1
FT                   /locus_tag="CND03940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43325"
FT                   /db_xref="GOA:Q5KI75"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="InterPro:IPR032154"
FT                   /db_xref="InterPro:IPR037067"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI75"
FT                   /protein_id="AAW43325.1"
FT                   /translation="MSFKKDDEAGGISFYHDKSTVIQEARVFNESPISPRKCRALLTRI
FT                   VYLLYTGETFSTQEATTLFFGVTKLFQHKDSALRQMVYLVVKELSTVAEDVIMVTSSIM
FT                   KDMQPNLEVVYRPNAIRALARIIDAQSVQSVERFFKSALVDRSPSISSASLISSYHLFP
FT                   LSPTIIKRWSNEAQEAVNAKSVSSYSGASAYFSGGSAGGYQAVASSSYIMQYHALGLLY
FT                   LIREKDRMAITKMVQQLGASGKGSSIVRNPMAICMLIRFARKIMDEDPNLRKQMHEYLE
FT                   TLLRHKSEMVNIEAARAICETKDVQPGDLYKTIAVLQLFLSSPKPVIKFAAVKTLSKLA
FT                   QTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGNEASVDRLMKQISSFMTDITDE
FT                   FKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYEFKHAVVEAIFDMIKYIQDSRD
FT                   AALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFIRYIYNRVVLENAVVRAAAV
FT                   SSLAKFGVCVDDPSVMKSVNVLMRRCLDDVDDEVRDRAAMYIKVLEEKSLADLLVKDEA
FT                   QFSLANLEEQLMSYVRDNSKHASAFDISAVPKVSREQAHAEMAQTRSSALDVAGPSTAA
FT                   VITPASPIPSAKEAQSSYAAQLSTIPEFEPYGPVLKSSAKPIELTESETEYVVTAVKHV
FT                   FRKHVVFQFNVANTIPDTVLEQVAVIMQPSPDCGLIEDFIIPINSLTTQVGQAPVYVSF
FT                   TRENPQEYAAGSFGCTLKFVSKEVDPSNGQPEEEGYDDEYQVEELDLGAADYITPTFVT
FT                   FVNEWDKLASSPSLTETFALSSSESLREACRSLIEVLGMLPLGGTDTPTSNSVHTLNLA
FT                   GLAIPIADGEKSSKVLARCRMTYAPGTGVTIELNVRAEEEEAARLIMAAI"
FT   gene            1092003..1094315
FT                   /locus_tag="CND03950"
FT   mRNA            join(1092003..1092305,1092373..1092501,1092569..1092684,
FT                   1092735..1092755,1092816..1092897,1092954..1093091,
FT                   1093142..1093166,1093215..1093303,1093363..1093419,
FT                   1093478..1093648,1093702..1094315)
FT                   /locus_tag="CND03950"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1092105..1092305,1092373..1092501,1092569..1092684,
FT                   1092735..1092755,1092816..1092897,1092954..1093091,
FT                   1093142..1093166,1093215..1093303,1093363..1093419,
FT                   1093478..1093648,1093702..1094139)
FT                   /codon_start=1
FT                   /locus_tag="CND03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43323"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI74"
FT                   /protein_id="AAW43323.2"
FT                   /translation="MVPALSSLSFLILLFPLLVSAACTDNSTDTAGLQKLLTDGSAGYK
FT                   LQLCQNQIYSLTNTLNYTASNQEISTEGYPIGDARAVLVVAGFNQTTAVKASGTTQDSA
FT                   ALRHVIINGNRAANESVYKGGGGNIEFGGANSNQVIEYVKSYDPRGWSCMHISEGQLNC
FT                   VNATVQYNDIGPCGTDYFQNWADGISLSCSASLVQNNEIIDATDGGIVVFGAPFSTVRN
FT                   NTIKAKTRVMIGGINMVDVKPWKPIGNYSHTVVEGNTIYGGFATSMGNETRGPQEYQAI
FT                   IKIGLALGPDAWFSDQRFGSNKSFGGVIQDNRFSGAFAFGMGVTSAKDFIIQNNTFFGN
FT                   TSFIGNYGPNCTTGNKTPHPSDPLLEELSTLQNTTISVPASSPFQFVNGTAIGLTCFVP
FT                   PESTSYSWPYGDGQVNSEQADKGNGTSGTSTSTGSASQTSAASTVSSNGNESAARRVAG
FT                   LPSMKGFVLAIAITWTMSRSITTGDFTAVF"
FT   gene            complement(1094301..1099198)
FT                   /locus_tag="CND03960"
FT   mRNA            complement(join(1094301..1094704,1094756..1095096,
FT                   1095151..1095412,1095467..1095585,1095645..1095782,
FT                   1095837..1095992,1096043..1096162,1096220..1096334,
FT                   1096386..1096460,1096516..1096691,1096749..1096884,
FT                   1096939..1097501,1097551..1097697,1097761..1097841,
FT                   1097891..1098130,1098188..1098576,1098629..1098743,
FT                   1098798..1098989,1099048..1099198))
FT                   /locus_tag="CND03960"
FT                   /product="DNA repair-related protein, putative"
FT   CDS_pept        complement(join(1094680..1094704,1094756..1095096,
FT                   1095151..1095412,1095467..1095585,1095645..1095782,
FT                   1095837..1095992,1096043..1096162,1096220..1096334,
FT                   1096386..1096460,1096516..1096691,1096749..1096884,
FT                   1096939..1097501,1097551..1097697,1097761..1097841,
FT                   1097891..1098130,1098188..1098576,1098629..1098743,
FT                   1098798..1098989,1099048..1099128))
FT                   /codon_start=1
FT                   /locus_tag="CND03960"
FT                   /product="DNA repair-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42852"
FT                   /db_xref="GOA:Q5KI73"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027132"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI73"
FT                   /protein_id="AAW42852.2"
FT                   /translation="MARTGSRRQIDQLDSDNELARPHQSSQFKRAKTEPGTGDISSSDF
FT                   NSDNDDAGMDMDDSSDESEYEEPSYEEEALLAAYSDLRRSQKGYVGSASSAGIIKSISL
FT                   IDFMCHRHLTVDFGPRMNFVVGHNGSGKSAVLTAIAVALGGKANLTGRGTGLKDLIRTG
FT                   AERAVITITLANSGDSAYRPEVYNPNIVIERTIHSNGSSGYKFKASKDGKTIANKRSEL
FT                   TSISDYFNINIDSPLTVLTQDQSRSFLQNADPSKLYKFFLNGTQLSNLLESYEASSQNI
FT                   ESLVNFIKRQREALPDLKAKVESYKRKIQASKKVMRQKRRNKQLLIELAWSYVIEKEKA
FT                   RDEKKSDVLELREKIEKVQEEIHKTDKELPQVNDAILETESDLKNLDESSKPLALAVRQ
FT                   AKARSQEASKELRSMQSSVAEIEEKIISEKSTLERLERKIEEQLRLNEPEQQEERRRLL
FT                   QRRAKAEDILSKLQLERPARERERDDKFQAQKRAKEELQSINANLRDVNQSKAQMQRQI
FT                   QNISRQANSRIAAFGLHIEPLLEEINSTNWKHSKPIGPMGMFVHLEDMRYADVLQVMLG
FT                   SALCSFAVRDHEDRVKLSNILSKHFARGYRPGNFTARDGARIPTIYRHSGELFDFSNGD
FT                   LSRHGPTILSKLRIENEEVLRILIDHHNIEKTMLAPTLIEGNRLMDDLLNKNVAQYVTV
FT                   HCADLMTTSGTKSNRHSGPTNKYRGNPLFALDVGSEIAKCEAQLQDYESQCQQLCNSAS
FT                   MTENRIASLQQDMAKLSAGITDLQKKMIPLEKDLDQTKRKLADMASTEIDTSESIRDDL
FT                   KERINELEMKLQEHNADIIKQEDVIKQLDADVVQKRAAFDAQAPTKELLLKNLESQVQR
FT                   RTNILTRQSHWAQSLINYETKLEEAEEILVDLEQNVQEWTNKALDYAPEKINTIKTPAE
FT                   LEAERKALDQSITEASKALGVNLDELTAEYRLQRQRYQKANENIKDLNFLRIVLRKAMT
FT                   NRHTWWHQTRSHIAIRAKTAFVVFESFRAMEGRLNFDHGHEKLSLVIHNQTTTESQDGT
FT                   YTQISHYKGAKALSGGERSFSTVSLLLALWSTVPCPIRALDEWDVFLDAANRKVAAKNL
FT                   MEGARESDGKQYILITPLDMQGIDTSGPDKKVIRMADPERGQGTLNMSR"
FT   gene            1100588..1103552
FT                   /locus_tag="CND03970"
FT   mRNA            join(1100588..1101251,1101572..1102112,1102173..1103552)
FT                   /locus_tag="CND03970"
FT                   /product="expressed protein"
FT   CDS_pept        join(1101806..1102112,1102173..1103410)
FT                   /codon_start=1
FT                   /locus_tag="CND03970"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND03970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43324"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI72"
FT                   /protein_id="AAW43324.1"
FT                   /translation="MMSEAFLLSTHSYAPSSPDPTHLRLLAFSVAEAALQSDPNSPPIS
FT                   LTMDKAPVLPEIPHNLCDWPIQVEDVEEDWIEDRWRDTEHERRTQWEMGQKETGMKKSA
FT                   LGKILSGSPFSPSYYGFSLPRNSSLAATASDCVWDDLYERPKIASGKPTKEIRRQRLRS
FT                   CTHFTDPCSFLPTSSQPDRRHPSPDFEPRLAARKCSTHPGQGPVSNKHSSIKSDMFHPN
FT                   QPIDSPPCTNVRLPSLAQIHAKMGSPARQQSASGMGAVRMDTSESIEILQTPTEEYTSS
FT                   RIEARLALSTVLHRRPSTPPSPVTMSAVSSPKEKEAPRLAPFLRERTNGRISGRPSSMP
FT                   PMTFPAEHMTSLADLGKSHYTPPKSAVMVTPPKNRYKFEGGGDVPEPVRPPLIQSISGG
FT                   TPVSRIGGSSFPHMTTTPSSERTAVSPTYITSPTGSASSTMSIPRITCTPAPVKVVKDG
FT                   LEIDSDEDEGDVVLFEADTCGSERGKPSLLQAAQEKERVARAAAMKKRLLQRRMSN"
FT   gene            1104268..1110733
FT                   /locus_tag="CND03980"
FT   mRNA            join(1104268..1104538,1104592..1105539,1105600..1105948,
FT                   1106008..1106442,1106497..1106528,1106672..1106698,
FT                   1106743..1106842,1106900..1106969,1107029..1107077,
FT                   1107131..1108497,1108548..1108768,1108817..1108876,
FT                   1108925..1110733)
FT                   /locus_tag="CND03980"
FT                   /product="phospholipid-translocating ATPase, putative"
FT   CDS_pept        join(1104642..1105539,1105600..1105948,1106008..1106442,
FT                   1106497..1106528,1106672..1106698,1106743..1106842,
FT                   1106900..1106969,1107029..1107077,1107131..1108497,
FT                   1108548..1108768,1108817..1108876,1108925..1110572)
FT                   /codon_start=1
FT                   /locus_tag="CND03980"
FT                   /product="phospholipid-translocating ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND03980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42850"
FT                   /db_xref="GOA:Q5KI71"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR026871"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI71"
FT                   /protein_id="AAW42850.1"
FT                   /translation="MTSSSTYQSHGQPSTSTTHLSARLSSRSSFEHQGTDDESLDVFDP
FT                   MSIDPDLRLRTVKTAHSVLAESIRSEALAEKREKRRRLFRSMKRKASDIGKGTLKRKGP
FT                   AGDNGKPDSGKTEAGNTDAISTAGSLTSQPPPITPPEHQHQSGKTKGKAKNRKAELPRR
FT                   TVYVNIPLPSSLRNSQGEPVVRYVRNKVRTSKYSLITFIPKNLLEQFRRVANIYFLFLV
FT                   ILQLFSIFGAPNAQIGMLPLLAILGMTAIKDAFEDWRRAKLDNEVNNSATTKLGAWKNV
FT                   NQPKDPRNFVEKLFGLGPNPNKTSKGVQKLRAREANQGNQMVLDSRRAEEQDPLEDLAV
FT                   SDKESYPLGPMSRAEFSTVSAVDSTSDSLALEGYRRSFSAGISRSSLPSMMSRKSVGVV
FT                   DWSRSVPGAAQWERTLWKKLEVGDFVLLRDNEQVPADVIVLSTSNADALCFVETKNLDG
FT                   ETNLKIRRSLKATSAITSEEDLEHAHFVVDSEAPHANLYSYNGVLRYTPTDQYGKQMEE
FT                   KQEAITINELLLRGCTLRNTKWVIGMVIFTGSDTKIMLNGGETPSKRSKIEKETILCLI
FT                   TAILHGWYRSLSGTSADWYEPDAEASDNIYVDSVIIFFSCLLIFQNIVPISLYITVEIV
FT                   KTIQAYFIFQDVEMYYEPYDTPCVPKTWDISDDLGQIEYIFSDKTGTLTQNIMEFKKCS
FT                   IHGVPFGEGMTEAMMGAKKRDGQDISTAMEDQEDELQVLKEKMLELMTGVMDNRYLRQD
FT                   KLTLIAPDLVQHLTTPSDPLRSPIIDFFRALAVCHSVLADTPDQSKPFELEYKAESPDE
FT                   AALVAAARDIGFPFVSKNSHFLEIVVLGKPEKWIPLRMLEFSSSRKRMSVVARDPNGKI
FT                   VLFCKGADSVIYNRLSVNHDQELKDATLKDLETFANGGLRTLCIAYRNLSEEEFSDWSK
FT                   KYDAASAATVDREGEIEKACDLVEHSLTILGATALEDKLQEGVPDAIATLHRAGIKLWI
FT                   LTGDKLQTAIEIGYSCNLLTNDMEVMIISADSEDGARQQIEAGLNKIASVVGPPPTTSG
FT                   GRIMTAGMNPAVKFAVVIDGESLRYALEPSLKSLFLSLGTQCAAVICCRVSPSQKASTV
FT                   RLVKEGCNAMTLAIGDGANDVAMIQEANIGVGLYGLEGSQAAMSADYAFGQFRFLTRLL
FT                   LVHGRWSYVRVADMHANFFYKNIIFTVSMFWFFIFSSFDATYLFEYTLLLMYNLFFTSL
FT                   PVGFLGAFDQDVNPTAAMVFPQLYKRGIASLEYTRTRFWLYMFDGLYQSAVIFFIPYFA
FT                   YGTGESWSSQGRDTNSLWDIGTTVACAGVLSANGYVSINIRYWTVMTWIINVASTLLIY
FT                   IYIPIYSAVTALPYAGEVGVIYPTFSFWAVILIATIIAIGPRWLVRSFKQSYFPQDKDI
FT                   IREAWVTGQLKRDLGIKSRKQKRRQNKEKADAARCEENEQELEDVPGLELVTGKDLVQQ
FT                   FQKGNMEGDAFRGLYEPAATYSPRKEAVRSPLMSEESSPRNMRAYHPAYTNYSTNDISS
FT                   IRQIQTSIPPPFTARTSFNSAEQPSPLGQSIASSDHSFQNPLRTYDCHPSPSSIHQVEA
FT                   EISREVGRLKRTSKDIQRASSLYDKEEESVRMSRASLFSQKGFEALPQSGDSRGSISNL
FT                   SRKQSISVLGGSVPASWKDSSPLSNVDELGRGNLSSMRGALDVTAKHSELFENRVENQS
FT                   WRPSDDHLLYARERSSSAVQQTKNIFDFTDASSSQWGAEASKKDNEWEGAGYAI"
FT   gene            complement(1111046..1111136)
FT                   /locus_tag="CND03990"
FT   tRNA            complement(1111046..1111136)
FT                   /locus_tag="CND03990"
FT                   /product="tRNA-Asn"
FT   gene            1113949..1114872
FT                   /locus_tag="CND03995"
FT   mRNA            join(1113949..1114266,1114327..1114482,1114570..1114872)
FT                   /locus_tag="CND03995"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1114105..1114266,1114327..1114482,1114570..1114758)
FT                   /codon_start=1
FT                   /locus_tag="CND03995"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIJ8"
FT                   /protein_id="ALO60535.1"
FT                   /translation="MIFMIPIHISTLILHLFASAAYASSQPFLGGCLKSNPAPANSLAI
FT                   TAISPSQCVTQCWNEREDTRYAYWDSRSEDKCLCSPFPANAIDFTLSNQAEAFETCAEG
FT                   ITMYVRAPEPPNFQIERKRAGKGRPGDVSSRAEGLCPSPLTACSVAGDSSIYEVKVFFL
FT                   ISCTP"
FT   gene            complement(1115179..1115277)
FT                   /locus_tag="CND04000"
FT   tRNA            complement(1115179..1115277)
FT                   /locus_tag="CND04000"
FT                   /product="tRNA-Gly"
FT   gene            1115402..1117148
FT                   /locus_tag="CND04010"
FT   mRNA            join(1115402..1115591,1115652..1115784,1115934..1116011,
FT                   1116105..1116217,1116301..1116396,1116479..1116517,
FT                   1116573..1117148)
FT                   /locus_tag="CND04010"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1115589..1115591,1115652..1115784,1115934..1116011,
FT                   1116105..1116217,1116301..1116396,1116479..1116517,
FT                   1116573..1116851)
FT                   /codon_start=1
FT                   /locus_tag="CND04010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43332"
FT                   /db_xref="GOA:Q5KI70"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI70"
FT                   /protein_id="AAW43332.1"
FT                   /translation="MALTPQALRLLSRQIMALKSDPPEGVRIAVGEEDFTALEGWVQGP
FT                   SGTPYEGGYFRIRFAFGSEFPNLPPKCTMVTKIFHPNISKSGEICVDTLKKGWKKEYGV
FT                   GHVLITIKCLLIFPNPESALDEEAGKQLLEDYEGYSKYARLMTSIHAIPKVAPPEFRVA
FT                   KMSRSDEHMPTGTSPSPMNNLLHRPIPLGNSSSQEQGPILSHPGQHVQDAKNDLKAFGN
FT                   SRAACSGGIKTAPMSKVKRGAKRL"
FT   gene            1117476..1118846
FT                   /locus_tag="CND04013"
FT   mRNA            join(1117476..1117580,1117643..1118196,1118246..1118616,
FT                   1118694..1118846)
FT                   /locus_tag="CND04013"
FT                   /product="hypothetical protein"
FT   CDS_pept        1117673..1118179
FT                   /codon_start=1
FT                   /locus_tag="CND04013"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIV2"
FT                   /protein_id="ALO60536.1"
FT                   /translation="MTRTMASPTILSSPLLSLESINILLASPAPQNVDVRIQLLSAKIL
FT                   ALSNLPLSPACRLDVQKTRFQLGKTYLRDKFDLKCAEIELGMVQRECKELARKKSYKAD
FT                   ELEHYPSQENIIKEMAVEYEALQSQAKELRMEAMRLLVEVEEGLGRLGRAATWRNLIEA
FT                   AVKDA"
FT   gene            complement(1118665..1119914)
FT                   /locus_tag="CND04015"
FT   mRNA            complement(join(1118665..1119496,1119561..1119719,
FT                   1119813..1119914))
FT                   /locus_tag="CND04015"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1119444..1119496,1119561..1119719,
FT                   1119813..1119903))
FT                   /codon_start=1
FT                   /locus_tag="CND04015"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LIS3"
FT                   /protein_id="ALO60537.1"
FT                   /translation="MNSHQTQLLRRLHCILLHFTHWVYTQLCRNYKSDIQLLCVSLVYL
FT                   GQASFRRTTGVNDEGMGICASTESSVYNGGPSQCTGAYGTMPDKMNECQKRVIMP"
FT   gene            1120019..1123213
FT                   /locus_tag="CND04020"
FT   mRNA            join(1120019..1121074,1121130..1121605,1121654..1122331,
FT                   1122378..1122743,1122796..1123213)
FT                   /locus_tag="CND04020"
FT                   /product="vesicle-mediated transport-related protein,
FT                   putative"
FT   CDS_pept        join(1120087..1121074,1121130..1121605,1121654..1122331,
FT                   1122378..1122743,1122796..1122927)
FT                   /codon_start=1
FT                   /locus_tag="CND04020"
FT                   /product="vesicle-mediated transport-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43333"
FT                   /db_xref="GOA:Q5KI69"
FT                   /db_xref="InterPro:IPR000237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI69"
FT                   /protein_id="AAW43333.1"
FT                   /translation="MFAVSLQDRLKAAVNSLEATGSTLQARALNANQHPQDTRDSSPQD
FT                   ATSANPRPASPSPPFPHSNNSKQDVRSKSVPVPLNQAAYTGATTSQLAENALSGLRKSF
FT                   QFGRSSLDLSDPVGISSSLPATPSGQGVKDIDLPSPSASVPAEPSAFAGKSPAVSFLQI
FT                   TDAANGPTEIHARSTTMRTLIPGDPMSIPLPPSPTLSSILPSPEADPLGASTSYDSVDE
FT                   GTIPGHKELKPVEKPDQDEKDLNQPDEEMASTNVKKLADLERRYDDLSNRFTTLLIQAH
FT                   QANKIFKELTPLESCISDVEALEGWIRMMVGKVEMMGTEMKRLQDNLTLQDSRIEELRD
FT                   THRLESASQNELVSKLRSDLSESQSKLSTYSSTAATVTQLRADLAKAQTQAKEEEEKRI
FT                   KAISLLKTVRLKLVKVEKEKEELEKDRASERAERSRLNEEMEKAKIEKEKEVSSLKKGF
FT                   ERELGGAKERYEKELKDKKASWELEMITTKAAHAKELSQKSVKISGLEAIIKELNTNKQ
FT                   TIHALLQSKQAEAESARADMEEMQTKSKELEFQLREANERCSLLEDSLRDDGMGRGGPV
FT                   GMTVLETRRDSLSSSRNNSLSGTSPMEIQRLLAESESRAESKLSELRARIRSLECERNE
FT                   LEEEWAGKMQERVRELEKMRRVLLDKEKEHARSLEGLRERESTIQEVEQKTRDLEAEIS
FT                   RMKLRMEEVEGDKAVASESERAAREELSSLQHELVDLRSQLDDSKSHISFLKSTNKTLR
FT                   DEMRKIQSSVQLMEKQRNPGVGYWAAAAGQRSSMVGSPMSSVNVDSPALGRKSVESIRT
FT                   TAGTEIGSDLGESKRTPEEDLNLEYLRNVILQFLEHKEMRPNLVRVMSVILRFTPQELR
FT                   RLNAKLLS"
FT   gene            complement(1123214..1126601)
FT                   /locus_tag="CND04030"
FT   mRNA            complement(join(1123214..1123617,1123684..1123758,
FT                   1123821..1123890,1123944..1124003,1124079..1124165,
FT                   1124224..1124310,1124373..1124752,1124804..1124897,
FT                   1124955..1125069,1125128..1125464,1125521..1126083,
FT                   1126141..1126601))
FT                   /locus_tag="CND04030"
FT                   /product="CAP1-related"
FT   CDS_pept        complement(join(1123318..1123617,1123684..1123758,
FT                   1123821..1123890,1123944..1124003,1124079..1124165,
FT                   1124224..1124310,1124373..1124752,1124804..1124897,
FT                   1124955..1125069,1125128..1125464,1125521..1126083,
FT                   1126141..1126426))
FT                   /codon_start=1
FT                   /locus_tag="CND04030"
FT                   /product="CAP1-related"
FT                   /db_xref="EnsemblGenomes-Gn:CND04030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42848"
FT                   /db_xref="GOA:Q5KI68"
FT                   /db_xref="InterPro:IPR006598"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI68"
FT                   /protein_id="AAW42848.2"
FT                   /translation="MEVQEASPRIPFRAASTPPASAPHLYTTPASYNPSTRASQDGYPE
FT                   SPVGLRPQATFQKPYIFTLGQLPTRRRRFRILGSPKRLFLIVFLAVLALLGRFWHASDK
FT                   SKIAGLKDFDGLCRFVSPIDAYHRDLTRLRTVFRGSSFSRNSSIYHGRSKTFKHYHSYS
FT                   PTGHLIVSHDPEAPHPIPLLLDLGEKRWEELLSRQSRTLEEAVREYIRRYGRQPPKGFD
FT                   KWWDFAMQHNLVLPDEYDRINLDLAPFLALPKSEMMRRMEMVDNMAETFTLVVRNGSVD
FT                   IEIKDEGGLQWGGTLPRARDTASLLRGFSDYLPDMRATFSIFDQPQIYLSWARRGSLVD
FT                   LGLRGEKTSHLEETDSAKVKLSRSCAPDSNYRKNENFSEGKSLIYDSLEAGDLCQNPYL
FT                   IPLHGLTIEPHEPYSHPRPHTQLLPLFSLAKTSINSDILVTPLDQFHDPPGNDPEWENK
FT                   PSSKLAWRGSPTGISWMTSDLDWRSAHRFRLHNYANNRSLEPMNYLVPNLGQREEDDYD
FT                   ELDVYSAMGGDEDLDGWREGNTEVKEHRATETEGPLRYKEEKILTAQAMEFFYDIKLAG
FT                   EPIQCSQDDGTCQSMWDEIEWAPRQSGDDLNLNKFLLDIDGNGWSGRFRKLMSTNSLVI
FT                   KMTMFTEWFQPHLIPWFMYIPAKLDFSDLPDIMAFFRGTPTHPELAFDETAQALARNGK
FT                   CFVQRMFRMEDLQAYMMRLFLEYARIAAKEGVDMDFHLNNDNWTQINSFERFSSPEDTL
FT                   VDGGYSSHLTKMPLPDAKEEAPRHKAGVIMEEAKKDMDGMDGVKLEVWISGDDVAVDTT
FT                   AGERK"
FT   gene            complement(1127643..1129265)
FT                   /locus_tag="CND04040"
FT   mRNA            complement(join(1127643..1127815,1127876..1128146,
FT                   1128203..1128274,1128319..1128407,1128458..1128536,
FT                   1128599..1129043,1129100..1129265))
FT                   /locus_tag="CND04040"
FT                   /product="ATPase, putative"
FT   CDS_pept        complement(join(1127696..1127815,1127876..1128146,
FT                   1128203..1128274,1128319..1128407,1128458..1128536,
FT                   1128599..1129043,1129100..1129136))
FT                   /codon_start=1
FT                   /locus_tag="CND04040"
FT                   /product="ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43288"
FT                   /db_xref="GOA:Q5KI67"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI67"
FT                   /protein_id="AAW43288.1"
FT                   /translation="MAPRDIGRVFMDVAFFAASQVALYYTLRYVVSSLDPASGSSRKAK
FT                   EKSKSLLAQTGLSEAQLASLELDEYEQAIAAEIVPPSSIDVTFEGIGGLDDIIASLRET
FT                   VIYPLTFPELFGSGNGLLSAPKGVLLYGHPGCGKTMLAKALAKESGATFINLPLSSLTN
FT                   KWFGESNKLVAGLFSLAKKLQPSIIFIDEIDSLFRERSAGDHEVTAMMKAEFMTLWDGL
FT                   TTGSDSRILVLGATNRPNDIDPAILRRMPKRFAIRLPNHEQRVKILTLMLMHTRLASDF
FT                   SIEKLAQRTDGLSGSDLRETCRNAVMTPVQELMREKGKSGVQGLEKARKEGFQIRPLNM
FT                   DDFVLHDSHAYAYVDPSRRPPGAYVTESLD"
FT   gene            1129517..1131406
FT                   /locus_tag="CND04050"
FT   mRNA            join(1129517..1130167,1130218..1130421,1130474..1130612,
FT                   1130659..1130790,1130844..1130996,1131046..1131144,
FT                   1131204..1131406)
FT                   /locus_tag="CND04050"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1129587..1130167,1130218..1130421,1130474..1130612,
FT                   1130659..1130790,1130844..1130996,1131046..1131144,
FT                   1131204..1131317)
FT                   /codon_start=1
FT                   /locus_tag="CND04050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43274"
FT                   /db_xref="GOA:Q5KI66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030616"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI66"
FT                   /protein_id="AAW43274.1"
FT                   /translation="MSSQNVSGLMAGLSLYAPQSPKGSKAQQAGKTQESSHSSQSQNRL
FT                   PPVLKKYMNPGLVRPPNSGLANNSHPSSSYSDPSSRGPLLTLAGVNVSYPKSGTVSPMN
FT                   KSKGAVGHHSAHGIHGPAHSTSSRAMASSINPGASKHAVTTSSSHITNLVSENCKSLEL
FT                   GRYDGGLEEDEANHGDASGPTAKMLELSSVSEGAIPLSLPSFTIGRPLGKGKFGRVYLA
FT                   RSKAPPHFIVALKCLHKAEIIQGKVESQVRREIEIQQNLRHPNILRLYGYFHDSKRIFL
FT                   VLEFAAKGELYKQLSRLGRFDEKKSSRYIAQMADALSYLHRKHVIHRDIKPENLLIGLN
FT                   GELKIGDFGWSVHAPSNRRSTLCGTLDYLPPEMVEGKEHTAAVDLWALGVLTYEFVVGG
FT                   PPFEDLSGNAATYRRIRNVDLHVPSWVSPEATDLIKRLLRYKPEDRLPLSQVMIHPWIK
FT                   MYEKKRSASNGIRRS"
FT   gene            1131976..1134080
FT                   /locus_tag="CND04060"
FT   mRNA            join(1131976..1132438,1132489..1132866,1132942..1133526,
FT                   1133583..1133778,1133838..1134080)
FT                   /locus_tag="CND04060"
FT                   /product="expressed protein"
FT   CDS_pept        join(1132031..1132438,1132489..1132866,1132942..1133526,
FT                   1133583..1133778,1133838..1133950)
FT                   /codon_start=1
FT                   /locus_tag="CND04060"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43275"
FT                   /db_xref="GOA:Q5KI65"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI65"
FT                   /protein_id="AAW43275.1"
FT                   /translation="MPSKRSATASITTASKRRRIHTSSVWTHKDDWSTLLSDSSLSTSS
FT                   ISVRPPRFRTFPTLTRCASDAVVKGFPSFWRLAKHADRMTKYSGPDEIVREDWERWWKE
FT                   WWERVPSRLQETVRDNIFKKWGGALSIPVIQELFVIPGVLFLPGDLLPAVAQATRLKPL
FT                   IPPTHISSLLNTLILTHSPTSSDVGIAGLIYHLPNLEAINLKGCTSVAEKTVKTILNRC
FT                   AGLRKINLKGTKIVERGVKDLLGTFGGQLESFKIDNVTFDNTDDTFSSSPYPLISHLCL
FT                   PGDILNRSSSSANRNTIRFTGMGYPQPRNTLTTGIIQWSGFSRCFPRLTHLYLPGLLVP
FT                   SGTKIDTSFLKLEKIVLGPRGPPVPISTVISLIAGHESTLRSLHLGNVYPDIPSSRASH
FT                   MAAYDDLANHLRQSKLLEQFRWQTDIKGTNDSVADISMRQWGEMVFEHFFDTRKGPLKH
FT                   LVLEVPCPFRTPQMADLACNTVNPSQLETLEIPGAYLLDHKQFTLIIASYPKLRHLDLS
FT                   GTTIDDDDMKIIIRHCQLLSRINLTSCRGINVRHRRNIFDVR"
FT   gene            1135654..1137558
FT                   /locus_tag="CND04070"
FT   mRNA            join(1135654..1136015,1136070..1136100,1136153..1136286,
FT                   1136339..1136885,1136943..1137262,1137317..1137558)
FT                   /locus_tag="CND04070"
FT                   /product="NADH-ubiquinone oxidoreductase 51 kDa subunit,
FT                   putative"
FT   CDS_pept        join(1135709..1136015,1136070..1136100,1136153..1136286,
FT                   1136339..1136885,1136943..1137262,1137317..1137465)
FT                   /codon_start=1
FT                   /locus_tag="CND04070"
FT                   /product="NADH-ubiquinone oxidoreductase 51 kDa subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42845"
FT                   /db_xref="GOA:Q5KI64"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI64"
FT                   /protein_id="AAW42845.2"
FT                   /translation="MLSRTPLLRSSPRSIAAARRSLATVSDAPVRHYGGLKDQDRIFTN
FT                   LFCKHDHGIKGALARGDWHKTKDIILKGDAWLIQTVKDSGLRGRGGAGFPSGLKWSFMN
FT                   KPGWEKDPRPRYLVVNADEGEPGTCKDREIMRGDPHKLVEGCLVAGRAMNANAAYIYIR
FT                   GEFYQEASHVQQAIDEAYKAGLIGKNACGSGYDFDVYLHRGAGAYICGEETALIESIEG
FT                   KQGKPRLKPPFPADVGLFGCPTTVANVETVAVAPTIARRGGSWFASFGRERNSGTKVFC
FT                   VSGHVNNPCVVEEEMSIPLQELLEKHCGGVRGGWQNLKGIVPGGSSVPVVNRETSEKCL
FT                   MDYDSLKDNGTSLGTGAVIVMDNSTDMIAAIARFSKFYKHESCGQCTPCREGTSWMMNM
FT                   MDRMVEGRAQEREIDMLLELTKQVEGHTICALGDAAAWPIQGLMKNFRPEVEQRLAQFH
FT                   AKNGQVLFGGKLLSDADRRYALPDNLGGDAIRQIASP"
FT   gene            1137744..1139583
FT                   /locus_tag="CND04080"
FT   mRNA            join(1137744..1137979,1138038..1138229,1138295..1138372,
FT                   1138439..1138608,1138668..1138978,1139052..1139583)
FT                   /locus_tag="CND04080"
FT                   /product="mitochondrial carrier protein rim2, putative"
FT   CDS_pept        join(1137837..1137979,1138038..1138229,1138295..1138372,
FT                   1138439..1138608,1138668..1138978,1139052..1139390)
FT                   /codon_start=1
FT                   /locus_tag="CND04080"
FT                   /product="mitochondrial carrier protein rim2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42838"
FT                   /db_xref="GOA:Q5KI63"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI63"
FT                   /protein_id="AAW42838.1"
FT                   /translation="MSTQSFSQSFLSSTNPSSSPSPPAAPPLNLSAKTEKKLQGWQHSA
FT                   AGSMGGMTGAIVTSPFDVVKTRLQSDMFRHSSDEGVRHAAEVAKKGGSSGGVRGVMWQF
FT                   VDTVYLIKRIAVEEGWRALYKGLGPSLVGIIPARAINFYFYPTSKVYLAKQFPNAPTEK
FT                   PGQTAEDSPVIHLGAAVVAGIMTSTGTNPIWVVKTRLQLSARKKETGVVSAKSGSILPK
FT                   PIAASAASLASQASTPITAAAASAASTRTVARSSLTPAFSMTMDIIKKEGIRGLYRGLS
FT                   ASYLGVSEGVIQWVLYERFKRLNAATTTGLESQPLLSYIPHIVGASGGAKAVASLITYP
FT                   HEVIRTRLRQPALPDGTVKYKGLLQTLKLVWMEEGVGALYGGLTAHLFRVVPNAACMFL
FT                   IYELVAAKLGA"
FT   gene            complement(1139528..1140414)
FT                   /locus_tag="CND04090"
FT   mRNA            complement(join(1139528..1139894,1139979..1140077,
FT                   1140189..1140414))
FT                   /locus_tag="CND04090"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1139849..1139894,1139979..1140077,
FT                   1140189..1140310))
FT                   /codon_start=1
FT                   /locus_tag="CND04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42836"
FT                   /db_xref="GOA:Q5KI62"
FT                   /db_xref="InterPro:IPR024645"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI62"
FT                   /protein_id="AAW42836.1"
FT                   /translation="MSGKKPEFPEPPCKLFAITQYQCSPESGRVTCWPIERIFRQCGEN
FT                   KPVIEVTNRILRDRSGSNKNEIVVDPLFIKNPPKAKSWGDLRG"
FT   gene            1140525..1141173
FT                   /locus_tag="CND04100"
FT   mRNA            join(1140525..1140868,1140936..1141173)
FT                   /locus_tag="CND04100"
FT                   /product="expressed protein"
FT   CDS_pept        join(1140596..1140868,1140936..1141103)
FT                   /codon_start=1
FT                   /locus_tag="CND04100"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43276"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI61"
FT                   /protein_id="AAW43276.1"
FT                   /translation="MASLTSDPILLNPLSEIIAALSSSSFGILPAPDSEPLLEQTFPRT
FT                   AEELKSVQEESNRSRKISERIVGMCRVGLLDGEGHVVIRLDRAGWTIETADGERHVTNK
FT                   IGTTYESMESLLISASKKYVEAMNREIWKRFEDHPQAVEERE"
FT   gene            complement(1141176..1141860)
FT                   /locus_tag="CND04110"
FT   mRNA            complement(join(1141176..1141365,1141410..1141514,
FT                   1141567..1141590,1141637..1141860))
FT                   /locus_tag="CND04110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1141253..1141365,1141410..1141514,
FT                   1141567..1141590,1141637..1141826))
FT                   /codon_start=1
FT                   /locus_tag="CND04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42834"
FT                   /db_xref="GOA:Q5KI60"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI60"
FT                   /protein_id="AAW42834.2"
FT                   /translation="MFRPSLARTAAPLARAHARSFVSRATFVGRLGTAPEKSTTSAGQP
FT                   YYKYPLAVSKPPKRDAEGKVILDEGGYPVRADPSWFTIFNFNERAEARIESLVPGSLLY
FT                   VEANIDTITSPSAAEGSPGTKQYVFREVSHKVLSKPRQE"
FT   gene            1141874..1145618
FT                   /locus_tag="CND04120"
FT   mRNA            join(1141874..1142105,1142158..1142313,1142367..1142826,
FT                   1142892..1143022,1143092..1143478,1143541..1143925,
FT                   1143969..1144281,1144353..1144433,1144511..1144565,
FT                   1144642..1144666,1144731..1144800,1144872..1144975,
FT                   1145034..1145302,1145370..1145618)
FT                   /locus_tag="CND04120"
FT                   /product="Pol II transcription elongation factor, putative"
FT   CDS_pept        join(1141992..1142105,1142158..1142313,1142367..1142826,
FT                   1142892..1143022,1143092..1143478,1143541..1143925,
FT                   1143969..1144281,1144353..1144433,1144511..1144565,
FT                   1144642..1144666,1144731..1144800,1144872..1144975,
FT                   1145034..1145302,1145370..1145528)
FT                   /codon_start=1
FT                   /locus_tag="CND04120"
FT                   /product="Pol II transcription elongation factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43277"
FT                   /db_xref="GOA:Q5KI59"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI59"
FT                   /protein_id="AAW43277.1"
FT                   /translation="MPARRLRPVIELAPLPPAVRALYARPPSAAPAHTQHRTFCEKCRR
FT                   PPAALILESLHSRPKKRPRTKRPSPEDDDLLSDSELVHILQGWVTCRRCVVASHYGCLS
FT                   ASQKKAVLESLRSQDLAALGNIDPTTQASDVPLRKTVPIQQEADFLCAKCGEGVPCFVC
FT                   CKDELLNVDPVTVGRRKDDDAGVVDVGKEDSMTDMDSSKAPQLPPLAEAVSDKEIGSPQ
FT                   PKSTRPLFRCLRCRQAAHYEHLKVPEPLGENPDLAEIAHHYQTQTDDGDAWTCHQCRAS
FT                   PWGIDIVIAWRPLPATSPFHSLPPPPPKTPLYKTVLPREYLIKYSSRSFRHVEWVPHAW
FT                   LSGIAPMKLRRFLEKGPLLDLVTDETLEARGDEVVRPSIADIDNRAHGKDVHHEKGVGL
FT                   IVDAEEDAESGLPILWSTIDRVLDVLLIRPTAAQIKGKSKKSQSGNDRRNQRRIVSLSP
FT                   SPYDGAAPFPPDSSPNAQAVAVKTPFEQLQADLNIPDGLPLPDDELIEIEEWEILTGRR
FT                   LLETDVEEVAGLVGWGLFKWQDLQYDQAHPRTEKACWDTPPPSSSPLYTAYKHGLSKYL
FT                   AARHITIPVLTPAQIRARDNDPARGFVPPQEQPDCIAGGNLMPFQMEGFQWLLYKYFKR
FT                   ESCILADDMGLGKTVQIASVLGYLGSAEHEIYPCLVVVPNSTITNWVREFEKWSPHLRV
FT                   VPFYGEAASREIISKYELFHKGTQGKPVGLKAHIVLTTYDMITSSEFRVFSAIPRWEVL
FT                   CVDEGQRLKSDNSKIFNNLKTLNSVHRILLTGTPLNNNIRELFNLLNFLDQDNFKDLES
FT                   MEQEYSDLNEVKVQKLHQMIKPYILRRIKADVLNLPPKVEIIVPISLAPLQKQMYKGIF
FT                   ENHAGIIEDILKARQKRRQAIKSVQSAVPTN"
FT   gene            complement(1145626..1152495)
FT                   /locus_tag="CND04130"
FT   mRNA            complement(join(1145626..1146004,1146054..1147548,
FT                   1147613..1147978,1148028..1148373,1148426..1148705,
FT                   1148757..1150227,1150278..1152028,1152085..1152220,
FT                   1152268..1152495))
FT                   /locus_tag="CND04130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1145733..1146004,1146054..1147548,
FT                   1147613..1147978,1148028..1148373,1148426..1148705,
FT                   1148757..1150227,1150278..1152028,1152085..1152220,
FT                   1152268..1152270))
FT                   /codon_start=1
FT                   /locus_tag="CND04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42832"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI58"
FT                   /protein_id="AAW42832.2"
FT                   /translation="MNKIVSFSDEACAGEASLVSTPASSSVPTDSSSTRQAMPLGAART
FT                   LSLNRRAVIFSPRNDTKYFHSDDSILPSASAGQPLDLKLHPTSDPVTPHNSSRRSRTVR
FT                   GTPSLVKSILKSRAQQIRIAASVEEGTLSNREPARLLISGKRPALAARDSFELVAMVGG
FT                   EDPRVVKDTVRMSSGAPSSDESAPSSTAGGSDGIEIAEGSEDEEEEAEIEQDGTLATGS
FT                   LIDIILNGAEDLLTLEEAYNILTLRLRHRMPTDSEGTITPEIEEDIRSAAGPIHDEAPA
FT                   MVRAIQRDICRLLGKPPTSEPAMERLESSPFREITPLVIDRKDRFTPSPSPPPAGDGVS
FT                   PSKAERQGYTAAEIRYRREASGVGAAVLRFLAFIFHNPQLYCCFSEADLQLLLDQVLGI
FT                   TRVPRLPTPNPKRTYFLCVILLTQLKLPLSCVSPLKDKIVRAAVKAVMEDFRLRNSGTA
FT                   SDKPGPNGFKKEGLSAVANLLNTYPTLFFPYYAELLPPCLSAYNNSSVQIRFRAGAAVA
FT                   AFAKAKMIFMAHVQSGPQETWQAVKTVIQKSEFFVVSHLKGAYILPTTSSPVYRKDGGK
FT                   QTAWAVLESRFKATVGENKEVHVACASWAAIVTLIGSAYMLSGLSFKRIDYIMEGSLKA
FT                   TTNAIRPILARAAWNHAIHAYLSYGSTTCYLEDGRIIKSYKPFMASREQEKSFENAVEM
FT                   PIWLALKEALAESNFTTGRNGPVGRRPAHYVWKRNEKSKKLQWLTTTAMTTTAVMYAYI
FT                   GVAFHSQDLPGGDMTALSGLPSSDISDEPITLTLDQKRRSRLDQTWDKIVYPILHSFFS
FT                   IRGIDALLTYSWDILDALTTSSEKQTLWDFDKLVTTGYHSIDVFDVEKESELPSLLDHF
FT                   QAVSLTPADIPSFGKSWVAFRLGKWGHLFMEALSSVHGLNHPDSTQWVKDNSGAPLIPV
FT                   SLSKVWCNLLHALASFSNSVGEEHSVYLLGIMTVTEVLIQVWRRHPKEIIPISQIGDDG
FT                   KCFFDEERVRIGLTSHLFNLSTEILGEDALGNIKFPKEKNASLASYAACAFGIEEASST
FT                   CAGFLLGQVVRTNFVVPNDQEIRSLFMKFVKEVLHVGLQGDSWKRFLGSITIAVPFLFE
FT                   LNEELNMDIWRMIASEWSERIVYDKQPSPNNYTGNILISLLSDPFRGRQLNSYWHQQAT
FT                   LDDLSQWRKLLETTAQRFKAKRAVIHSGLLETLAAHLTDFLEPKDKTLCSPTTLYCLGA
FT                   ATSLISFQPEIHRNQYSPWQADANHVPVDFLTLLNSSLTHAYSAAQFPNAKIHHGLKIL
FT                   LESINVVLGKVPVGYREDVLCPLMEGLRVWMKDDSGVVSQDMAQLLDDLNATILSLQTN
FT                   SASSSCDLTISPQRIQLILDLYSSRAIRSALVGQNLMTLISCILERSYNYPTPEVIGAV
FT                   EKLFGFLMLFFNEMSPENAKQLFNTVPLGLVTWLKDTNKLVEQSPLEEKLNDLYRLILT
FT                   LFAEIIPSHIPADSTTVNALSPIYSSRASYMPLAFLEFWSITFQGIHNLAFDDDTKAFL
FT                   RDMMEVQEGKFEVPGLSLETQMAHESFSSPQPRHLSQSQLNQTPLQVSGMDMESGQSYD
FT                   ADESQIDSYAKTEVVSVDDGKAQTNSGLVREQGIRQPADGPITGSVVTREDVFGPAPAT
FT                   VKRVKRRVKAKNIEGKGKTKKTAAKGVRQKSGSAKTFKPSVPVQTELESQTGCEVESPL
FT                   GEASEDECIVVQPEYEYYIRKGLTPPPDHPASVSSPTQGSQTEVETKDVAENAEPKTGS
FT                   PSSEQHQTSISQRASLLSSAGRWLAKVPSLSFFSPSNTSKSHVPMEMPADNSLSEPASV
FT                   GKKQAGRKPRKRKASGQHQNPPKRARSNVSVSSLHSEGSQRQIPVVEINSRSRSSSSPQ
FT                   AMKDDVRKVAVEVPSGDKGKNNVPVPTEGPEDEDELLLSPESAKKQRQEEEAHLRLAMG
FT                   SLGSQSWNESISGRFDDAPTDRSPDQVTPLRPRRASILKVPSGPSPTRRTAQQVHILSM
FT                   MEEVVRTKEAIDTLDFEGTKMLLKQLKEIHEVAEERMLARMDEMRGK"
FT   gene            complement(1152616..1154922)
FT                   /locus_tag="CND04140"
FT   mRNA            complement(join(1152616..1153249,1153312..1153955,
FT                   1154003..1154269,1154323..1154922))
FT                   /locus_tag="CND04140"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1153434..1153955,1154003..1154269,
FT                   1154323..1154778))
FT                   /codon_start=1
FT                   /locus_tag="CND04140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42830"
FT                   /db_xref="GOA:P0CO34"
FT                   /db_xref="InterPro:IPR009286"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO34"
FT                   /protein_id="AAW42830.1"
FT                   /translation="MNDGNHYRPAISPNPSADTQPSDWAYIAEGGAHIVFSYQGRSKTY
FT                   ATRALRVRKPSATTEPLAQAEENDLFGQWRRNILPKLLPRQLLTTSREVILEDRWYKEL
FT                   LAMVDVVRPDQRKSGIDFAAKGDRRGVLLEDLTSSEDDGAIAVAIEIKPKWGFLPCTEH
FT                   LHPPESVSIKSHVSRFRLHQHFRGCSDDPPYDPLDLFSGDKMRMRTALDGLWTMWEISR
FT                   GKVNNWKVFVGGKEISPDDLQNGLLPIGGDDFVTKITQLTLDTLQTSFALPLLKNLQQN
FT                   LDPIDISSLAALFQAEYPNSPPFDPDLIPDVSAVELNGFVDIYISDPQAGQRMDSWSLR
FT                   ERIIAYALSAIFKDCSLFIRGFLKHAEDGVWRLVSGSDSVKVIDLDLKPIKNIQKWAET
FT                   DEKVWKYWLETKGAR"
FT   gene            complement(1155532..1156627)
FT                   /locus_tag="CND04150"
FT   mRNA            complement(join(1155532..1155760,1155805..1155814,
FT                   1155892..1155911,1155964..1156102,1156166..1156422,
FT                   1156499..1156627))
FT                   /locus_tag="CND04150"
FT                   /product="acyl carrier, putative"
FT   CDS_pept        complement(join(1155726..1155760,1155805..1155814,
FT                   1155892..1155911,1155964..1156102,1156166..1156387))
FT                   /codon_start=1
FT                   /locus_tag="CND04150"
FT                   /product="acyl carrier, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43287"
FT                   /db_xref="GOA:Q5KI56"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI56"
FT                   /protein_id="AAW43287.2"
FT                   /translation="MYRSIPLFRSTFPHYIRHSMAISYRPKPVKLLHKTFSMRRFADGP
FT                   PEPLALTKDEITDMLLRVLNQFKQIDSSKLIGNASFTTDLGFDSLDHSELIMSVEETFD
FT                   IDVADNDICELDSMDKTVDYVAKTLEAQRLVEKIKQS"
FT   gene            1156886..1159834
FT                   /locus_tag="CND04160"
FT   mRNA            join(1156886..1157669,1157718..1157980,1158032..1159141,
FT                   1159199..1159834)
FT                   /locus_tag="CND04160"
FT                   /product="RNA polymerase I transcription factor, putative"
FT   CDS_pept        join(1157030..1157669,1157718..1157980,1158032..1159141,
FT                   1159199..1159801)
FT                   /codon_start=1
FT                   /locus_tag="CND04160"
FT                   /product="RNA polymerase I transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43278"
FT                   /db_xref="GOA:Q5KI55"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI55"
FT                   /protein_id="AAW43278.1"
FT                   /translation="MPLSSITSASLLMTKVVKLPQPSNPVPKSRQKSKKFAGVMVTNDS
FT                   PVSGSSRASSMAGRKRPRESDGDGKIRSRRTKSTGDAKDSRGSSSSAKDREAFQRSLIA
FT                   VFVPKALQESKEGNMTHYNDLLAHFLPTPTMPIVNLPPLLPLLRAVSAHVSLLSPDIHG
FT                   SLVSAIISLPWATGDEKFVRAFIGWAAVLVTAQPGWMKEIVGMGVKGLTWQPCFGAPST
FT                   VSRRVFHARHHLLLSHLISLVPTLPNVLQPLMIRHFPNKREPEVSQTTWIRNCCELVGY
FT                   CPELGGRMWGEIVDRMLRIDVEITNSLDQDDDESSDDEYEPQMATPQSIMTTLDPLDLL
FT                   ISQEIPRSRSVSHSPEIGVDDEDSEGDPDPDDLSSVDGAESDAEDIAVNELKEAEERAK
FT                   KNANTKAMREKLDGMLFHFFQHLEEYLAGRKEHPSALEMASERMETDVRSGASTPTVET
FT                   PSIASTSLSRKQPPSPAQSLSYFQTLLNLFSRQILPTASTQHIPFLLFLTSSFSPAHTE
FT                   LFLGLLVSQALYATTSTVPSINSQPVSMNQRIAATVYIGSVVCRARFVTDDQARTVLTY
FT                   LLAYMDGKLHQSRVNKRHSTDELPLFYAVCQAAMLIFCFRWRAFLAGADKEGDGVLGDM
FT                   EMDGESVDDEGKAEGKWMADLDVLQNAITSDLNPLLGCNPTVVSTFAKVAHHTNFAYCF
FT                   SIIEANQQSSHPRSSSSHALSKTAVPASRSSSGAGSNRQDPTFGSQTLPRQARQLNVDA
FT                   GLDSYFPFDPYDLPKSKRFIETLYRTWDEVAIDGGLDSDSDGSSESESDSQAGDKSDGE
FT                   SSFEDHLAPKGLPLPKLKVGSYGDRRRSLWDSKQDAGLSSSLEGMSISPGRIGMGVFTS
FT                   "
FT   gene            complement(1159853..1161672)
FT                   /locus_tag="CND04170"
FT   mRNA            complement(join(1159853..1160165,1160236..1160479,
FT                   1160538..1160617,1160672..1160741,1160796..1160948,
FT                   1161023..1161120,1161181..1161292,1161349..1161444,
FT                   1161557..1161672))
FT                   /locus_tag="CND04170"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1160015..1160165,1160236..1160479,
FT                   1160538..1160617,1160672..1160741,1160796..1160948,
FT                   1161023..1161120,1161181..1161292,1161349..1161444,
FT                   1161557..1161632))
FT                   /codon_start=1
FT                   /locus_tag="CND04170"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43286"
FT                   /db_xref="GOA:Q5KI54"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI54"
FT                   /protein_id="AAW43286.2"
FT                   /translation="MPSNSPTVWKFELEKTLQACTHDYRDLALEQAQALAEPPSALTAL
FT                   RMIHHSHPYLINGFSPLEKETANLYDWSRAEVYKEISGSRRVTVAVTDDGLADSVRERH
FT                   DGRKTFVKALETKMTMSQLTEKLGRSADQDSFIYYLQSQDGNIYRDQPSSSGPPELEAF
FT                   QKYFKRDVSWMKEAIGKQAEAVNLWIGDSRSTTSLHHDPYENIYHVLAGSKTFTLLSPL
FT                   ETIHLDQRFYPPSTLKRSPSGQLYPEYDYPNPSCGPRIPWVENLCLPRSARSISVTLHE
FT                   GDTLFLPAGWWHRVEQEGGEEGIAVAVNYWYPSEIHPERYAYERFFRRIAIMSGMEGLI
FT                   PPMGDEESINSEENDDPDR"
FT   gene            1161836..1168320
FT                   /locus_tag="CND04180"
FT   mRNA            join(1161836..1162091,1162144..1162561,1162616..1163381,
FT                   1163429..1164609,1164668..1164859,1164919..1164980,
FT                   1165045..1165166,1165220..1165275,1165334..1165376,
FT                   1165433..1165735,1165788..1165944,1166003..1166039,
FT                   1166091..1166220,1166268..1166368,1166428..1166926,
FT                   1166991..1167002,1167053..1167082,1167369..1167512,
FT                   1167571..1167727,1167778..1167840,1167890..1168320)
FT                   /locus_tag="CND04180"
FT                   /product="hydrolase, putative"
FT   CDS_pept        join(1161955..1162091,1162144..1162561,1162616..1163381,
FT                   1163429..1164609,1164668..1164859,1164919..1164980,
FT                   1165045..1165166,1165220..1165275,1165334..1165376,
FT                   1165433..1165735,1165788..1165944,1166003..1166039,
FT                   1166091..1166220,1166268..1166368,1166428..1166926,
FT                   1166991..1167002,1167053..1167082,1167369..1167512,
FT                   1167571..1167727,1167778..1167840,1167890..1168145)
FT                   /codon_start=1
FT                   /locus_tag="CND04180"
FT                   /product="hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42828"
FT                   /db_xref="GOA:P0CP36"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP36"
FT                   /protein_id="AAW42828.2"
FT                   /translation="MSSIPTPPDANGNPLIALAVAVIYAILYVLQGVKYGVSLLTIGIP
FT                   SCIVRMLQYSLTISLGFPHLLALFAGALLALFFLIRYRYLTRYAQLKESALPPPSPPAL
FT                   ASRLLPLDGDGLGLPDSRSQTSSFHNYLDDFLSAIRIFGYLEKPVFHELSRHLQTRRLA
FT                   AGDTLEIGGGEFWCVVEGKVQVFAPDASSQGTPTPSSDTNSPTRPSFNGYHLLNEVSTG
FT                   GTLSSLFSILSLFTEDIKLSWKSSADDEGEEEQIFEGAPEQSSAKLRVRRANSDVSQLG
FT                   PDSIGVRAMDPTPLPESIDSHGDSSVPQRRRERSSSIDAAGETVREREGIFASASLPIS
FT                   STEPPSPRRSQSLRSSPRLNSATNLLSSQSEHLRSSVPRKAGIEIGSKALKGTIARATE
FT                   DTTLAVIPAAAFRKLTRKFPKASGTIVQVVLERFSRVTFMTAHKYLGLTREILQTESSL
FT                   NLLVTHPLPRSFYTGGGMQALRARFQPEALAKESVHYDSLKSSPNARVSSKDYFNYVPA
FT                   SPTVKAPSLPAMTPKPLSPIIHKSSLGQTATTTVKNEPLNGGSSPLDETRDKVPSFGLS
FT                   TAAATNPDASFRHASPFIRRTSAMRQQVAAGDLAMSVHNLPDESGQAYYRPTAITPGLS
FT                   KMDTWQRRYSSSWNLNDSPHTDGQPVDPQRDDESLLNESFDLKEAVLNSIAKSIGLYQE
FT                   AESNSDMIARSSMAPSVSALSTPNSPMFPPNAGTPLQGSTRSRPPHFGNVLDLINASSQ
FT                   NEGVIGGMLREAAFNSRPDDEASSISMSLHDSQGGASGVDRKIMKDLERHVEILFFKKG
FT                   SVLVKEGERSPGMYYVIDGFLETSLPFRSTSSNQENPNSTPGSKHRQSSFGSSNERPFK
FT                   TALGLDTSKGKELDDGSKKDEALFTVKPGGIAGYLSSLCCTDSYVDITAKTDCFVGFLP
FT                   HHTLERIIERRPIVLLTLAKRLLSLLSPLVLHIDAALDWQQLNAGQVLYEKGDKSTDFY
FT                   IVINGRLRAFTEKNDNMHVLREYGQNDSIGELDVITAVDRSETVHAIRDSELVRIPAAL
FT                   FDAISIKHPETTVQFMRLIAGRVRRALGDEMNGRVPGLPTTDMNLKTVCVLGSTRNVPV
FT                   TQFAGKLKNALEEIGASTSYLDQGIVMRHLGRHAFARIGKLKVAGWLADQEQHYRTVLY
FT                   VADSPPASQWTLTCIRQADLVLVVSMGDDPSLGEYEKLLLATKTTARKELILLHDERTV
FT                   APGSTRQWLSNRPWIQTHYHVELPGVVTPARPIPPVHDAAAIAAFKHLREQVETRIKKY
FT                   RGLRPFTRPRRPPHMNDFARIARRLCGQQIGLVLGGGGARGISHIGMLQALEEFGIPID
FT                   AIGGCSIGSFVGGLYARETDLLETAGRTKQFSGRMGSMWRILSDVTYPFVSYTTGHEFN
FT                   RGIYKAFYNTHIEDFWIPFFANSTNITHSRMEVHRTGYAWRYVRASMTLAGLLPPLSDN
FT                   GNLLVDGGYMDNTPIQPLRENGIRDIIVVDVGSVDDTSPRDYGDSVSGWWIFFNRFNPF
FT                   YERRVLSMTEISSRLTYVSSVKTLEGVKATPGCHYIAMPVQQFDTLGGFKRFSEVMEIG
FT                   LKAGRETLKKWKEEGKLPTGLVDEAKGSKAVQRGNRLRRMSI"
FT   gene            1168599..1171160
FT                   /locus_tag="CND04190"
FT   mRNA            join(1168599..1168743,1168882..1168959,1169030..1169229,
FT                   1169300..1169559,1169617..1170115,1170170..1170239,
FT                   1170308..1170372,1170436..1170624,1170691..1170747,
FT                   1170813..1171160)
FT                   /locus_tag="CND04190"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1168663..1168743,1168882..1168959,1169030..1169229,
FT                   1169300..1169559,1169617..1170115,1170170..1170239,
FT                   1170308..1170372,1170436..1170624,1170691..1170747,
FT                   1170813..1170930)
FT                   /codon_start=1
FT                   /locus_tag="CND04190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43279"
FT                   /db_xref="GOA:Q5KI52"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI52"
FT                   /protein_id="AAW43279.1"
FT                   /translation="MPSPNSSPKGTSSTKKKHAPTSAISTLGSTIALPLNTLTSLLTLQ
FT                   NAEDSKPRLSKLSWLPDIVVYKSSILPIVLGPVLTVTLFSAGVAAASLWWDKEVGLTNN
FT                   VVPLLSVVVGLLLVFRNSSAYERYAEGRKDFTCLISTARNLSRNIWVAVSLPSPSNGAA
FT                   EIQISRNNLTEEKKKVIRLVVAFVIATKHHLRGEDGVQHNDLKGLLPTTMMNSKNWRSS
FT                   FTPPSFVSTQHLSSSPNAYDDHEIDEETSLGLVSSSPIVAPGQSGSSNRWRTANNSSSH
FT                   GRVSAALKEGPCVGTGLKRRPTAIRIIVADHDANGKRSGLFSGNREENGKVDERTPMIK
FT                   TRVKSGPLISLGEPGGAEIGLGKMVQLGLPLIIAHEISRSIFKFRRMGCLETGGPAGLN
FT                   SLQAAVSSMIDQLGSMERIVQTPLPYVFCVHLKQVVSLYLFILPFTLVDAMGWKMVFIM
FT                   FCISMTFMGVEGIAAMIEQPFGTDPSDLNLDLYCTELLCECEGLIECLSEGDEGDMPIY
FT                   SRPIIVDQATVDLSADDREDD"
FT   gene            complement(1171202..1171876)
FT                   /locus_tag="CND04200"
FT   mRNA            complement(join(1171202..1171285,1171342..1171512,
FT                   1171577..1171633,1171819..1171876))
FT                   /locus_tag="CND04200"
FT                   /product="ribosomal protein s21, putative"
FT   CDS_pept        complement(join(1171254..1171285,1171342..1171512,
FT                   1171577..1171633,1171819..1171822))
FT                   /codon_start=1
FT                   /locus_tag="CND04200"
FT                   /product="ribosomal protein s21, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42826"
FT                   /db_xref="GOA:Q5KI51"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI51"
FT                   /protein_id="AAW42826.1"
FT                   /translation="MENDKGVLVDLYIPRHCSATNRLITAQDHASIQLQIADVDADGKA
FT                   IRGSATTIAICGRIRAQGDSDDSINRIATKEGLLKNVWSYTR"
FT   gene            complement(1172639..1173960)
FT                   /locus_tag="CND04210"
FT   mRNA            complement(join(1172639..1172829,1172893..1173659,
FT                   1173708..1173779,1173848..1173960))
FT                   /locus_tag="CND04210"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1172710..1172829,1172893..1173659,
FT                   1173708..1173779,1173848..1173929))
FT                   /codon_start=1
FT                   /locus_tag="CND04210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43366"
FT                   /db_xref="GOA:Q5KI50"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI50"
FT                   /protein_id="AAW43366.2"
FT                   /translation="MALPSSLHVHPHFNAEEAAHVVTGFVSSLENLPGEVTFLLEEIRE
FT                   KDVRISQYVQRINSRHMSLTKTAKTLASLPPSNATFPLPIPPGALLPSSHLSQKEAQSL
FT                   AKIQNEWAQVLTLQDEKVKLAERLERIVLRAKERAKHQWVKVGGMEIEEVEKWSGTGEL
FT                   GNGEVVLPPGGLGSGIDGRPAKKRKPNIPSLSVNHTKQAIHPSISMPPPPPPSRPSLSA
FT                   RSSHSNVPSTSHTHTSSLGQHGSRSRRVSVASDEDADGEPDEGDTDMVDAADAEGETDE
FT                   TLYCICRQKSYGEMIGCDCDKCPYEWFHVKCVNISGPLPDTWYCPDCVARYGFSNDKGN
FT                   KKARKK"
FT   gene            1174081..1174975
FT                   /locus_tag="CND04220"
FT   mRNA            join(1174081..1174157,1174237..1174555,1174604..1174975)
FT                   /locus_tag="CND04220"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1174118..1174157,1174237..1174555,1174604..1174625)
FT                   /codon_start=1
FT                   /locus_tag="CND04220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43280"
FT                   /db_xref="GOA:Q5KI49"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI49"
FT                   /protein_id="AAW43280.1"
FT                   /translation="MTAPVIFRSGALLTAIGISSGAFGSHGLRNLSPPVTERQISSFST
FT                   ASSYLIYNGLALLAISFHPGFAVGSATRRYKFAAGMIVGGAVAFSGSIFALVLGRDRFK
FT                   QLGPVTPLGGVAMIAGYIALAL"
FT   gene            complement(1174593..1177358)
FT                   /locus_tag="CND04230"
FT   mRNA            complement(join(1174593..1177155,1177204..1177358))
FT                   /locus_tag="CND04230"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1174680..1177155,1177204..1177223))
FT                   /codon_start=1
FT                   /locus_tag="CND04230"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42824"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI48"
FT                   /protein_id="AAW42824.2"
FT                   /translation="MMAGLLRCPNFRGTVLRNVSPTIPRKSGSIYRLSTRQNQTCAPSD
FT                   HRLLSTKKPPEGSRFENEATHLIYARPLASSSTPPIPISQVIQILQQTSCDLITLVQLV
FT                   SDLEKGDLAYVQEALRYLLPCLGRRRMAVLLPRVLDIWMEKVDVELEEGRVEQAQLQTW
FT                   YHQIVKMLSHFIITPGETTHQSHQDPLPGYIKKQVVRLISHLIDILPFFPSSSTQRPCI
FT                   NFSLLERLFTRRYLSTELRVVLAKHCVENGIELSARMWHECVMVSLSENDTKMVRKLEK
FT                   RKQAALDKEAEAQETFRGKRRSQTKSKRRRRLRKIADLISRLQITNTDSSHEKLFHVLE
FT                   PYLDPPSLESLPSLPANPSSPSDGKGLSHIPSSHLVQHAWSILLTRLSKDKTVSADMLL
FT                   ELSDSMPMKYTTGRTLTPIMHGLLRRGEGPRAWSIWRELVSKESKLEKRSEKGLFVDRV
FT                   SLSVGAQICHGVAGLDNAIEMVDLWAHRPWQPPPVQGQMENSIFLDTQCVNILLTLCQI
FT                   DGATSTAFRLWKAALPRWGVYVDHISLKILIDIARYHNVHDKSVQPDADVFKERLRQMV
FT                   DGFSFWREGRGEEGAAVAYDAYEDAGFAKGSTSVLLAPSGNFNAHEKEDWRFEKPWQMA
FT                   RVIFRQVVLGNWPHLRETQSPLDEVDQSAFDKFTSLFDGDLHIPRHASGDKPRKLNQDS
FT                   LPDPNARYTHIIPTASTFHSYISLLGYYNHPHEIPVALAWMKALSIVPTWFTMRLALMH
FT                   ICEAEGPRRWVRKWGKEGKGRLVRDEEIMRRWLEEWLLQEDSGGNGGLGDNRADIVPSE
FT                   EEVAAFRRMFAERNQRVTA"
FT   gene            complement(1177754..1180479)
FT                   /locus_tag="CND04240"
FT   mRNA            complement(join(1177754..1178923,1178976..1179258,
FT                   1179311..1179658,1179708..1179858,1179909..1180479))
FT                   /locus_tag="CND04240"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1177839..1178923,1178976..1179258,
FT                   1179311..1179658,1179708..1179858,1179909..1180327))
FT                   /codon_start=1
FT                   /locus_tag="CND04240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43285"
FT                   /db_xref="GOA:P0CM78"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM78"
FT                   /protein_id="AAW43285.2"
FT                   /translation="MSALAARRATAAAASPKPEQPESSIEEVSVSGALTLPSPKRRKTR
FT                   QTSPKPRSKARYSDDVPTSRQFFQATESLAEQRTGRFSPSAPDSDGGTSSSSVGDSDED
FT                   MAQEDEFEDRREVDGERDQRKVSVAANMSSSGPFKSLDLMPVDITSQFNPKDNVNFCRI
FT                   TEGQLASAEMNDGHPGPGVIVSLARNESLTIAGLFLLTPLQNTLSIYSTALSPSMSSFP
FT                   VYAPTSHPLPVISPASTQAPGKGTLSILNNIKLPLSFQKESDKTLLLIRENRCGIDGLR
FT                   NGAVPGFSNIWLEDNGPWGLRGVHPVVGSFPVPVYPYCTPPSWSHAISSLSSSDVNLQT
FT                   PFVGLVKGPKRSGKSTFARALLNNLLRRFRKVAWLECDLGQGEFGSGAVVGLWILDKPA
FT                   LGPPFTHPLLPSRSHYLGTYTPLTCPDEYLVAIRHLIEHYKYELQYTSEYSALHTTVHD
FT                   KISTHVPLVINTQGWMKGLGEELLNVIESMAQPTRVFSFESQSEEVYSGQGWTSTPPWQ
FT                   ATQLPYDPAYPTTEPVETEVTQTYSLETAPVSALQARYTPADLRVLSAITYFHASLHPT
FT                   QSVPVTWDISSPLVCTIPWEVELGIGKALEKVYLIGEGSEGVLEEDLPIALNGAIVALA
FT                   EMLGSYEDEPTVYEQGRSPPPTDLVNILGLAVIRSLSSGNSVNPGLKLQLLTPLPPSYL
FT                   SRARILIKSGALELPLPGMIDWRRGGINEEGMLGKGWEEIPFLDVGGLDVIGGERRRFR
FT                   KNIMRKGM"
FT   gene            1180647..1183493
FT                   /locus_tag="CND04250"
FT   mRNA            join(1180647..1180793,1180852..1180901,1180971..1181007,
FT                   1181062..1181125,1181179..1181220,1181267..1181337,
FT                   1181389..1181587,1181642..1181999,1182046..1182165,
FT                   1182213..1182514,1182567..1183493)
FT                   /locus_tag="CND04250"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1180723..1180793,1180852..1180901,1180971..1181007,
FT                   1181062..1181125,1181179..1181220,1181267..1181337,
FT                   1181389..1181587,1181642..1181999,1182046..1182165,
FT                   1182213..1182514,1182567..1183427)
FT                   /codon_start=1
FT                   /locus_tag="CND04250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43281"
FT                   /db_xref="GOA:Q5KI46"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI46"
FT                   /protein_id="AAW43281.1"
FT                   /translation="MSVRNIREAEGLLMEVHDPSKGPVLPKDGQRNVLITSALPYVNNV
FT                   PHLGNIIGSTLSADVFARYNRTLNVPTLYICGTDEYGTATETKALEEGVTPYELCTKFH
FT                   KLHTEIYEWFQISFDKWGRTSSPEHTEITQGIYRRLHDNGLFRLETTDQTYCVDDKLFL
FT                   ADRFVEGICPNCGYDDARGDQCDKCSLTFSSPTQLLNPRCKRNKAHTLSVRPSTHACYR
FT                   LDLLQPRLVEWMQKARVKGKWGTNAVITEKGEIVEPRMLGEGLRPSAVTRDLKWGVEVP
FT                   KVGDEEEDKAMEGKVIYVWFDAPIGYPSITATYTEEWEKWWKNPDNVELYQFMGKDNVY
FT                   FHTVLFPAMLLGTEERWTMLHNISSTQYLNYEDTKFSKSRNVGVFGNNARETGQPPEIW
FT                   RYYLISQRPENSDSSFLWSKFIAANNNELLANLGNFVNRVVKFINAKLDSKVPGPEDFA
FT                   GGEVAPPADSLDVDFVTDVNTRLKEYREQMDDTKLRGGLATAMALSARGNQYLQENSLD
FT                   NALLASNPKRCAEVLLNAVNLIYVLSVVFHPFMPNTSEGILRQLNAPARSLPTKFSIDI
FT                   LPGHVLGKAEYLFKKIDNVNGEQEKKWQRQYGGDAVVADHVAPPGPGGHPEGGKVPKVK
FT                   DTDAESKKAAHEARRAQLAKEKKAAQAAADAKKTPEEKELEAKVEAQGKRLAAIKKGLE
FT                   EGDAEKEMSVAKSLKTELADLRKRLKGTTI"
FT   gene            1183805..1188981
FT                   /locus_tag="CND04260"
FT   mRNA            join(1183805..1183950,1184020..1184193,1184245..1184266,
FT                   1184324..1184544,1184600..1184678,1184749..1187138,
FT                   1187212..1187441,1187507..1187792,1187844..1188981)
FT                   /locus_tag="CND04260"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1183903..1183950,1184020..1184193,1184245..1184266,
FT                   1184324..1184544,1184600..1184678,1184749..1187138,
FT                   1187212..1187441,1187507..1187792,1187844..1187873)
FT                   /codon_start=1
FT                   /locus_tag="CND04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42822"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI45"
FT                   /protein_id="AAW42822.2"
FT                   /translation="MASTARAKSVRNILMELRKVCQHPYLSAPELEIFDLPLEEQHRQL
FT                   LNASGKLQFLKLLLPKLIARGHRILLFSQFKMALDRIQDFLYGENVKHLRLDGDTQQAQ
FT                   RQKYMDQFNAPNSDYHIFLLTTRAGGVGINLASADTVILHDPDFNPHQDQQAIARAYRY
FT                   GQEKRVLVFKLMIKGSVEETIINKGKRKMVLDHLVVQQMGKETEENDFEDLFLKGVEGM
FT                   YSGQGGINIPDINYNSKNVDELIDRVEADAEAEAKAMAERERQDKNGVVKQMKSKQGVP
FT                   FQFSRIWEADKNELIHDEVQDTVKDEEEEEDVDWEQLMVAVQAERQLRLQKEMEESRIR
FT                   RKLKSKEGVYKIDDDFEVDEKKRRKNKGKGKGVELSSSDAEYMDGGLSDNGSATDIPDI
FT                   DLETLKDDLSIDPIVAKSSGGVKRKRSKKILDNVFNQSTAPHVCPRSSLSHVSTSETPP
FT                   GSLTTYPAQPGLSLIEPRQNNTAQYSSLSKTGLSGSMLSANAPEEANDTFSSSKKRNPV
FT                   DFAQARQTHPPIHSVRPPIEIIAAQNIVQWLFLIIRELAWGHHIGHWATLGVREIPAEK
FT                   RKRLYCIIAADVDGYLRRFRQTPYFLEREQREAVERLLDSGWPIIPDISALIAVPEKAA
FT                   VLIDPPFPVSGSGHRESTYASMPPAPPKYVSETSEILRGATAPEISENDGNTGDAAKTS
FT                   SNSVTSQGTVSMPPAPPKYVPEAQAILPDATPPETPENNENTGGAAKSLLSYETSRDTV
FT                   SLPDIRGPGAAVLPSSFKEKEDIQNRSDTTSAGGHSIPLAPQILEQTLHSPVQMPTLVA
FT                   STPSLSTEIAPVEISQSAHISNGSPSVSRQPGHVTPTHSTGSSLPELNLQTNGVNDIHK
FT                   SSEAASASEPAPLAHTSEPALIQSSLKIPSGLPIQLSSSQAVKGTLPSSSRQSSEIIVA
FT                   DSSGEPGRCEYCLEDGHRLQDCQRMYSVEILEKAFLAIKQSNLSEGQKRRDLETLDRLK
FT                   SFMIKAGKLQKDYHFPESSFVAVMSNRSPSSNACHSSVPEPGAQGQLTIDKDTRNEGKR
FT                   DISASESAVHIISTQSLLSTPPQMASVAPQVCPFCETNCGRPLRACIQATGDRKSLKRK
FT                   IRKLKEKIDGLTKAPGEPQTDKQQMERIMLRKMQSSLFDCYKKWPKERPSDL"
FT   gene            complement(1189374..1190791)
FT                   /locus_tag="CND04270"
FT   mRNA            complement(join(1189374..1189576,1189652..1189722,
FT                   1189794..1189988,1190037..1190068,1190118..1190172,
FT                   1190232..1190290,1190341..1190357,1190425..1190445,
FT                   1190512..1190542,1190590..1190668,1190714..1190726,
FT                   1190771..1190791))
FT                   /locus_tag="CND04270"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        complement(join(1189544..1189576,1189652..1189722,
FT                   1189794..1189988,1190037..1190068,1190118..1190172,
FT                   1190232..1190290,1190341..1190357,1190425..1190445,
FT                   1190512..1190542,1190590..1190668,1190714..1190726,
FT                   1190771..1190776))
FT                   /codon_start=1
FT                   /locus_tag="CND04270"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42820"
FT                   /db_xref="GOA:Q5KI44"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="InterPro:IPR040463"
FT                   /db_xref="InterPro:IPR041672"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI44"
FT                   /protein_id="AAW42820.1"
FT                   /translation="MTLYYSICFVLLMAELSLFCTIVCPMPFAIRKKMFHFLSENPVVA
FT                   KIQYGLKITFIFVAVLFVDALQRMVRIAQEGATAKMKQDMTDARTETNYAARRFYAQRN
FT                   LYLTGATLFLSLLLARVFYIILDFIQVQESYTALQAKTAKASGAAGENEELRNRIAELE
FT                   AKERDFETLKKQASQQNAEYGRLADEHNRAAGAVSDKKAD"
FT   gene            1190959..1194082
FT                   /locus_tag="CND04280"
FT   mRNA            join(1190959..1191334,1191405..1191594,1192398..1192617,
FT                   1192690..1194082)
FT                   /locus_tag="CND04280"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1191293..1191334,1191405..1191594,1192398..1192617,
FT                   1192690..1193977)
FT                   /codon_start=1
FT                   /locus_tag="CND04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42818"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI43"
FT                   /protein_id="AAW42818.2"
FT                   /translation="MIDDGKRGVWVEGREKTRKIVDIWQKGATFPQPCLDELKVKLNNA
FT                   VASAGPSNSADSAAVKKERKPLSLADGEPKGSGPYNRSTTPPYPPPAYILAKYARRSSK
FT                   SSRKVAESKPEQPGQAQPGELPPEVAKLLGIEKQESAKDEKSHTPLSGIPANVAALLPS
FT                   TFDPSSHSSSPHTVPSAAAAVASQESTAPPPLAINHEQLAALAKFASNSQTTSGGQHEL
FT                   HELPPFPPPHPVPSGVITPQPYIPPPKPKPISPPGARYHTSSSSRSDRGLGERGSPRHI
FT                   DKERGERDYQHRQDDHWRAGRQRDNRSRSRSPDRRTNGHQRMNIPRRRPAASLPNPLPP
FT                   PPPAARLGQGRGIGEGDGEEDMALDVSDGEERAKQAGAAQAAAYPPPIVAPPYVSVPPD
FT                   VVAPPFPPPSSALQHQPPPISMPMSSGQPMKRRNDLVTLHTFPLQTFDPSSADSWAKLG
FT                   EAWQNSTGRKPEQMELMHWLATGQVMDFKMMLMGTGHENGDSSSQSHVSPGDMNGLSSA
FT                   TANPAIGLLPPSQMRMDVGAGSIGQPPHLSIGGGDQWRNVQGQAQWGNDDSQRLWGAQG
FT                   QGY"
FT   gene            complement(1194087..1195125)
FT                   /locus_tag="CND04290"
FT   mRNA            complement(join(1194087..1194269,1194344..1194603,
FT                   1194668..1194783,1194886..1194913,1194961..1195125))
FT                   /locus_tag="CND04290"
FT                   /product="small monomeric GTPase, putative"
FT   CDS_pept        complement(join(1194245..1194269,1194344..1194603,
FT                   1194668..1194783,1194886..1194913,1194961..1195092))
FT                   /codon_start=1
FT                   /locus_tag="CND04290"
FT                   /product="small monomeric GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42816"
FT                   /db_xref="GOA:Q5KI42"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI42"
FT                   /protein_id="AAW42816.1"
FT                   /translation="MGLSLSRIYSSLSSLAFWGKDKEVRILMVGLDSAGKTTILYRLQI
FT                   GEVVSTIPTIGFNVETVSYKNINFQVWDLGGQSSIRPYWRCYYANTQAIIYVIDSSDTS
FT                   RLATSRSELLTMLSEDELKSVPVLVFANKQDVEGALSPGEISDKLGLAGQEKGREWSVR
FT                   GSCAIKGDGLEEGLDWLVNTIQK"
FT   gene            1195202..1197932
FT                   /locus_tag="CND04300"
FT   mRNA            join(1195202..1196050,1196117..1196241,1196318..1196383,
FT                   1196451..1197932)
FT                   /locus_tag="CND04300"
FT                   /product="nucleolar protein, putative"
FT   CDS_pept        join(1195291..1196050,1196117..1196241,1196318..1196383,
FT                   1196451..1196750)
FT                   /codon_start=1
FT                   /locus_tag="CND04300"
FT                   /product="nucleolar protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43282"
FT                   /db_xref="InterPro:IPR019327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI41"
FT                   /protein_id="AAW43282.1"
FT                   /translation="MASSLQETLPAQPTSLPVSPENNKKEKKARKRAKKDQPPSEAVST
FT                   EPKPNAESERPPRKPRARKSKGGENQLDPLPKNNASAPESKVEGEVEAKDKKKRRKRES
FT                   RAGTEAETKECLKEVATGDGAAIVDHEKDVKKVQDQEKGEDNGADKVEEREKTSDEASK
FT                   EGKKRKRQTEQAHVESQTATVEASPAAITAEENEEPKEKKPKREKRPKIKSVKGAIDTP
FT                   KQPEVDVQAAPEGSEGTTIFTDSSLSDQAKKNIFYAHLFALSQSPSPAPNTPSWKFSKA
FT                   KQNWLMRNIFSNIEVPETYFEMVLGYLKTTQGHSRNTLIEQAKKILEPPLVPPVESVDP
FT                   AVEEITDAAMPETASPKEESEVENSTQNRLDNVDPDIPIPEASESNSEQLEKEKEKEKQ
FT                   IKETRARQLLEAMGVAQ"
FT   gene            complement(1196948..1199961)
FT                   /locus_tag="CND04310"
FT   mRNA            complement(join(1196948..1197727,1197778..1198008,
FT                   1198057..1198138,1198186..1198736,1198786..1198856,
FT                   1199543..1199670,1199908..1199961))
FT                   /locus_tag="CND04310"
FT                   /product="protein kinase, putative"
FT   CDS_pept        complement(join(1197666..1197727,1197778..1198008,
FT                   1198057..1198138,1198186..1198736,1198786..1198855))
FT                   /codon_start=1
FT                   /locus_tag="CND04310"
FT                   /product="protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42814"
FT                   /db_xref="GOA:Q5KI40"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI40"
FT                   /protein_id="AAW42814.1"
FT                   /translation="MTSMDLRVGGKYRIGKKIGSGSFGDIYLGVNIVSGEEVAIKLESV
FT                   KAKHPQLEYESKVYKTLAGGVGIPFVRWYGTECDYNAMVLDLLGPSLEDLFNFCNRKLS
FT                   LKTVLLLADQLISRVEYIHSRNFIHRDIKPDNFLMGVGKRGNQVNVIDFGLAKKYRDPK
FT                   THLHIPYRENKNLTGTARYTSINTHLGVEQSRRDDLESLGYVLMYFLRGQLPWQGLKAA
FT                   TKKQKYDRIMEKKMTTPTEVLCRGFPHEFAIYLNYCRSLRFDDKPDYSYLRKLFRDLFI
FT                   REGFQYDYVFDWSLQPGVKSSGATGEDGLQAQDNQRQLRSQTKARDTGGW"
FT   gene            1200150..1200915
FT                   /locus_tag="CND04320"
FT   mRNA            join(1200150..1200197,1200242..1200304,1200357..1200470,
FT                   1200523..1200624,1200678..1200915)
FT                   /locus_tag="CND04320"
FT                   /product="chaperone, putative"
FT   CDS_pept        join(1200195..1200197,1200242..1200304,1200357..1200470,
FT                   1200523..1200624,1200678..1200869)
FT                   /codon_start=1
FT                   /locus_tag="CND04320"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42812"
FT                   /db_xref="GOA:Q5KI39"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI39"
FT                   /protein_id="AAW42812.1"
FT                   /translation="MSFRVVPPTAQTSTDPHVVSTQATVHPISGTHDTFRHGLKSAAQS
FT                   VAAGTTSPLQARLEKWSQTQTQLQQNIQRSTFGLAVPLKQAMEVKLVSESLHNPLLEQS
FT                   TLSGLPIGGSHNLSLEILQGRDESLDADEFMGGSQSMAEVLDVNGALERKRGI"
FT   gene            complement(1200748..1201780)
FT                   /locus_tag="CND04330"
FT   mRNA            complement(join(1200748..1201156,1201211..1201427,
FT                   1201504..1201557,1201636..1201780))
FT                   /locus_tag="CND04330"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1200981..1201156,1201211..1201427,
FT                   1201504..1201557,1201636..1201755))
FT                   /codon_start=1
FT                   /locus_tag="CND04330"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43284"
FT                   /db_xref="GOA:Q5KI38"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI38"
FT                   /protein_id="AAW43284.2"
FT                   /translation="MSLQDRFASQDPLSLLSGATTLSLITAASQASLAYNLPVVLFGVL
FT                   SYEMKNSNAPFRQFLILIPLTFILDLYAILFRSLSILPWIVTLLLALLKAPLFFSCLAQ
FT                   LRERGGELSLEGWTGIGGFNRLGGQNSWGMPASMPGDFGDNQPSAAPAQQTFPSSGGFR
FT                   LGGDEEQGQGHPTGAPGRNGYQTIG"
FT   gene            1201938..1204974
FT                   /locus_tag="CND04340"
FT   mRNA            join(1201938..1202066,1202117..1202139,1202203..1202220,
FT                   1202289..1202377,1202442..1202612,1202675..1202779,
FT                   1202832..1202869,1202920..1202935,1202987..1203067,
FT                   1203133..1203236,1203305..1203356,1203405..1203446,
FT                   1203491..1203568,1203614..1203656,1203711..1203959,
FT                   1204010..1204056,1204107..1204417,1204480..1204587,
FT                   1204653..1204974)
FT                   /locus_tag="CND04340"
FT                   /product="vacuolar protein, putative"
FT   CDS_pept        join(1201961..1202066,1202117..1202139,1202203..1202220,
FT                   1202289..1202377,1202442..1202612,1202675..1202779,
FT                   1202832..1202869,1202920..1202935,1202987..1203067,
FT                   1203133..1203236,1203305..1203356,1203405..1203446,
FT                   1203491..1203568,1203614..1203656,1203711..1203959,
FT                   1204010..1204056,1204107..1204417,1204480..1204587,
FT                   1204653..1204789)
FT                   /codon_start=1
FT                   /locus_tag="CND04340"
FT                   /product="vacuolar protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43283"
FT                   /db_xref="GOA:Q5KI37"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR014485"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041823"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI37"
FT                   /protein_id="AAW43283.2"
FT                   /translation="MRFPLLLPFAALELPVPTAPLEWKQANFLSISDSHGWLLGHQHST
FT                   WPEPNYSGNYGSFASFVIHMRKIADEKGVDLLLIDAGDHHDGSGLVSSSPDSASLAEDI
FT                   FSMISYDVITIGNHELYHYADALDIYENHERWGGRYVTSNVNITVKREGEWQSVPIGQT
FT                   HLKFTTKQGYNVTAFGVIFDFKAHDKGITVQKPSKLVHEPWFQEAIRDAPDYFILAGHM
FT                   PVRGETAEFAPVFDAIRDIHPQVPIFLFGGHTHVRDCVQYDERSIGVVPGKYLETVAFT
FT                   SSSLPSSSGDDRPLDVARRYLDANPTSYQWHTNQTSYTFDTEQGLHISLTLQHLASSLN
FT                   ITDPLGVSPHDYYLARHPWGHPRSVLTLFSDKVLPKTVVDHERGKGEQGKERIIIGNAG
FT                   SLRFDLFQGVFDRNDELTVSPFTSSFLYTRLPASLARNITDQMNRAGASKLMSKSPVTP
FT                   YEEEQRVKRIHDRWLYEQWQAYELENAYEGDTQKVMVDKGKDKPRTLGHVTKDKCPGTG
FT                   DDIAHIPVPFYSDQPDFISSPFPSVAEDEEIDVVCMDFALDDFLTAVNTLDPTLNLNES
FT                   EMKPYAKGLRINSVFGKYAQRYWGAGTQE"
FT   gene            complement(1204643..1207729)
FT                   /locus_tag="CND04350"
FT   mRNA            complement(join(1204643..1205129,1205185..1206800,
FT                   1206858..1207729))
FT                   /locus_tag="CND04350"
FT                   /product="protein transporter, putative"
FT   CDS_pept        complement(join(1204887..1205129,1205185..1206800,
FT                   1206858..1207695))
FT                   /codon_start=1
FT                   /locus_tag="CND04350"
FT                   /product="protein transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42810"
FT                   /db_xref="GOA:Q5KI36"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR035803"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR037868"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI36"
FT                   /protein_id="AAW42810.1"
FT                   /translation="MDEEESFANLISSTALPARPSWDAPSTSPSHDADPWANPFSADTT
FT                   TLPTSFSSSALLSSSPKRTTVSPYVAQLEREATARPFPDPPSVIAAREQELVQKAEDLA
FT                   KHRSVYASSAFASPFESPAVNSGPAADDPFGNPFAQPSAGQERDPATVLFPPGAIDASL
FT                   PPATSGQTEEQGLEILKDLIDDGLTEDGDSGRSLKRAFKKSAQVPREKHELGSERSKAY
FT                   VFSPKKKGSNEEAKQRLLNDDMEADKVVKGAEELPLSRENALDKDREKEGLDQHQLQAY
FT                   TETSTNAPSPTTPKANTPTPRSPASVPLPISTVTTPTATRQSTPVPSTENSPDHAKEQI
FT                   KAGKEKDNASTVTLSTPRSNGMSVSPLDASSIEEPYKNLSIGGSAPEQIHSSRDTWNTP
FT                   QPGESQPSVSTTTTRFGGRGWGALDEDDNDGLFGKSTLGMASGSVTGAMTSWGEGEESG
FT                   WGEPGLASLDENTTFPFDDGSDEPASSQPKLEPKPPYASSVSSDSVPFATPPTKRSTLP
FT                   YFQISVSDPTRVGDAVRGYTVYTIRTRTSSPHYQQSTFSCLRRFSDFLWLFEQLSHNNP
FT                   GVIVPPMPDKHSWGRFEDQFVETRRLALEKCLKKITSNPILQLDPDLRLFLESDNFAYE
FT                   SKERKHQIAAQTSSTEKGGLLAGWTSTKFVEQDDWFNSRRAFLEALESQLKSLAKAIEI
FT                   SSKHRVEVAISLADYAESLTALAESDLGASLSAALSQMSGLVAREGDYAEWHAKSEVGE
FT                   LLNLADEYIRFIGSVRSAFAARVDSWKVWQEKDKEVARMKTAREKARISGKLGDRVQSS
FT                   LKEIMEAERRVHEASLEFDRLTKLVKSEFVRFERERVLEFKETLERYLNGLIEKEKEMI
FT                   EGWEGLHSVVARMMEKSQAGQSVGQQM"
FT   gene            complement(1207878..1209196)
FT                   /locus_tag="CND04360"
FT   mRNA            complement(join(1207878..1207959,1208007..1208064,
FT                   1208120..1208322,1208376..1208541,1208596..1208738,
FT                   1208797..1208907,1208958..1209049,1209101..1209196))
FT                   /locus_tag="CND04360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1207942..1207959,1208007..1208064,
FT                   1208120..1208322,1208376..1208541,1208596..1208738,
FT                   1208797..1208907,1208958..1209049,1209101..1209110))
FT                   /codon_start=1
FT                   /locus_tag="CND04360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43367"
FT                   /db_xref="GOA:Q5KI35"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014646"
FT                   /db_xref="InterPro:IPR014892"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI35"
FT                   /protein_id="AAW43367.2"
FT                   /translation="MNNYDGQNPYYGGAGGGYVAGGSPYGSQDSPSRKARGGNQTIRPV
FT                   TVKQILDAQQVHPDADFTIDGVDVAQVLLIGSVRNMSTTATNISYEIGDGTGYIDARVW
FT                   LDSADDESGKTTGIEQDHYVGLMGTIKVFGGKRHVSATHIRPITDGNEVQHHLLKALYV
FT                   SLILRGGTPGNAPKAAGTHDDYNAGATTGATDQSAWSHLEPLQRRILEVLSSEGQGNDD
FT                   GVHVTHIIKFLNGADENDFTVALDWLTDNGYVYSTLDESHYQVL"
FT   gene            1209341..1210496
FT                   /locus_tag="CND04370"
FT   mRNA            join(1209341..1209878,1209931..1210134,1210182..1210496)
FT                   /locus_tag="CND04370"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1209381..1209878,1209931..1210134,1210182..1210391)
FT                   /codon_start=1
FT                   /locus_tag="CND04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42808"
FT                   /db_xref="GOA:Q5KI34"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI34"
FT                   /protein_id="AAW42808.2"
FT                   /translation="MPDPELSPIDPALQQPTLNSIQEAHDSSGVNPLNEFAQQVLGREA
FT                   DAENLLDFGRAHSILGEEQTFGDLLQAERRKDGEDEDDVDADRHMEHHEHGHEHVHEGH
FT                   LQGQEEDVHYMAENVEQVMDPLPGRARGIRQAKKRRVGDDVIDGDGQIIDPLEYAKSRK
FT                   DNHREVESRRRQAIADGIAEIAQLLPSPPAPKEGKGQLLKRAVTYIHELLGKIARGVEE
FT                   IAQVEQEKQKLRMDIAHLEARLADERSRSIRFESSWRQAEDLAASSNFELERLKAELEK
FT                   LKAEAEPAEDQLLPAEAAREEE"
FT   gene            1210633..1213423
FT                   /locus_tag="CND04380"
FT   mRNA            join(1210633..1210844,1210901..1211072,1211137..1211211,
FT                   1211272..1211348,1211396..1211602,1211661..1211893,
FT                   1211948..1212150,1212199..1213178,1213242..1213423)
FT                   /locus_tag="CND04380"
FT                   /product="monovalent inorganic cation transporter,
FT                   putative"
FT   CDS_pept        join(1210783..1210844,1210901..1211072,1211137..1211211,
FT                   1211272..1211348,1211396..1211602,1211661..1211893,
FT                   1211948..1212150,1212199..1213178,1213242..1213329)
FT                   /codon_start=1
FT                   /locus_tag="CND04380"
FT                   /product="monovalent inorganic cation transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43289"
FT                   /db_xref="GOA:Q5KI33"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI33"
FT                   /protein_id="AAW43289.1"
FT                   /translation="MSTAPPDTEILNPEDEEFYASWGLCILCVLLIGALISSYYLQVKR
FT                   IRAVHETVISIFAGMVVGLIIRLAPGHMIRDMMSFKHTFFFNALLPPIILNSGYELKQE
FT                   NFFRNFAVILTFAFLGTFITAVGVGVLVYIWSFLGLEGLKFTLLECLIFGSTLSATDPV
FT                   TILAIFNTAKVDPKLYSIIFGESILNDAVSIVMYETLSHFHGEDIYVSSLFHGVGIFLF
FT                   SFLISMALGVSFGLACSLGLKHSHLASYPHIESCIITLVAYTSYFFSNGLAMSGIVSLL
FT                   FCGITLKHYAYHTMSRRTQRTTKYMFGVLAQLSENFIFIYLGLNLFTQDVQVFKPLFIL
FT                   VSAIAVMASRYAAVFPLSELINWIFHTRGQRTEEIPHSYQMMLFWAGLRGAVGVALAAG
FT                   ITGDNADALRTTILVVVVLTVIVFGGTTSRMLEVLGIRVGVEDEDASSDDEEPWTAQPG
FT                   HLALQSGAGFRRYPYSSQNSRGWEDPSELDLQSPEGSPYNQTLKLSHSRQARSSSYGQG
FT                   RYGYGVRSGFSTNSDESDEEVLPSAGPSGSYGDGYDPEANVPGTSSDNRAGEGKGPSMI
FT                   FRDGQWFTALDERYLLPLFSNSVTARRHHAKKAVRKGALAASGAGGRDTPGTGSKSGST
FT                   SGTPRRASLELGDDGYGGDGESENGKNKGLPRTFSGSVSDFFFSKSEPSPLPSTSLPLD
FT                   ERGK"
FT   gene            1213439..1215513
FT                   /locus_tag="CND04390"
FT   mRNA            join(1213439..1214235,1214295..1214609,1214667..1215160,
FT                   1215215..1215513)
FT                   /locus_tag="CND04390"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1213583..1214235,1214295..1214609,1214667..1215160,
FT                   1215215..1215483)
FT                   /codon_start=1
FT                   /locus_tag="CND04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42806"
FT                   /db_xref="GOA:Q5KI32"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI32"
FT                   /protein_id="AAW42806.1"
FT                   /translation="MDKPSLPEYLVGGRYFHAKTRRPVTLRYIGHLPPSSSSRDPSSQV
FT                   WLGIEYDDPLFGKHSGVYQGIQVFHTREEGSGAFLKFAGRPLQEGKNLVQSIEERYGPI
FT                   IPNDEGQPPQIAGNVHANSKGLILGSSKGSIIVETPNNWADAQKRVGNLEKLRIMGFED
FT                   EGITELGGDKNLRDIMRARLRGVEWLNLSRNLLKGWGEVAQIVECFKGLQTLTLSHSRF
FT                   DGLSSDLPDDTRQRLGAFSKIRELHLSDCSTTMKEVVLIISFLPNLRVLHLEANRTIST
FT                   LLLDEQEYQILDRCKTLKELRLGGCPISRWDEIAVILEHLSGLESLDLSFTPLSHVPRP
FT                   SITTYANIRSLSLFGSCLLRWEYIDHISQYFPALTSLRFSLSSGAISSIAAKGTQNSSA
FT                   FISASSDLQRSLIIPKLPNLIAFNSTTITPSERRDAELFYINHVKSRLSEHPDERESWG
FT                   RYVELCKVYGRDETSTEKKPEAGLKRKMITLRVYKHPTDPSPGTLALLPSSSIKLLLHR
FT                   VSRLVGATSTASPRLWTVIDKGGELEKVIDISRKREGNDWTVGWWFEDGDCVLVDEDES
FT                   "
FT   gene            complement(1215530..1216778)
FT                   /locus_tag="CND04400"
FT   mRNA            complement(join(1215530..1215846,1215909..1216364,
FT                   1216418..1216480,1216536..1216620,1216676..1216778))
FT                   /locus_tag="CND04400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1215547..1215846,1215909..1216364,
FT                   1216418..1216480,1216536..1216620,1216676..1216740))
FT                   /codon_start=1
FT                   /locus_tag="CND04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43309"
FT                   /db_xref="GOA:Q5KI31"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI31"
FT                   /protein_id="AAW43309.1"
FT                   /translation="MKHGIHQRKLGRMPAHRIALLRNLVSALLHHESIKTTLPKAKEAA
FT                   KMAEKIITLGKKGTNQARSKATAYLMPAHHAPSSSYAPSPSNPTPTLPPLAHPQSLDPE
FT                   TFTPPTSLLPKLFTTLATRYAARPGGYTRIHKFGRRPGDNAPHAILTLVDGPRDLKFEM
FT                   TARTAGKESLDAMEGWEQIESSVDEWEGLSEKTKRDVAKVLRYRSEDDKKLFKAKATSF
FT                   SDTVTVEESAYGGVRKPALELQKPTFRAPSLNLPRSGKHIHAGERLSGMSVAHTGLGLA
FT                   RGALARSKSGKSGLDRTPLLWGQSNRLDRVKGEVVTSSADA"
FT   gene            1216921..1218033
FT                   /locus_tag="CND04410"
FT   mRNA            join(1216921..1217151,1217330..1217468,1217529..1217548,
FT                   1217618..1217627,1217684..1218033)
FT                   /locus_tag="CND04410"
FT                   /product="acyl carrier protein (acp), putative"
FT   CDS_pept        join(1216945..1217151,1217330..1217468,1217529..1217548,
FT                   1217618..1217627,1217684..1217691)
FT                   /codon_start=1
FT                   /locus_tag="CND04410"
FT                   /product="acyl carrier protein (acp), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42804"
FT                   /db_xref="GOA:Q5KI30"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI30"
FT                   /protein_id="AAW42804.1"
FT                   /translation="MFRTLPLLRTARTALRQTAPVALRPQPLALSLRPLAARGYAAAAG
FT                   LSKDDITVRILDVLKSFEKVDSSKLTNNASFTSDLGLDSLDAVEVVMAIEEEFAIEIPD
FT                   AEADEITTVQDAINYVANTSEAH"
FT   gene            complement(1218015..1220084)
FT                   /locus_tag="CND04420"
FT   mRNA            complement(join(1218015..1218635,1218688..1218813,
FT                   1218869..1219119,1219172..1219342,1219398..1219690,
FT                   1219740..1219847,1219893..1219973,1220010..1220084))
FT                   /locus_tag="CND04420"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1218099..1218635,1218688..1218813,
FT                   1218869..1219119,1219172..1219342,1219398..1219690,
FT                   1219740..1219847,1219893..1219973,1220010..1220074))
FT                   /codon_start=1
FT                   /locus_tag="CND04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43308"
FT                   /db_xref="InterPro:IPR028942"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI29"
FT                   /protein_id="AAW43308.2"
FT                   /translation="MLRVITAQPAMSQPPADAPQDDWQVAYVWAFITAFNLRHRIPRLE
FT                   SQQDLELSLRQPVATRPDDLLESTLICFLSNLRPALRNLNAENVQSYLSNYISDQLATT
FT                   SEWTVWDPSWPINEENRGSCCTDDPDRAELGRLRYQGEPPADRARRNPLKRMEEKGGGL
FT                   FELDWAERARLLRQLVDWQLTHSEHIRTIINNAKKGPEAKSKKGTASKKPLQDEAPSIS
FT                   IEPLGQNRNRQRIWALDDSWRLYRSGNPFKRPCPMESFTHTRDDYFAYIAEVEEYGGQS
FT                   QEGTKKEKATSQHRRFIKGVQDEKKLAEILKDRIERIEKEEARVQRAKRKIAQAVQLQQ
FT                   AAEMRSTRTRRPVRKVDYIYGNEDEDEEPLPTRRSSRPSRQSGRDDESYSALDSRGRPV
FT                   IPGERRSTRVSGAAREVVEDDDDDDDDDRDDETPRQPPPLPQPEAVSGPANGRKAPKGY
FT                   AWVQENVGGEDSSPGVAAVDDQQRRVEPTSAKQQDVQSEDQVATPLESTDTSRVEFEQS
FT                   EQGVRLGMLEQGENDEQTEITMEVEV"
FT   gene            1220198..1221274
FT                   /locus_tag="CND04430"
FT   mRNA            join(1220198..1220304,1220360..1220504,1220839..1220958,
FT                   1221013..1221274)
FT                   /locus_tag="CND04430"
FT                   /product="ubiquinol-cytochrome-c reductase, putative"
FT   CDS_pept        join(1220204..1220304,1220360..1220504,1220839..1220958,
FT                   1221013..1221147)
FT                   /codon_start=1
FT                   /locus_tag="CND04430"
FT                   /product="ubiquinol-cytochrome-c reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43290"
FT                   /db_xref="GOA:Q5KI28"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="InterPro:IPR036544"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI28"
FT                   /protein_id="AAW43290.2"
FT                   /translation="MLLGQHYSQPPPIAPSTMPSIAKMVFGNGPLGPSFAPWIRQYPGV
FT                   QKYWARWSELYRHAAGYRQKGYLLDDLVIEENKAVQKALSRLPERVAYDRVWRHRQGIM
FT                   MSMHHTDLPRNKWTPPEKDEQYLTPYINQVLAEEQERADWDHSVVERIKKRQAGRQNPF
FT                   ERV"
FT   gene            complement(1221222..1222815)
FT                   /locus_tag="CND04440"
FT   mRNA            complement(join(1221222..1221400,1221465..1221541,
FT                   1221600..1221705,1221784..1221809,1221867..1222239,
FT                   1222297..1222368,1222442..1222464,1222549..1222571,
FT                   1222626..1222650,1222719..1222815))
FT                   /locus_tag="CND04440"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1221264..1221400,1221465..1221541,
FT                   1221600..1221705,1221784..1221809,1221867..1222239,
FT                   1222297..1222368,1222442..1222464,1222549..1222571,
FT                   1222626..1222650,1222719..1222762))
FT                   /codon_start=1
FT                   /locus_tag="CND04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43307"
FT                   /db_xref="GOA:Q5KI27"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI27"
FT                   /protein_id="AAW43307.2"
FT                   /translation="MAIISTLAAIGMAVGPPLIYVDQAISIIKKKDSSGFSQDVCGVII
FT                   IANIIRIFFWLGEHFEIPLLVQSILLIVSQLLLLAICLHYSRGSPEETYFSLPRQPTEP
FT                   PSADPAHTADYEYSGPSSSQPPDVPVRRGFFKSVIQGLKEGRRPFDFWQWAGYGSYLEF
FT                   LAGLIVVLGIAQVGLGRWPWYIDALGFIALTIESTLPIPQFIANYRHKSCYGFRASTLA
FT                   GWFFGDAFKTVYFFMRGSPIQFKVTAIMLVCWDSAVFAQRIIYGANPPVNQTGVEFDAH
FT                   DENNDESRALHDAHNDREER"
FT   gene            complement(1223069..1224016)
FT                   /locus_tag="CND04450"
FT   mRNA            complement(join(1223069..1223372,1223434..1223580,
FT                   1223642..1224016))
FT                   /locus_tag="CND04450"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1223148..1223372,1223434..1223580,
FT                   1223642..1223842))
FT                   /codon_start=1
FT                   /locus_tag="CND04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43306"
FT                   /db_xref="GOA:Q5KI26"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI26"
FT                   /protein_id="AAW43306.1"
FT                   /translation="MAFASTSRHLPRESVYPTPPSSDYLNALEDCVQATEACSRSLQTG
FT                   LDRFEPGVRDLPRLTKIFKHKHHFLVLPEPTIAAHKAALSQSLAPQIDHLIAKTDSMVD
FT                   SEKTKVGNLEERLRILESARLSASASTMRTVSSGRSTKAVSNTSDDTSSKISDLNMKDL
FT                   SILQRKKVMQLKAKRDRLEREMARLGR"
FT   gene            complement(1224236..1227205)
FT                   /locus_tag="CND04460"
FT   mRNA            complement(join(1224236..1224465,1224522..1225215,
FT                   1225266..1225522,1225572..1226424,1226475..1226600,
FT                   1226649..1226806,1226866..1227205))
FT                   /locus_tag="CND04460"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1224268..1224465,1224522..1225215,
FT                   1225266..1225522,1225572..1226424,1226475..1226600,
FT                   1226649..1226806,1226866..1227132))
FT                   /codon_start=1
FT                   /locus_tag="CND04460"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43374"
FT                   /db_xref="GOA:Q5KI25"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI25"
FT                   /protein_id="AAW43374.1"
FT                   /translation="MSHTIPLSLATLRSHSIFNPPISTSSPPEDEWELLDRPSADEPMS
FT                   QKQGRMVLRDKDLIVAMGSEVRMMSLNASDGSWKVEDGLVGSYRTLKSAHLTFAIHHIV
FT                   VNPTGRLLAVVGHHQIVVLVLPKPTHSGKLEEGQAEVESIPIDDFLFSRSSNDAITQVQ
FT                   WHPWGENGNSLWVLTAGGKLREYDVLQPHDCVQTFDFIPERTRSVPKFTAVDPLSRYAS
FT                   SFAFGSSMIGFSPLMVYCLLASGDIHVLGPILPLRTEMPAQYLRQLKTFADIRLATVQN
FT                   QARDVFGAGTSGLGKAVLQAEWVDHLVKQVRQTEEMQSKKQVEEGGGTTQNMPMRASIL
FT                   GKSTKIHSSPVENRSSSLGLPRNGFVRVHPPHLTESGGPAPGAHRTLLRQGPVVFSPGP
FT                   QDVGNVDEDLDEEQMATDLLIVQVDANEMDAGGSKGTEGQTVIAIAWSGGRVDIGLELD
FT                   APEARWISSRDPTPPAPVIHITDSILLSFPNNDPFIISSNAPVLARDPLYNDVFYVSHA
FT                   FGVDAINVRAVVDGLDGDGNEGELPVPQVSRLVESNSVPNTPIVGMFGFCNITFGYGIV
FT                   VLASTGQVAYMELDIRFGDRLALLPSSARAASGFRTELKDTQSLLDNAFEVDSLVSSVK
FT                   TGTKASRRQIPDYNMPLTVINSDHLSALQDVSSHVHAQAQRIRTASQAVENRLDLQVEE
FT                   LQRHARLMAECRQEVASLQKSETLGRIESLIRRQEGIQKRVEKMLGDMALEYKPHVGDG
FT                   ERKWFKELQEMEMKLNGDSGEAKEALTDKVQSLRNQLASLLPVVSKAHQKESAAASTLA
FT                   PKQIKPLKAALGARSEELKRLLNKVEALDIRLDTAPVE"
FT   gene            complement(1227474..1228794)
FT                   /locus_tag="CND04470"
FT   mRNA            complement(join(1227474..1227809,1227862..1228037,
FT                   1228098..1228268,1228323..1228345,1228400..1228480,
FT                   1228569..1228794))
FT                   /locus_tag="CND04470"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1227659..1227809,1227862..1228037,
FT                   1228098..1228268,1228323..1228345,1228400..1228480,
FT                   1228569..1228755))
FT                   /codon_start=1
FT                   /locus_tag="CND04470"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43305"
FT                   /db_xref="GOA:Q5KI24"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI24"
FT                   /protein_id="AAW43305.1"
FT                   /translation="MPPSVILDCYQHSYFDFPHYLAKNNYRLYMMLLGTLAHLALTITC
FT                   GYSLTVPQAHRETLEEAAVNTKKLIEDVTVGTMSSVFPNGTDNGGRPFAMMEYHAPCHP
FT                   PPSLTFLLLPISLSTHNIMASSSHYASYSVAMPHKDEWSPMSLSRVAFIGNMTFLPDIS
FT                   KEEKAELEKCYLSYHPDAKYWLPGASNSPHSSVWAKLDADDIYYVGGFGDTHYIGHIPI
FT                   DLYTKVGEADEGNGQGQSEQVLSGYSVFRNGVSLLLKNIF"
FT   gene            1229198..1230269
FT                   /locus_tag="CND04480"
FT   mRNA            join(1229198..1229284,1229513..1229794,1229886..1229957,
FT                   1230005..1230269)
FT                   /locus_tag="CND04480"
FT                   /product="structural constituent of ribosome, putative"
FT   CDS_pept        join(1229282..1229284,1229513..1229794,1229886..1229957,
FT                   1230005..1230055)
FT                   /codon_start=1
FT                   /locus_tag="CND04480"
FT                   /product="structural constituent of ribosome, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43291"
FT                   /db_xref="GOA:Q5KI23"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI23"
FT                   /protein_id="AAW43291.2"
FT                   /translation="MDPEGPVTLRTSKFITNRLLNRRQFVLTVFHPTRPNVSRSELSEK
FT                   LGALYKTDKERVVVFGLKTKFGGGSSTGFGLIYDDEDSQKKFEPKHRLVRSNLAEKVVK
FT                   PSRKLRKERKNRSKKLRGKARSKAGEPAKKK"
FT   gene            complement(1230270..1232542)
FT                   /locus_tag="CND04490"
FT   mRNA            complement(join(1230270..1230604,1230667..1230942,
FT                   1230999..1231165,1231212..1231303,1231360..1232294,
FT                   1232353..1232379,1232440..1232448,1232520..1232542))
FT                   /locus_tag="CND04490"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1230311..1230604,1230667..1230942,
FT                   1230999..1231165,1231212..1231303,1231360..1232294,
FT                   1232353..1232379,1232440..1232448,1232520..1232540))
FT                   /codon_start=1
FT                   /locus_tag="CND04490"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43304"
FT                   /db_xref="GOA:Q5KI22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI22"
FT                   /protein_id="AAW43304.1"
FT                   /translation="MPTAGVKTKKVTTYGRKNTQIISIHSDFVEPVDLTSPPVLPTRQR
FT                   QPLTAKPSNDNCNLPAATCQALNSLKSDRLSKAPYKEETLPKVAKGVSPDGTLSKVTVP
FT                   PLSKSPRIVSTKQRRVSRKTSKAIVPRSPAAAHTTLPSAPKIPMESSSMQSTKQQRSPG
FT                   SAIRAKKRLVFEGVILPLRSPISDIRIEELSERLSDVTIKDSSAQKTGNGADKGKSSSQ
FT                   FALEALIQACSSASVQEFNAFIKSFPLFPASKDVFMTKVGEASYSEVFGFSQSAEDADL
FT                   VLKVIPLFSGTVEADGSFPDCSSPEDVLREIEITKKMNQVPGGGFVEFRGAYVVEGKYP
FT                   KELLEKWDIYKSTQGSASVRPSAFGPTQKYCLVALCNSGIDLEALQFDSSRGWVQAAGI
FT                   FWQVAAALASAEDWTKFEHRDLHEGQILISSLSESPSSTEPENYLSPTYTSLQTTIIDF
FT                   GLSRLNMPTPVWSQIPEEVYEGKGAQWDLYRAMRSRIGDDWGGFHAITNLMWLRYILQY
FT                   MLVSKSLRKPRALRSTQVPRLARGVKPKPDTVRSEKAWGILQKVEEMMEYSLNFDMSAR
FT                   SNRNHKNDALKPLTSARDLVNWGKDEGWIG"
FT   gene            1232915..1237245
FT                   /locus_tag="CND04500"
FT   mRNA            join(1232915..1233063,1233186..1233330,1233376..1235637,
FT                   1235689..1235874,1235950..1236210,1236264..1236745,
FT                   1236800..1237245)
FT                   /locus_tag="CND04500"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1233035..1233063,1233186..1233330,1233376..1235637,
FT                   1235689..1235874,1235950..1236210,1236264..1236745,
FT                   1236800..1237115)
FT                   /codon_start=1
FT                   /locus_tag="CND04500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42802"
FT                   /db_xref="InterPro:IPR005635"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI21"
FT                   /protein_id="AAW42802.2"
FT                   /translation="MSQIMAHVPKAPIGELIKTPSKTQTVKRTRAATAAAKEKTEKIKG
FT                   LNAQLLSPSSRQTSRPALSPLQFGSRNVNTSDAPSPSPIKSKSIKASSPSKSKAKRGRS
FT                   RKAEPAMISNENASPRFENKNICSSSAAEPQHPFSPSRQSKLGDRMEQASSTKVEKTLK
FT                   SKPVMAETVENITEALIDGQNMASDRDETSLQSAVNHSPAGEIQSLPTVDEIVDMDIDN
FT                   IQGAGETQLKEMVEVMPELDNVKPEETVLPSSAEEDAHDVTVKEKGTGDHKLGQPKEGF
FT                   GEGIRKEAVIEDVQSAQPTINEGGEIFGSNIGSNELKEGLVPHTEFPVQLSSRTSATES
FT                   KGIVTAAISSTQSAAVPQSPLAPAKASFMESSASSSTTAFSSGAVPIPVRQVRSSWLSK
FT                   ALGTGTVPISNASGPAESNSVIGKPFTAPSQQRPSAAMDFSGLRKSLLPIGGLKRKSGE
FT                   GMEGEEEEEEGRRPDKFKKVSSEPYDFQVSTTPGPVGRPKLPSKTPSFGTGSINSNPAS
FT                   QGRSALSSNLIDDSHRPEISKVTKALDELREKTAKDVAKQKASSAGRPESGNGRAPKAK
FT                   STGAGFLRGLLNFGGTSEEEEAIRRARELEEEKIAEAELEKLMWNATKPFIDIESALND
FT                   PSADVSPLPEGNDDAGRSTTPILSPPSKLTPLPLPQLQSQPVTTAVKDEDQEMVDEESV
FT                   LDEIIPAETAEPVDTKDRRQQLSSPAPAFSAVNDVTPVQERPSASHDRREKDQNKVSDI
FT                   NIKKMEEAKERGKEHNYGDQRDTGVEKLDDRRKAIDKSPGTHEAQVDYPYDNNVNDDIE
FT                   INGELPPSTTAPTDILNFSTSSQATNSSTLNHASTMAAKALGVRPATGPVKSLQLAAAA
FT                   AKKEQNAASRKAAMRDQADKRKELLAQKKAEEERQRADEERKAKIAELEEKRRLRAEHE
FT                   KRKKEREARVAAIAKERVAKEEREMQAAKVKAEEEAARKRKLTVALNKSQSSGVPATKR
FT                   LAGHNQSLAKGKEPFRPTKTTSTHPLSQSTTTEQQAPKAFRTAETTHTQSSTITLVKQT
FT                   QRESHVERKPLGQPSRLSAMENQAMRQPQHQQNQIPQQSSSAAPQSWAQVQSSLDEKAM
FT                   AQQSEDIVLPDIASEYSDPDEDSTRDFDRPAWAESPELRKALEAQAHINPDDLFGPIKP
FT                   LNMEELFKVRAGKFRARTSSANWSRGDGLTRAEEVDYARRMGFTSLSYYDEAGGNGPHR
FT                   G"
FT   gene            1237287..1240246
FT                   /locus_tag="CND04510"
FT   mRNA            join(1237287..1238029,1238121..1240246)
FT                   /locus_tag="CND04510"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1237882..1238029,1238121..1239820)
FT                   /codon_start=1
FT                   /locus_tag="CND04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43292"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI20"
FT                   /protein_id="AAW43292.2"
FT                   /translation="MPTDGAGAGAMYASELVTHNHGYQSSSPTSGNWCFCGGPVEEGGI
FT                   YCSVACARYDAINSLCYKSHQSPLLAQNIDFQQAGSLTQAPSQPLLLGSSSTASSTAAI
FT                   AGDDDHWHAPHYRLSHADMRKQERRDERRRRRAEGSSSGSMSSNRSTVQSTSSSIASRA
FT                   VPDLVGGGGHSRNPSVASSVTSLASSAFSLSRNPSVASNHSKRGLGGGFNVDSIIMETE
FT                   GEQEWLRSESSKPYGSISLARQTHHKPLNSRSTSGRQRKNTPDLPLGMGQDMRDVLEEI
FT                   IQMEQSYLVDDTNSPTSPDDPPPPRLFSSQFGPPRTPSPSSNRKRAPPAPGAPDTSVRG
FT                   HRSTLSQNALAPPHTPACQPQRGPRPSSLFGMHQSSLSESHTALYLATASPAAAETRSA
FT                   SPKLETRRSLVFTADNAGPSINVDTEHLSTGVPSLTLPRRNSEANSPMVTPMNRRFVQN
FT                   RTPKAIHPSMDGWRFPSPMNATTPTRSARQSIPDTPLMGESRGIHGIAQNRCCSPERIT
FT                   PALLWPPQSRPRGDSPPINLEPSLFPGSPVAIPYSVNPLSHVERGNMTQGDREDDIMDV
FT                   EMRGSPGYHDSSTEVPGNGGRYLLVPLETESSRGTSHRW"
FT   gene            complement(1239959..1242139)
FT                   /locus_tag="CND04515"
FT   mRNA            complement(join(1239959..1240479,1240535..1240591,
FT                   1240638..1240667,1240718..1240730,1240797..1240817,
FT                   1240879..1240905,1240963..1240985,1241034..1241065,
FT                   1241120..1241220,1241353..1241367,1241420..1241456,
FT                   1241607..1241726,1241819..1241837,1241888..1241915,
FT                   1241989..1242139))
FT                   /locus_tag="CND04515"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1240386..1240479,1240535..1240591,
FT                   1240638..1240667,1240718..1240730,1240797..1240817,
FT                   1240879..1240905,1240963..1240985,1241034..1241065,
FT                   1241120..1241220,1241353..1241367,1241420..1241456,
FT                   1241607..1241726,1241819..1241837,1241888..1241915,
FT                   1241989..1242025))
FT                   /codon_start=1
FT                   /locus_tag="CND04515"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII9"
FT                   /protein_id="ALO60538.1"
FT                   /translation="MALVPTGAPRDAAITIGPFKPSRPGYGPVLSYLQAAQLPTPLKIH
FT                   PLLQLRTWDPKPYAKYLTWNTIEHPMFAAIWVDYDDTETVWIKERGQPATSPIVEELNL
FT                   GHVETGWSIRVRNRMGITCEDVLFAIYDFFASPLYVDELGEMHPRAVRIMEQQYFEKRR
FT                   MGFFDLMEGYRKSDALLGATYFDGIHNDPESVERLKVKYNYHSSNLLLLRLGNC"
FT   gene            1242314..1245011
FT                   /locus_tag="CND04520"
FT   mRNA            join(1242314..1243171,1243224..1243385,1243438..1243828,
FT                   1243892..1243976,1244030..1244072,1244121..1244333,
FT                   1244390..1244587,1244648..1244799,1244855..1245011)
FT                   /locus_tag="CND04520"
FT                   /product="WD-repeat protein, putative"
FT   CDS_pept        join(1242356..1243171,1243224..1243385,1243438..1243828,
FT                   1243892..1243976,1244030..1244072,1244121..1244333,
FT                   1244390..1244587,1244648..1244773)
FT                   /codon_start=1
FT                   /locus_tag="CND04520"
FT                   /product="WD-repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42800"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI19"
FT                   /protein_id="AAW42800.2"
FT                   /translation="MELYMYTPPVYMAPLRPLVKPAPSVPIVKEAPIPELFQAPEGQYS
FT                   LAEPGSMFPLLGNTSPNVASELRLACQPGPFLGGPGFGIPPTPQQTSPSAASASSTCFG
FT                   ATQINGKWEPIYPTRMSWVTVQFPSKTGDRGFGGLLGKSGKGDTAAFLPPAAADGRYPT
FT                   KSSYSSSSSSSSPISSEPQSVPFAMSPPTIQSKWPFTKTINAIPRPKTNMRNSTSDFVQ
FT                   RVIGLDSASKYLAEKGKTVSEVVKWGCWHMGRQWAWGDFGKQANEAEKKKEALVKVLFS
FT                   TPLTCTAIINQTASADRLDVIIGFETGDLLWLDPILGKYTRLNKNGVLNSSRVVGIYPD
FT                   PRQPTHFLVLFADNTILRFNISLEDPINAANITSHPWDVFFDRVLLATTNGHDPSLSSD
FT                   SGTGLSLDREQDVELLKWKNEDWVAGVESEKPKDKNAIVFTGRNPVAALKIGDARINAL
FT                   AYSPDGGKLASVSSDGLLRVIDTSEERITDTFSSYYGGLKCVVWSPDSRLIAAGGEDDF
FT                   VTLFSIGRDARIIARCQGHSSYITSIAFDPQSNNPSSRAYRFVSTGEDGKLLFWDYSPA
FT                   TVHKPRQHHVNGSVQRDAAASSMTVNILDHSRSHTPAERTSGRFHSAPSRKSIPTLQPV
FT                   MSKTVDVTILTNVYCLPDAIATVSRQGVARFWMRPSSRPPPA"
FT   gene            complement(1244986..1248657)
FT                   /locus_tag="CND04530"
FT   mRNA            complement(join(1244986..1245973,1246026..1246081,
FT                   1246135..1246216,1246267..1246573,1246623..1246714,
FT                   1246763..1246905,1246958..1247125,1247177..1247975,
FT                   1248019..1248392,1248450..1248657))
FT                   /locus_tag="CND04530"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1245155..1245973,1246026..1246081,
FT                   1246135..1246216,1246267..1246573,1246623..1246714,
FT                   1246763..1246905,1246958..1247125,1247177..1247975,
FT                   1248019..1248392,1248450..1248600))
FT                   /codon_start=1
FT                   /locus_tag="CND04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42797"
FT                   /db_xref="GOA:Q5KI18"
FT                   /db_xref="InterPro:IPR004583"
FT                   /db_xref="InterPro:IPR018325"
FT                   /db_xref="InterPro:IPR018326"
FT                   /db_xref="InterPro:IPR018327"
FT                   /db_xref="InterPro:IPR018328"
FT                   /db_xref="InterPro:IPR036985"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR042488"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI18"
FT                   /protein_id="AAW42797.1"
FT                   /translation="MSASRPKSSRVIQKPRGISALAARIPTSESTKQQSNVGGKRKAPT
FT                   PATRKGTRPASPISVASTVLSVSDNDEDDEDELEEVPIPIVSNEVQGGDEDEDEQDGED
FT                   EESEDDDGVIHLEIGGETAEEKAKRMVLAKRKKPLTARDRALRLEVHKVHVIALLASAS
FT                   VRNKWCNNSLLKARLLSLLPHPLQAAFNIPPSRFPDRAQRSRLFFEALQSLVTWWSQTF
FT                   FDVSDYALGLRTRPWDEVQGIIESISKVHTPFSRSPSGHGDGEKINKAASKGKGKAAAS
FT                   EELSEQLAFGSGAERLRSVNSLMKKALQQEGSRDVSAQLFVALARACGLGVRLVTSLQA
FT                   VPWRAEKGATKKKAVGAGRGGRTLASRQGLGDEDEDDDEDEMEEVRIPDDVGRSVGGAK
FT                   NNSREAGSRRLKDPADLYRLRKYKPPARKIGSPTKSKPKASQSLADQPPVFWAEVFNRS
FT                   DQRWIPVDPVRGIIRKKRDYEPPTDSGPVRMLYVVAFEEDGYARDVTLRYTKNFYAKTS
FT                   KLRVPAKPNEPQWWSDIVMGFLRRPYHLNRDDMEDAELEMSQMTEGMPMHMSGFKDHPI
FT                   YVLERHLKRDQVLNTANPVGRFKGEAVFRRSSVQNCKTAENWMRSGRKIKEGQEPLKWV
FT                   KQRAVTLQKRRAQELAKQEGEEVTQGLYAEWQTEIYRPPPIRDGIIPRNSFGNIDLYAP
FT                   TMLPLGAVHLPYKGIAKVAKGLGVSYAEACTGFEFKKQRAVPIIKGIVVAAEKKQEVLD
FT                   AYEESTIAAEERERMKREDRALKRWSKLVNGLRLRLRLQQEYGSKDKVNETPSNLFEGA
FT                   GDEGEMRINLRGKSARELLAAAQHQSTKDWEERVRREDISMEEEDGMMPAMAVERESNQ
FT                   ILLGDFRAPSSAISEVTNVTPSAETPRIMLRFKNTSSPQSAAHAASESRSGLTSSQKRK
FT                   AMISGTIEAVDDEQFEDPRTTKGDKTMALPEPVASTTNMRTLRSTRARTREQMKANQAR
FT                   EDKIRQA"
FT   gene            1248877..1252969
FT                   /locus_tag="CND04540"
FT   mRNA            join(1248877..1249102,1249155..1249185,1249248..1249284,
FT                   1249338..1249649,1249702..1249793,1249840..1249877,
FT                   1249930..1250871,1250924..1251070,1251123..1251184,
FT                   1251241..1251339,1251389..1251765,1251821..1251993,
FT                   1252045..1252272,1252322..1252387,1252446..1252610,
FT                   1252675..1252969)
FT                   /locus_tag="CND04540"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(1248956..1249102,1249155..1249185,1249248..1249284,
FT                   1249338..1249649,1249702..1249793,1249840..1249877,
FT                   1249930..1250871,1250924..1251070,1251123..1251184,
FT                   1251241..1251339,1251389..1251765,1251821..1251993,
FT                   1252045..1252272,1252322..1252387,1252446..1252610,
FT                   1252675..1252923)
FT                   /codon_start=1
FT                   /locus_tag="CND04540"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42795"
FT                   /db_xref="GOA:Q5KI17"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI17"
FT                   /protein_id="AAW42795.1"
FT                   /translation="MVSSAAAQDQGNFKLLKSFPIGYAPITVSKWRSEKTGLTVVLGSH
FT                   QAPITNGYFAIASEIFDDTGRPHTLEHLVFLGSKQYPYKGVLDQLANRAGSNGTNAWTA
FT                   NDHTAYTISTAGSEGFLKMLPVYVDHILHPTITDAGFVTEVYHINGAGEDAGVVYSEMQ
FT                   ARENTAGDLMALEGQRSLYPPGSAYRSETGGLMHKLRVLTAQQIRDYHAEYYQPYNLCL
FT                   VIDGAVPIPELFDVLNNQIDPMILANKSGSGPIIPADWKRPFVQTTTAKPLSISKPITK
FT                   TVEFMEEDESVGEVLITYLGPPPTDYRTNLAISVLDSYLTQSATSPLSKEFIEIPKPLC
FT                   TAFSFYSSDRVNKNEISVYISDVPAKHLEDIAGLLQEKLRKIVREEGIDMERMKRILRK
FT                   DQRKLLEYMESRATEVLSDAIIGDFLYGKVDGKELPLAFNDMEDYSSLHSYTAEEWLAL
FT                   LDKYFVSAPSITIVGKPSAALSVKIEKEEKERVARRKEELGDEKLKALEAMLEAAKKES
FT                   EIPPPKEMITSFPITDPSRLTWVPVETAINNAINDNVKSDGGEVQRFVDADGHRLPYQT
FT                   HFSHVKSNFVVVVALFDTIDVPIHLKPYLTIFQNALFSLGVKRADGTVLSHEQTVNELE
FT                   DLTVSQSAHFEFKGNFAEVMAVTLKVEKAQYEQAVAWLRDLLSGAVFDSKRLSVIVAKL
FT                   AQELPTEKRDGNTIATAWANNLTYDASKSSSQACELLNRLHFIPHVAEMLEKEPNAVIE
FT                   KMEELRKHLLDPRKMRVAIQGDILGLQKPLSVLARSFLQVGEALPLEPLSTSQQTLTTL
FT                   GKNPSKKCVIIPMPAIEGSYATFFATGPSGHSHPDLPALRLASSLLNALESYLWKSIRG
FT                   SGLAYGAHVMVYPEAGLVGFSVYRSPNAMLAYQAAGKIMDGLVDGSVELDQDLVDGARS
FT                   SMTYDYARRSETVLGAAGTAYLNEVLKGLGKNADQDLLKSLPGVTLEQVRDVISRYFSP
FT                   LFKAETSIGAVTVSTSKTDEVEAGLRKLGFETERKELPVLQGDDESEHGSDVDMNGSES
FT                   GSEVER"
FT   gene            1253214..1258563
FT                   /locus_tag="CND04550"
FT   mRNA            join(1253214..1255046,1255111..1255246,1255305..1255376,
FT                   1255427..1255600,1255648..1255869,1255918..1256274,
FT                   1256326..1256532,1256580..1256734,1256790..1257323,
FT                   1257376..1258563)
FT                   /locus_tag="CND04550"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1253274..1255046,1255111..1255246,1255305..1255376,
FT                   1255427..1255600,1255648..1255869,1255918..1256274,
FT                   1256326..1256532,1256580..1256734,1256790..1257323,
FT                   1257376..1258470)
FT                   /codon_start=1
FT                   /locus_tag="CND04550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43293"
FT                   /db_xref="GOA:Q5KI16"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI16"
FT                   /protein_id="AAW43293.2"
FT                   /translation="MSPSASNPGYPPFLSPPTVDTRPSHPAQYQPQPQYHQRYFDHPPQ
FT                   HTRYSPATYEYSPLGIEGAPEHVRPVTFAGGGQQPFAANQHYSLHQQVPQKQPQLGTPE
FT                   QLSVPSQYPYQSTHDQFPRLVASSHLPYGSPISTLHYPQVSQASVPESPSLRPESRGNS
FT                   LAPGFQQNTQAETSTSWPLPPIHPLPFSETPPRASLPTTTIVPSQNGFNLANTSTKIRF
FT                   RPPLSPVAISGMVSSRSTRRSSQVHQEEQTVGASGRPQRGATRLAATKSIYKEDDDEEL
FT                   DDAYNSVVDEDVDEGADSTIKVAPAVTTRSGRTQKAPQRFEDDFEDAVTSASPEMRSGR
FT                   RIARGKAKRRLIVDPDEDEEGNAVPPPRNAFPPRSARNSLASANIDSALQQPDVGTSYP
FT                   NGKRSLRSDARAATRTRHSSADADEFEPTEGESTEGRASSDPLGNYDEEPEEEDFVVSD
FT                   DDDSGYGKRRSSRRRTTRATARNTRSTALPTRRSTRSSAKARALDSDEDSSPHKRPNLR
FT                   ERTSRPNYHIPTLEELSKEISTQEALAAVAGGSGRAAGGFRGAGGVRYGGVGLPFAMRA
FT                   KDLTQAMGDPDTSDSDDMDFASPFKSGAAGPSMSGGTAVAARGAAGPSDVPNFGRINPK
FT                   STTADADPLGVDMNVTFDNVGGLDNHINQLKEMVALPLLYPELFQQFGITPPRGVLFHG
FT                   PPGTGKTLLARALAASCSSGNTKISFFMRKGADVLSKWVGEAERQLRMLFEEARASQPS
FT                   IIFFDEIDGLAPVRSSKQDQIHASLVSTLLALMDGMDGRGQVIVIGATNRPDAVDPALR
FT                   RPGRFDREFYFALPNREARKKIISINTRSWEPKLSDEMLDKLASLTKGYGGADLRALCT
FT                   EAALNAIQRRYPQIYKTVDRLQLETKSIHVKAKDFMLSIKKIVPSSARSTSSPAIQLPS
FT                   HLLPLLSVPLERINSAVDHVLPPKTQSTALEEAEYEDEAYESFEKHIVLQSLDKLRTFR
FT                   PRILVHGQPGMGQIFLGPAVLHHLEGFHIQSLDLGTLLGDSTRSVEATIVQLFVEAKRH
FT                   QPSVIFIPSLSQWASAVPELARSTFSALLDGIPPSDPILLLAIADSPWADLPADVKAWF
FT                   GFARENKIALDFPNTSERSAYFTDLLASVRKPPTDFPDGVPRRKRVLENLPLASPLPPR
FT                   QPTEAERARDEEKDQAARNMMVVSFTNLVKEFMKRYRKVVASVKDDAMELSRCLVEQAA
FT                   ASAALSQSATALKGAEVVSNIIEDANNNAESQVNEVDGGMNMLPTTENLSESSTGDIAN
FT                   ISAAPVSAVNHLALPSASASTSAALIPTPTWQAHNVDIDTIQRRLIRHKYYTPEDFLAD
FT                   IRKIEENAVKVGDPERQAKVVEMGANARLHISGFDPKWTPEFERYAERMRAKKAARQRK
FT                   KEQAKEIGEENGQNLTASESTHHPNPIAEISGMPDAADTSSKRPREEDDGAEIEYQGRE
FT                   KRLRDDQPDTAEKASVDAPEALTSQSFPPDIACDSPQLDYPPFILPEQDLQNLQAELET
FT                   ATADLTVDQLEQLRATLFDKLWDDRKEWNRTMTVIKMRQRLQEYIKEVNSWKND"
FT   gene            complement(1258529..1259544)
FT                   /locus_tag="CND04560"
FT   mRNA            complement(join(1258529..1258786,1258841..1258999,
FT                   1259061..1259544))
FT                   /locus_tag="CND04560"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1258635..1258786,1258841..1258999,
FT                   1259061..1259283))
FT                   /codon_start=1
FT                   /locus_tag="CND04560"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43303"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI15"
FT                   /protein_id="AAW43303.1"
FT                   /translation="MSLTSVTRVVSKSILGASFTSTTRRLTTTVPRFGRMPPPAHKMAH
FT                   FPRITSSLPSEHSEFRTVMWTGESSQLVLMTIPVGGEIGEEIHHVDQHLVFTSGTAKAI
FT                   VGGEEKEIKAGDLVIVPQGTKHNFVNTGPTPLCLFTVYAPAEHAETTVNKTKEEGDKLE
FT                   DEGKDEPPKWAVRK"
FT   gene            complement(1260055..1262103)
FT                   /locus_tag="CND04570"
FT   mRNA            complement(join(1260055..1261641,1261688..1261856,
FT                   1261916..1262005,1262046..1262103))
FT                   /locus_tag="CND04570"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1260235..1261641,1261688..1261856,
FT                   1261916..1262005,1262046..1262083))
FT                   /codon_start=1
FT                   /locus_tag="CND04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42793"
FT                   /db_xref="GOA:Q5KI13"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR041367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI13"
FT                   /protein_id="AAW42793.1"
FT                   /translation="MASAQVCRNYLNGNCRYGNSCKFYHPPKTAQSNQALKLPFQFTED
FT                   TIRNDLTIELPQWILSVYGAAKYEPNLIYEGELSPEELRWRSVLSLKEGKVQEYVREEE
FT                   TLVSNAKAKITSLVADLSATNKLAQKLHQMRFTNGQQPGAPRPRDFSETAVVPSMQPLS
FT                   GSAPFGARSNVSAFGGGNNSSFGSGGSAFGAMNRANPFSTAAAGGGTSSGSAFGQSAFG
FT                   AGKPQAFGSSAFGGGSQTGSAFGSADKPTVSGGGAFGQAAFGQKSAGAPAFGTSTFGLT
FT                   NSSTKSAFGSSAFGQSAKPSVNAFGSSAPQSAFNQDNKPVKSAFGSSQAPSAFASTPQT
FT                   TATPMPGTAFGQSAFGNPSTRTAANPAAASAFGQSAFGQEAKQNPFGMQPRETVASGSG
FT                   FGLNQPAAPATGGFGSFSNTAHTSANPFGQSSVIPVTAPANVFNESANATQPTSLNSFA
FT                   APSTSAFGSTSAFGAAHSSKPAFGFANTSDSRSAANGYSALNSALKQPQLSGPVPPGWS
FT                   YDDPWTWCLYGNAGTDNGDSLEDEFLDAFKQATFTLGNIPTMPPPLDLRT"
FT   gene            1262248..1264720
FT                   /locus_tag="CND04580"
FT   mRNA            join(1262248..1262307,1262364..1262428,1262482..1262795,
FT                   1262847..1263105,1263152..1263220,1263285..1263319,
FT                   1263369..1263441,1263493..1263878,1263929..1264032,
FT                   1264084..1264458,1264515..1264720)
FT                   /locus_tag="CND04580"
FT                   /product="chaperone, putative"
FT   CDS_pept        join(1262269..1262307,1262364..1262428,1262482..1262795,
FT                   1262847..1263105,1263152..1263220,1263285..1263319,
FT                   1263369..1263441,1263493..1263878,1263929..1264032,
FT                   1264084..1264458,1264515..1264634)
FT                   /codon_start=1
FT                   /locus_tag="CND04580"
FT                   /product="chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42792"
FT                   /db_xref="GOA:Q5KI12"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI12"
FT                   /protein_id="AAW42792.2"
FT                   /translation="MPPPHLTIPSPKHLYAHLSKYVVGQERAKRILSVAVHNHYQRIAS
FT                   LLPPVTEQEPSPPKPPRPQPPPIILESPIPYPPTSSISYFSGSHASNFKKKERASYKPS
FT                   DPASSHWDPSTAGMSPQDPTITHDLLTLRSREGQWARNGYFEPLQPSTPLPTLSGQVTK
FT                   RQRVTSEHDKSLSNEKTAKSYKGKTYATHNESIGNGSETPEHDDTRVVEGESVIIEKSN
FT                   VLMIGPTGTGKTLMARTLAQMLNVPFVTCDATTYTQAGYVGEDVENCVLRLLQAANYDV
FT                   GKAEIGVIHIDEIDKIAKRGGSDVGGGGRDVGGEGVQQALLRLLEGTSLTLSAKAPAIS
FT                   SSTHNSSVSPFPPPLGGGMGSGSPSNTPKATNRAVFGDPPGWDFNNSSNKGLGGKRSVR
FT                   EGLPGYNSNGGGTPAKGDTFVVDTSNILFVLSGAFVGLEQIINRRIGKGSIGFGAPLPQ
FT                   LTTDFSNQSSPLKGLSTVDLTNYGLIPEFLGRLPILSTLHPLSIDDMVRILAEPNNALL
FT                   KQYIKLFENYGSELCFTDKAVREIAREGLDRGGGARGLRGVLEEVLLDAMFEVPGSSVR
FT                   YCLITEAVVRKDCAAHYFSRGQNVAFLEAIERERLP"
FT   gene            complement(1264690..1267005)
FT                   /locus_tag="CND04590"
FT   mRNA            complement(join(1264690..1265555,1265602..1265892,
FT                   1265961..1266007,1266061..1266258,1266321..1266574,
FT                   1266672..1267005))
FT                   /locus_tag="CND04590"
FT                   /product="actin filament organization-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1264806..1265555,1265602..1265892,
FT                   1265961..1266007,1266061..1266258,1266321..1266471))
FT                   /codon_start=1
FT                   /locus_tag="CND04590"
FT                   /product="actin filament organization-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43301"
FT                   /db_xref="GOA:Q5KI11"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI11"
FT                   /protein_id="AAW43301.2"
FT                   /translation="MDKSVKVSDNLGGKVNGLAERRFGTEAFWPVTGDFPKEMDKCARI
FT                   LRAFTVDGVITEEKKDEDASGSKKKKVIRKIPPAVIAKAKGLAIFTSMRSGIAPFGGAG
FT                   GAGVVVAKLPDGTWSAPASISPNNLSTGFLLGVDIYDCVLVINTQKALDSFKTHKATIG
FT                   AELGVAAGPYGAGAAVEAGLEKAPLFSYVRSRGIYAGVEIVGQVFVERYDENGAMYHWP
FT                   DVKAGDILSGKVKVPVEAARLHKALKDAESGKAQKEKGSALDIVIPEGATELELNDGEV
FT                   LKLPPTPDQTTGDEQESDPETERILYPSRPGSHNPSFTSIDKISRDYSPTCGEPTGDAH
FT                   SPNPRLTVPPPLPSRHPKRPSLEKKQSSASDYSEAANNAPSTSALEADVPPSYAEAYVK
FT                   VATGTEYPEERWESSLDDTNRDQMSAAEKKEWEQYLADQKSQGGHLPSSLQDGTVEGEL
FT                   SDRLQNQVLGSDDKNTDSLT"
FT   gene            1267974..1269263
FT                   /locus_tag="CND04600"
FT   mRNA            join(1267974..1268114,1268167..1268322,1268377..1268767,
FT                   1268821..1269001,1269055..1269263)
FT                   /locus_tag="CND04600"
FT                   /product="ribosomal protein, putative"
FT   CDS_pept        join(1268054..1268114,1268167..1268322,1268377..1268767,
FT                   1268821..1269001,1269055..1269189)
FT                   /codon_start=1
FT                   /locus_tag="CND04600"
FT                   /product="ribosomal protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43294"
FT                   /db_xref="GOA:Q5KI10"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI10"
FT                   /protein_id="AAW43294.1"
FT                   /translation="MSIPIGTPLRSLRPSSAARSVRSFASSVSVAHTAEPSLRPRNGSV
FT                   LQGESPEDAWKRNLQEARQWRQRKEYQRSTLSVYIPEGSTAIPKGRSARSPHEATLSTL
FT                   LASGAALGHAANITSHAYTPYIYGKRAGLSIIDLDQTLPILRRTAALVKDIVKADGVVL
FT                   IVGTRPGHQKMIQKAKERLEDNGFAVGQWIPGLLTNAETFFGMKPLLDKSYKPDLVIFL
FT                   NASENTPAIRECTSRHIPTVGIVDTDTDPRLVTYPIPANMESMRTAELIISTLSIAGQE
FT                   GRRLRLKEAERKASQVRASKGRRERR"
FT   gene            1270348..1272061
FT                   /locus_tag="CND04610"
FT   mRNA            join(1270348..1270508,1270564..1270705,1270773..1270915,
FT                   1270975..1271438,1271511..1272061)
FT                   /locus_tag="CND04610"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1270471..1270508,1270564..1270705,1270773..1270915,
FT                   1270975..1271407)
FT                   /codon_start=1
FT                   /locus_tag="CND04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43295"
FT                   /db_xref="GOA:Q5KI09"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI09"
FT                   /protein_id="AAW43295.1"
FT                   /translation="MRLFFVRHGQTDDNVRGIIQGHKDTPLNNYGRFESTRLAKRLSKY
FT                   SITEAWSSPLSRAKETTRIVLQYHDKVPLMTPDELKERGLGSMEGRRRKKGERAPADAE
FT                   DYESLSRRTKSWFDKLLASHEPESSSSRHDHSSHTRYLPTPLHSNNHTRHARYSAHNLP
FT                   VTIDLVLVVTHGAWLSNFVRLLMSPVYHFNVREGVNLGLPCANTSIMVVNCEWKDGRWN
FT                   GVIEDWGNVNHLADVLDKEVQEVADDVRQ"
FT   gene            complement(1271496..1274171)
FT                   /locus_tag="CND04620"
FT   mRNA            complement(join(1271496..1271777,1271851..1272062,
FT                   1272118..1272212,1272262..1272377,1272434..1273007,
FT                   1273059..1273252,1273313..1273423,1273538..1273662,
FT                   1273715..1274171))
FT                   /locus_tag="CND04620"
FT                   /product="co-chaperone, putative"
FT   CDS_pept        complement(join(1271878..1272062,1272118..1272212,
FT                   1272262..1272377,1272434..1273007,1273059..1273252,
FT                   1273313..1273423,1273538..1273662,1273715..1273883))
FT                   /codon_start=1
FT                   /locus_tag="CND04620"
FT                   /product="co-chaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43300"
FT                   /db_xref="GOA:Q5KI08"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI08"
FT                   /protein_id="AAW43300.1"
FT                   /translation="MKGSFLVALPVLFLSLSAQVFGESSIPSAAQIVHNANRLLAEGSY
FT                   SAAARAYGEAIELDPTGYANYYKRATAYLSMGRHNAALDDFEQILRINPGFVQAHYQRA
FT                   KILAKEGDFAKAQYELKAYVQTKSDSEAEELLHLVTVGEAAEKSALQAFEKRKWQVCVD
FT                   HSTKALEVGPNSERLRRLRVNCATELGDINMVYGDLSRLASLDPSTTYLPLQLSNIAYF
FT                   IRASSQAAVHIKQCLHFDPDSKPCKTVHKTIRSLEKDAARVQNFIESGTYRQAIKILDG
FT                   DDGLLVRFEKALDDATKPKDGLPPYLAPQFHPKENSQMRLDLYALACKASVMANDFGEK
FT                   GAHWCEETMGMNEENVDSWISRGERLLKVEKWEEAMRAIEKAFELSGRRQDILPRVQKA
FT                   QRLLKQSKQKDYYKVLGVPRDADERAIKKAFRKAAKVAHPDVGGSEEKMAALNEAYEVL
FT                   SNTELRQRYDNGDDPNDPTGGHQHNPFAHHGGGMPFQFFQQGGGFQGFHQGFPGGGQKM
FT                   HFQWN"
FT   gene            1274445..1276292
FT                   /locus_tag="CND04630"
FT   mRNA            join(1274445..1274897,1274976..1275050,1275104..1275131,
FT                   1275182..1275252,1275307..1276086,1276142..1276292)
FT                   /locus_tag="CND04630"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1274562..1274897,1274976..1275050,1275104..1275131,
FT                   1275182..1275252,1275307..1275348)
FT                   /codon_start=1
FT                   /locus_tag="CND04630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43296"
FT                   /db_xref="GOA:P0CN02"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CN02"
FT                   /protein_id="AAW43296.1"
FT                   /translation="MFNLPYHCKALLTAKQERGLTFDDVAKAINKPEVWTTALFYGQAS
FT                   TDKSTAEAILKALGGEQFWTDYNDRLEAGQEKIDIRRVLNGLSGNGEENMGVKGMVTRG
FT                   ATFEVPPKDPVLYRLYEVLVVYGYSYKALIYEKFGDGIMSAIDFRTSLERKKDPKGDRV
FT                   VITMDGKFLPYSDPSAWGTQ"
FT   gene            complement(1275259..1276688)
FT                   /locus_tag="CND04640"
FT   mRNA            complement(join(1275259..1275743,1275855..1275924,
FT                   1275977..1276022,1276078..1276144,1276197..1276288,
FT                   1276361..1276451,1276520..1276688))
FT                   /locus_tag="CND04640"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1275583..1275743,1275855..1275924,
FT                   1275977..1276022,1276078..1276144,1276197..1276288,
FT                   1276361..1276451,1276520..1276628))
FT                   /codon_start=1
FT                   /locus_tag="CND04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42790"
FT                   /db_xref="GOA:Q5KI06"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI06"
FT                   /protein_id="AAW42790.2"
FT                   /translation="MALIPFITTSLKAFACIWALITFAVGASFISAADDLFGNHFVTRT
FT                   DLTAGNAVIAGGVLTWSYFVAILVVTFIQPENVFISVMLDTIFLSIWFIFFLASVASMS
FT                   TLASVFRDYDRFTWGRLGTATIGLSWVMTFLLLGILLFEVTYTLINFGRSYTTWPTPAA
FT                   NTIVEESIDEQAVLQSVQTTPVGIAVSVLSGARPPMSVPMRGKGVDRV"
FT   gene            1277557..1277654
FT                   /locus_tag="CND04650"
FT   tRNA            1277557..1277654
FT                   /locus_tag="CND04650"
FT                   /product="tRNA-Asn"
FT   gene            1279438..1281163
FT                   /locus_tag="CND04660"
FT   mRNA            join(1279438..1279936,1279993..1280142,1280202..1280762,
FT                   1280817..1280968,1281018..1281163)
FT                   /locus_tag="CND04660"
FT                   /product="negative regulation of gluconeogenesis-related
FT                   protein, putative"
FT   CDS_pept        join(1279685..1279936,1279993..1280142,1280202..1280762,
FT                   1280817..1280968,1281018..1281090)
FT                   /codon_start=1
FT                   /locus_tag="CND04660"
FT                   /product="negative regulation of gluconeogenesis-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43297"
FT                   /db_xref="GOA:Q5KI05"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR027711"
FT                   /db_xref="InterPro:IPR037683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI05"
FT                   /protein_id="AAW43297.1"
FT                   /translation="MDVSPALSALEALSSSTSTSSSGPVNGLIDDHLVQAKRRIMAGED
FT                   PRTVVQELQKAVVKSKKEVEKNLKAWYFALGNMGKAIDKTFPAQLSAISRAYEEPSLFA
FT                   DKDASQALDKAVLESLGRRGLWDSVAALETETSLVFPSERRLLAEELQRITTCLLSNDI
FT                   SPALKWCEENKSFIHSPPHPSSLPYFLHRAVFKSIEDPGHAIMYARQHMMAYLPLYPVT
FT                   KLITSRLYDGANKAEFKGQDTEMDETVINSFEQEDAVDLVALVAMFQSEFKRRHQWPKE
FT                   DPLEVAVDLGSKGGALNVIEKARRVMGEHLGHIRAWTDLPMEVPLPPSRRYHSVFVCPV
FT                   SKEQATESNPPKMLVCGHVIASESFERLLKGGRREVKCPYCPVETAQSAAQRLYF"
FT   gene            complement(1281134..1282641)
FT                   /locus_tag="CND04670"
FT   mRNA            complement(join(1281134..1281417,1281464..1281512,
FT                   1281566..1281607,1281657..1281801,1281870..1281901,
FT                   1281950..1282040,1282096..1282112,1282165..1282197,
FT                   1282249..1282309,1282361..1282641))
FT                   /locus_tag="CND04670"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1281257..1281417,1281464..1281512,
FT                   1281566..1281607,1281657..1281801,1281870..1281901,
FT                   1281950..1282040,1282096..1282112,1282165..1282197,
FT                   1282249..1282309,1282361..1282515))
FT                   /codon_start=1
FT                   /locus_tag="CND04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43299"
FT                   /db_xref="GOA:Q5KI04"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI04"
FT                   /protein_id="AAW43299.2"
FT                   /translation="MVMPTKISHADENTLSTVKEMALNTENAIALAGDAAPVVLGAGGK
FT                   PLPPPYKSTGNEALDTLAFLHMLEQLKIQKRSGWIREGVKQAESISDHMCRMALMAMML
FT                   PNSSERPLDIPRCVMMALVHDLAEAYVGDITPVEGVPTHVKHQLEEQAMDTFLNEMLGG
FT                   KGNKDARERFRSLWDEYEARETPESRLVKDLDRIELALQAVEYERSQDIQTLDPFFKGS
FT                   IPNLEHPVTRQWAATLMEERRQLWTSRGRTHEGLGDWET"
FT   gene            1282810..1287514
FT                   /locus_tag="CND04680"
FT   mRNA            join(1282810..1283008,1283060..1286678,1286731..1286913,
FT                   1286969..1287160,1287214..1287514)
FT                   /locus_tag="CND04680"
FT                   /product="expressed protein"
FT   CDS_pept        join(1282992..1283008,1283060..1286678,1286731..1286913,
FT                   1286969..1287160,1287214..1287339)
FT                   /codon_start=1
FT                   /locus_tag="CND04680"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42788"
FT                   /db_xref="GOA:Q5KI03"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI03"
FT                   /protein_id="AAW42788.1"
FT                   /translation="MSRRIGLSRSSTRPGGRRSTPAMPESQESTQQLSPKVRPGIPISD
FT                   QLDPLSCLTVDHEVPSLELPKFSVGRDVSPLNESVKEYADETQEGNIIWTDMESQSLAD
FT                   RISVKGNEEISSLLLEDSGKQLASSAAFQSLQAMDSGDRADSTKNSTITQFAAIESQER
FT                   PLSKIVPVGSSPQAIEQDQSREFVMVPDTQHDVATADGISPSFIPSNSLSKSFQLRSNN
FT                   LREPLGNEVNLQEEKRLFISVEKRPKIFTSEPSQSISPRKLEGASLFSANGPGGRQTMS
FT                   PISKHSSAKGLSGLENPSRSRSKSHVQASPSDEPVASRRKNETKEPNLSEESFAVDSIP
FT                   IKHPEPLDVIANLLRQHSEEMKGKAEKLKDGKKGPTSKFELSEKQGDELFHRHEKTRIE
FT                   MSEGKEFEVPQSAARISPNRLRTTIVDHDDSPGSSSSSQRTNVTFHSSHYTAPLEQSEP
FT                   SVNVPRQINHTIDQQDGVASQSCHPLRSSPSCHGERFRSFAEQGYLFDENRLSTFDEDL
FT                   FSSSQVVDGGLEVSEDAFSQRSNIFQATQVIRQPSGPLCEADLSSPAAIISPRGLAPTQ
FT                   RSSPDTPENSQTLRTTVTNSIPLHSSPISASVPTSKPPIPSIPPHRSLAYNSRRFTAQV
FT                   STEDNGRFDIPRYRQLQRRAASRIQLNDQLMEPLASEITGSPVGLCEGSIPAHSDTNTA
FT                   PQPIQSPQMGHCSPNKFRRSQDIEVVNEHEPSATVESDVQTTGDDQSNLRPGRINRHSP
FT                   FSPLPRSHLSSKAGLSPLSNNRISASNTSNHLLPSESDTHDDPSNPFLSTYEIVPGPYE
FT                   RRVRKKREIFSPATCSVDRLEVTSIRSPFKVEGIDEESDSSSTPDDPDDFSYRPAVKTA
FT                   RVSRGTGRRGRRASTSIASAFSESKQMRVPSTSPLSTFSDSDKSLTPDDENDVTTRPLK
FT                   KQKLHNAEAKGAKTRTTSATRTNLSSKKKARHLIGKSRAATPPVVEDVNRVLASYGHYY
FT                   YPARIIEPSGLRYKVIYDDNEHRECAPDKLRKLILKRGDKLEAYGRHDLPTKMEVLLDW
FT                   DGNERGVKCASNGTMLGFVKLRFIRIRQQIIKQQFNDRLFAPQIGAKSPTRSILRSPVK
FT                   NFVPLVFEGMIFLILTGVEENSVEYESKSLSKLIEIRGGIVAKDWTQIFEPDLHRGHFK
FT                   RNLGRTPFVIPTGTRPLMTSTFMVALAKGIPVLSVKYVDAAIEEGEAIDWHPYLISSGY
FT                   SCFTGQMMSQIVDTSWGTKNWDAVKAGHLLKPFKGKKVLFIQPRNSLSSLLTLCSTCLG
FT                   AEEVRVVERVSGKELDVILDPKWDYLVIDKMGIPSALKGCKKVANVQWLKQCLVMGKAL
FT                   PPLLTSQDEPEKGASKIKKETSNKGNARKRVNQST"
FT   gene            1287654..1288880
FT                   /locus_tag="CND04683"
FT   mRNA            join(1287654..1288435,1288493..1288880)
FT                   /locus_tag="CND04683"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1287836..1288435,1288493..1288591)
FT                   /codon_start=1
FT                   /locus_tag="CND04683"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2LII5"
FT                   /db_xref="InterPro:IPR018811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LII5"
FT                   /protein_id="ALO60539.1"
FT                   /translation="MLLRQSQHISRGLLSGTVQFRLASPLPHLPHLRATSTSTKPNSSL
FT                   PSTIASPKSTLLQRHFPALAQLSQSTNVSLPSLALSFLVLHEITAIVPAVAFYYFFAYL
FT                   GAGAGLVTWVTRLGHDESSKDSESEAGWKHWVRDWYQEGIKRVDRIGKKYGVLGYEKQN
FT                   AGEDGAAGPMQDLTARTTGAGAAEKVADAVAAYVLVKALLPVRIAVSIAGAPACARFVL
FT                   LPLRKLSRQR"
FT   gene            complement(1288590..1290834)
FT                   /locus_tag="CND04685"
FT   mRNA            complement(join(1288590..1288877,1288937..1289822,
FT                   1289875..1290387,1290435..1290834))
FT                   /locus_tag="CND04685"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1288656..1288877,1288937..1289822,
FT                   1289875..1290387,1290435..1290661))
FT                   /codon_start=1
FT                   /locus_tag="CND04685"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2LJ48"
FT                   /protein_id="ALO60540.1"
FT                   /translation="MRIKLSLLPPFSPSRILFLVPSDVKTIAHLKKYLIKSLSSIAQHA
FT                   SSSRELLLEIEGFQLLSGSDLNIIEPTDVVCVRLAPGSSADSPDKFSDKKRKRNSAPKL
FT                   PKQTKKRRIAVSSTPLEKDGSASVEAVFGKESRKLSQPLALAIPSHVMGGRRASISSSS
FT                   SSSSSSSSSSSSSTSSSSSSSSSSSSSPSSSSSSSSSSSSSPSSSSSGSNSSLDSENPP
FT                   SLKDGFSSKSQQNHAQSLKVHTGNESAIRLLQLPVPPGHGKPQTRNRNARRRLARQYQK
FT                   SVQDRGANVSTTGIDFNQEPSVQVSSSQFNEGTTTFTTPELPIPKDMSNKNKKRGFLRE
FT                   MAGLRGKKTVFHADTDGASASLPDTTTEVDQSPSSAFSLGGSRNHLQSQQNLSQRDWTL
FT                   DGIFCGDAVDGDGHRHLSFSTSTPLRPLRNIPPSELTSLPDNIFITRTEFGDSWYGKSN
FT                   LGRSSNGHRNNEESPANQQWGVAEEEEEFAGEHGPESEAHDDGTETMAMDKVFWESTEK
FT                   KYDDLKFLDEDNLSQLRFGSILARKELVLDLHTHSPQLQLNLVKVISVTTEGILIEKVD
FT                   SPKEEKEEETEEHVSSQEECGFIKLDRDEIKAGSWKIVF"
FT   gene            1291181..1293685
FT                   /locus_tag="CND04690"
FT   mRNA            join(1291181..1291438,1291541..1291653,1291745..1291861,
FT                   1291927..1292115,1292175..1292227,1292283..1292480,
FT                   1292532..1292661,1292723..1292865,1292921..1293065,
FT                   1293120..1293685)
FT                   /locus_tag="CND04690"
FT                   /product="transporter, putative"
FT   CDS_pept        join(1291251..1291438,1291541..1291653,1291745..1291861,
FT                   1291927..1292115,1292175..1292227,1292283..1292480,
FT                   1292532..1292661,1292723..1292865,1292921..1293065,
FT                   1293120..1293415)
FT                   /codon_start=1
FT                   /locus_tag="CND04690"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42786"
FT                   /db_xref="GOA:Q5KI02"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI02"
FT                   /protein_id="AAW42786.1"
FT                   /translation="MSAEKLEAANALSNASDSKTPSTIPDHRQVLAEEIAAMSPEEYEA
FT                   ADKKLLAKLDRNLVPWMTLLFTMSFLDRINIGTAKLAGLTTDLNLTSLQYNTASMIFFV
FT                   SYVALEVPSNLVLKKFRPSRWIPLIMIVWSLFQIFMGFVTNYGQLLAMRFCLGMAESGL
FT                   FPGISFFLSGWYRRKEASKRISLFFAGAVLAGAFGGIFGYALSRMDGAGGKAGWSWIFI
FT                   IEGLLSFVVGIASIWMVHDWPDKARFLTPLEREMVFLRLKDDTGILSEGRFSWKVVRRA
FT                   LCDWKTPCFMLMYIGCAEPIYSQSLFSPTIIASLGSWTTAQSLLLSTPPYVLAFITTMV
FT                   TAFFSDRWGKRGFFLMFWSAMAAIGYLLFITIPVRFPGARYFAVFLTTCSIAPCIATTI
FT                   VWSGNTFGQHYKKATSMGFIFSLGNSGGIIASEVYRTQDSPRYIPGQSVTFGFSCVCFI
FT                   ASIIMYFGLRRENRRREKLYGPPPGPGQLSEWDSEEGKKRWGLEGMTKEEIADLGDDHP
FT                   AHRFIL"
FT   gene            1294020..1295611
FT                   /locus_tag="CND04700"
FT   mRNA            join(1294020..1294116,1294185..1294235,1294299..1294309,
FT                   1294362..1294418,1294479..1294499,1294564..1294662,
FT                   1294722..1295292,1295343..1295611)
FT                   /locus_tag="CND04700"
FT                   /product="thiol-disulfide exchange intermediate, putative"
FT   CDS_pept        join(1294080..1294116,1294185..1294235,1294299..1294309,
FT                   1294362..1294418,1294479..1294499,1294564..1294662,
FT                   1294722..1295292,1295343..1295431)
FT                   /codon_start=1
FT                   /locus_tag="CND04700"
FT                   /product="thiol-disulfide exchange intermediate, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43298"
FT                   /db_xref="GOA:Q5KI01"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI01"
FT                   /protein_id="AAW43298.2"
FT                   /translation="MAGGIQNITSAAEFDGIVRSLPPSRLLVADFYAQWCGPCHAIAPV
FT                   LEQLAGAYKHVTFVKIDVDQQRELASRFRITAMPTFKLLKGGREVDQLRGASPPQLSQL
FT                   VSRHAGTAPPPTATASSGSKSQVATGEITESLLKQVISKGLNCLNEAKEHPLSSILGPE
FT                   KGPRGNSYLESDVDPELLISIPFQDAVKLKAISIFSGISPSQAPKTVKLFINQPNIGFD
FT                   DAENEAPAQELILTPEQVKGDRIPLRYVRFQNVRSLHILVKDNQEDEETTRIDSIDVYG
FT                   AQGEKLDAGVTSQSSAGTGSMLEKLLASGK"
FT   gene            complement(1295591..1300414)
FT                   /locus_tag="CND04710"
FT   mRNA            complement(join(1295591..1297270,1297327..1298411,
FT                   1298467..1299443,1299497..1300414))
FT                   /locus_tag="CND04710"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1295638..1297270,1297327..1298411,
FT                   1298467..1299111))
FT                   /codon_start=1
FT                   /locus_tag="CND04710"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42784"
FT                   /db_xref="GOA:Q5KI00"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KI00"
FT                   /protein_id="AAW42784.2"
FT                   /translation="MQVGPKTSDATTYTGTLTSTPGSAICSPDGSMLAAYSPDPFRPMP
FT                   RGFESLTSYPISTSQLAESRISLAPSKVTTPMDAIGNVPIEMASAKQSSTWRTQNYQSF
FT                   NQPAASGTTLANSLDFKTPARSRISVTDHRAPPPPPIPSNMPLPPTPTFARSSTLWEMS
FT                   SSMHGKESMEMLLGGEEEVWVPVDEQVAGAERWGVSGRGVGIVAVVGNVACFTLGLPFL
FT                   LHHGRFTHIARVLYLVSLLLPSLFLLLTSYILRYRLSKSVYHRAIKGSTKSASTGVTGH
FT                   KSLALISESQLSLPVSISPKLTPPQAKLGSVSEIHNTKLNISRLAHRRPSLTTYVAADK
FT                   DGSLSHPGRITFADRSPKRRHTVYGNFTMRDLEAEEAMRKSLSRKSCDVWIQNGHAIEG
FT                   GGFMSRAAEMFKPVPAMRVLVNQPLDARKRDTVKIFRGGVVSMIAKRTSGFFEGRRHSI
FT                   LTHAEATGKTRGQYEEASTINGASSPCSPANSFRSLSATNFDTDRPISHTSGHQSVNST
FT                   GEGSTLPAVQIYRATRGRMSNGPTLIFGKRMSNQRLNKAASVGEGAGLELDRLTDNVTP
FT                   NLRPSVDIRSDASEEPSQCSPHTSQPDEQGNDIIEQKRPLSKQFGYSVDAENSYPRAPS
FT                   FDNLSFKDQSTPHQSRRPSNKHHICNQNSSVDFSRSPEYYAAESSSKLLKGESAESKHS
FT                   LVHKSSFGLPRLKEEDFTADVRKSFEELSRPILLYDVQSAGIDLPPIPSSLTIAHLNLS
FT                   PITENKEDSFSETSMILSRSCVEDMHLALQLAASSSNQNIAQEITEHVGTLQDSKGSSL
FT                   ASPMGTEVEDAVEEMERMMAMDTPTREDFVVSPSLSTSTAPNGRLRSASDISVSTSASS
FT                   AIADTKSVNCYLGGLTKDGPPIPTIPAAYRQPSDLPTVVSHPHPPPLARTPSSTTFGLR
FT                   EQTDLRHFCISEPHPPVQRLLPKQSSDSTYSASSRIESELNDREQTLPLKIREYQPSKM
FT                   EMKIAKQLDERNRWRSIDANNRERRAVVEKPAIRSTVQHSKGSTLESTVRSSPLKPLQV
FT                   IAEKQANRTSLTNPKPTSKAVKGFSVLLQDEQGGSKVSLGGRSEKQKGKENAKGSKASS
FT                   SSSATVCMKGLRA"
FT   gene            complement(1300421..1301707)
FT                   /locus_tag="CND04730"
FT   mRNA            complement(join(1300421..1300873,1300942..1301103,
FT                   1301156..1301707))
FT                   /locus_tag="CND04730"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1300552..1300873,1300942..1301103,
FT                   1301156..1301646))
FT                   /codon_start=1
FT                   /locus_tag="CND04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42780"
FT                   /db_xref="GOA:Q5KHZ8"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ8"
FT                   /protein_id="AAW42780.2"
FT                   /translation="MPTAYPFRQTEPYHDGPIEVLPGVWLGAEESVGRWDIWAGNTAGN
FT                   TVRVVNVAQEVEDPFDAAGPGRVSGWPRPSALPAETAKRRMKLRTYPAVVGDGTRPHVE
FT                   YCHARWSHGELGLADLPADACLGDVLYPRAPENNEGLWRFWETIRWMEEGRQGGTPILI
FT                   HCQCGVSRSATLAIAYTMALAAAGAMPQYLGHIRVMQDAYDFVKGKSCWIGPNHSLVFQ
FT                   LVDFARNLTTLLSSHYATTPDAPIQTSFPTAAESELSEAEWARRRREFDEDEMGGCTTD
FT                   PSTGASDGETTGEGCMSAEEAGEEARRLDAAMLARRAATKEEV"
FT   gene            1301812..1303264
FT                   /locus_tag="CND04740"
FT   mRNA            join(1301812..1302938,1303086..1303264)
FT                   /locus_tag="CND04740"
FT                   /product="hypothetical protein"
FT   CDS_pept        1302203..1302658
FT                   /codon_start=1
FT                   /locus_tag="CND04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW42778"
FT                   /db_xref="GOA:Q5KHZ7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ7"
FT                   /protein_id="AAW42778.2"
FT                   /translation="MPPDLFRDPLKPSNGLTLTPFHILALALCAVSLILTNLLGPNPLS
FT                   GPLTRLSILLVLLLLSHHFILYMLSYHSASLAKAHEEEKARMDPLVKSKIEQKKSDWEY
FT                   PDAHPSKFLTTREGKPRLFPFPLGLAGRGASKELWWEAGNSSHMQVF"
FT   gene            complement(1303302..1304619)
FT                   /locus_tag="CND04750"
FT   mRNA            complement(join(1303302..1303484,1303545..1303676,
FT                   1303903..1303953,1304007..1304160,1304209..1304324,
FT                   1304443..1304619))
FT                   /locus_tag="CND04750"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1303431..1303484,1303545..1303676,
FT                   1303903..1303953,1304007..1304160,1304209..1304324,
FT                   1304443..1304454))
FT                   /codon_start=1
FT                   /locus_tag="CND04750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43188"
FT                   /db_xref="GOA:Q5KHZ6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ6"
FT                   /protein_id="AAW43188.1"
FT                   /translation="MFFLRELTHTILLHPSYFGAQLEDYLRQKLYEDVEGTCSGKHGYI
FT                   ISVITITDIGEGKIIPSTGQAKFKTRYTAIVMKPFKGEVVDAKVVNVNKMGFFAMVGPL
FT                   QVFVSCHLTHSDMKFDPSVSPPCYRSNDEIIQKDTKVRIQIVGCRVEANDMFAIGTIKK
FT                   DYLGQIRDE"
FT   gene            1304852..1309562
FT                   /locus_tag="CND04760"
FT   mRNA            join(1304852..1304973,1305024..1305149,1305219..1306374,
FT                   1306428..1307331,1307384..1307556,1307610..1308008,
FT                   1308060..1308249,1308307..1308869,1308952..1309122,
FT                   1309176..1309562)
FT                   /locus_tag="CND04760"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1304858..1304973,1305024..1305149,1305219..1306374,
FT                   1306428..1307331,1307384..1307556,1307610..1308008,
FT                   1308060..1308249,1308307..1308869,1308952..1309122,
FT                   1309176..1309184)
FT                   /codon_start=1
FT                   /locus_tag="CND04760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43104"
FT                   /db_xref="GOA:Q5KHZ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ5"
FT                   /protein_id="AAW43104.2"
FT                   /translation="MAQPPPTAPRSSLSPEKAPLRQREGRTPPPAPSAAYARRAREIID
FT                   DEMGVPTYKPVMDAEDDAAASASNSVATGYRRARAGTMPSNLQEAASRLTPEVDDVDQP
FT                   TSATTVTSETPTNPAYARTSALSPAYPQTASRPALRHTASSAANLETPAAHAPNRLRSG
FT                   SLTLPGAGLGDAFGHGPFSNAWLSNPGLTTAATTPARSPLGRRIQPAEEDFSFYTSASE
FT                   SAASLGTDDLNFSTLDYLGLADVSDHLPPASMSELRSQTQRAIASSGPASRLRASTVSN
FT                   FARPFRPSVTSMHSFTQETNPYDNGQSEEEMLARAIENLGVYDTSSYMSNPQLANLYPP
FT                   TNLFKDTHRQRASTIGALENPHRRGLNRSASYLASIPQSPMQAELAALGAYGYAARSRD
FT                   SSRAGRLSISSHTSRTGTPEDKGSSTPQVPTRSLWIGNLDVNATSNALFQVFAPYGAIE
FT                   SVRMLPEKTCAFVNFMDKVDAIRARDDVLNRLGGHVSALSETAPVRIGFGKIDSAPNGP
FT                   TVSAVAPAPPGLVFTSGPPLSATPIVSMSSALTSIPGPGASVTVPPQTATNMISSPDQN
FT                   DQTSALPTRALWIGSIPSTTSASTLLQIFTPFGPVESSRVLQNKCCGFVNFERLDSAVS
FT                   ARNALNGRDILGSDVGPIRIGFARVPTRSPTISTAHLGLPASPSDSPTKLGDALNSVLG
FT                   ATSVSTEQQMSVEGGGLENYRSPLVLDLVKQGVHEQVLEKGLAGENGNVSDQQMIMQVL
FT                   SSQPDEDSDIKAAADARPPATYYTSIPPPADRSMRRFDTGKLKEVRKKLDSGQCRQDEI
FT                   DEITKDLMEDCAELSSDFIGNTIIQKLFERTSHALRIAMLERIAPHLATIGVHKNGTWA
FT                   AQKIIECSSTDEERAIVVNNLRPFAPPLMCDSLGNYVCAGTLRFGEPFNHYVFDAMIDR
FT                   MWDIAQNRFGARCMRTCLESPYTSLYQKKRISTSIILNSIPLATNPNGALLLTWLVDSS
FT                   NLPGRYNLLANRFIPHIAHLCTHKLASLTVLRIITQTTEPQASTNLVQAIFTSTNDQTL
FT                   VEILSDANNGNQVIGKIIAVNTIAEDQKKQMVEAVRRVLPNIKASTTPPYRMLLEAVGL
FT                   PVPAGYASASPFGRNPTPQWQPNRQQQFGQTYYPYQPVNGASYQAVNGLGNLSPLLIPQ
FT                   TMPLGQMRGNPQPGKSPRTPAARQGRLSSPGSMMSPASDPFNPFASPSIDLQYPSQGSM
FT                   RMGSTLSQPPVTFDQQPAVGGLGMGGQGQGNGMMYYGQQSSGW"
FT   gene            complement(1310014..1313100)
FT                   /locus_tag="CND04770"
FT   mRNA            complement(join(1310014..1310781,1310857..1310943,
FT                   1311001..1311377,1311438..1311656,1311709..1311872,
FT                   1311924..1312110,1312159..1312267,1312326..1312453,
FT                   1312510..1312691,1312832..1312879,1312953..1313100))
FT                   /locus_tag="CND04770"
FT                   /product="Importin alpha subunit, putative"
FT   CDS_pept        complement(join(1310741..1310781,1310857..1310943,
FT                   1311001..1311377,1311438..1311656,1311709..1311872,
FT                   1311924..1312110,1312159..1312267,1312326..1312453,
FT                   1312510..1312691,1312832..1312879,1312953..1313021))
FT                   /codon_start=1
FT                   /locus_tag="CND04770"
FT                   /product="Importin alpha subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43186"
FT                   /db_xref="GOA:Q5KHZ4"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="InterPro:IPR036975"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ4"
FT                   /protein_id="AAW43186.1"
FT                   /translation="MESRNLDHRRNNFKGKTQFSAQELRRRREEQQVEIRRQKREENLA
FT                   KRRNLQSVITDEGIESDDEASMDSTALGDVLPGMLQAVYSEDANAQLDATMKFRKLLSK
FT                   EKNPPIDKVIQCGVVPRFVEFLSSTNSMLQFEAAWALTNIASGTSEHTQVVIGAGAVPH
FT                   FIALLSSSVLDVREQAVWALGNIAGDSPKCRDYVLGEGALQPLLGLLNENHKLSMIRNA
FT                   TWTLSNFCRGKNPQPEWELISPALTVLTKLIYSLDDEVLIDACWAISYLSDGSNDKIQA
FT                   VIESGVCRRLVDLLMHPSTAVQTPALRSVGNIVTGDDLQTQVVISSGALPALLSLLSSP
FT                   KEGIRKEACWTISNITAGSPMQIQAIIDANIVPPLINILANADFKTKKEACWAISNATS
FT                   GGLQEPNQIRYLVSQGCIKPMCDLLTSMDNKIIQVALDGLENILKVGEVDKDAAGPGGV
FT                   NKYAQYIEEAGGMVAIHNLQHHENLEIYKKCFYIMDKFFPDEEEEEADAAAPAVDASGQ
FT                   YAFQSDVAAPQGGFNFGGQ"
FT   gene            1313278..1316588
FT                   /locus_tag="CND04780"
FT   mRNA            join(1313278..1313880,1313934..1314009,1314062..1315309,
FT                   1315377..1315588,1315660..1316060,1316129..1316588)
FT                   /locus_tag="CND04780"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1313296..1313880,1313934..1314009,1314062..1315309,
FT                   1315377..1315588,1315660..1316060,1316129..1316285)
FT                   /codon_start=1
FT                   /locus_tag="CND04780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CND04780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW43106"
FT                   /db_xref="GOA:Q5KHZ3"
FT                   /db_xref="InterPro:IPR006767"
FT                   /db_xref="InterPro:IPR006768"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR040194"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KHZ3"
FT                   /protein_id="AAW43106.1"
FT                   /translation="MGRDSTNTDRDTHRHGSRHDRHDRPHRHRTHRDRDKQDADQIEEE
FT                   QRRERKRLKKERRTDDDHTLQVLDDDPSMWVEKSLDPTNAVANIPTADSLPLTSNPSGP
FT                   KVSLPLSTATGSEGRQRDSWMLEPSVSSAIVPTPRDDVPHSAVKSAADTADRYGDGQPD
FT                   DRTSVSNVDLFSSMGIEHKRKDPRSDKPDPSQLVVDDRFELNTQLLEGKNVDEYEVKEK
FT                   KTTFGGPGYQWRMMKLKRLYEQAEEQSRPVEEVALERYGSLDEFNEALEERRYLDDREA
FT                   RRKSRGVSRPVGPSSDSSRPTTPSGNSSGMRTPDAGRRFMFANRTTGEQTFGTGGGSGN
FT                   RPGSRTGFRRPGEDLEQGTTPVSSAGRLDTLRRDNGGLGTPKLESGVRSGSSGVVPMKV
FT                   GTPIPSVFTPTTLTRSFTGPSPPGPEHESGAVDPTSSKPPLSTEQLNKLQAAVLRSKLM
FT                   DDPNASALEDEYEIERERSERAHAGVGAGAGLWEGNNEGIQGQLGRMDEKGNRIEVQVL
FT                   PTLDGRGKLYDVGTGKEDESVVRPGNRKQKDAKFETRDKQGNLLRYNADDDIQSLGELV
FT                   RQERFGAGSSDQKNLDAEMARAIATDGKFEDDLDYMDDNADKLARKKMKSDALKRAFAI
FT                   NDYARTKKALDTCPLCYQDDRPPQTAIVALGTRTYMCCTQYEELVPGHCLIVPLQHHLS
FT                   MLEMEDDDWDEVRNFMKCLMRMHAQSNHGVIFFETITSFKSQRHSYIEAIPVPFDIFQD
FT                   LPAYFRESILSSEGEWTQHKKLIDFSSRPGGFRRMMVPNLPYFMVQWDYKGEKGYGHVI
FT                   EGIKDSGAGGGEDEEGDVGGAMSESEFPRYFAQEVIGNILGLEARKWRRPRKMDVALNK
FT                   ERARKLGTLFQPYNWTVGNGV"
FT   gene            1316811..1318837
FT                   /locus_tag="CND04790"
FT   mRNA            join(1316811..1317013,1317078..1317337,1317389..1317776,
FT                   1317827..1317909,1317957..1318364,1318417..1318837)
FT                   /locus_tag="CND04790"
FT                   /product="aerobic respiration-related protein, putative"
FT   CDS_pept        join(1316906..1317013,1317078..1317337,1317389..1317776,
FT                   1317827..1317909,1317957..1318335)
FT                   /codon_start=1
FT                   /locus_tag="CND04790"
FT                   /product="aerobic respiration-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CND04790"
FT