(data stored in ACNUC22857 zone)

EMBL: AE017348

ID   AE017348; SV 1; linear; genomic DNA; STD; FUN; 1194300 BP.
XX
AC   AE017348;
XX
PR   Project:PRJNA13856;
XX
DT   10-JAN-2005 (Rel. 82, Created)
DT   29-NOV-2015 (Rel. 127, Last updated, Version 15)
XX
DE   Cryptococcus neoformans var. neoformans JEC21 chromosome 8 sequence.
XX
KW   .
XX
OS   Cryptococcus neoformans var. neoformans JEC21
OC   Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina; Tremellomycetes;
OC   Tremellales; Cryptococcaceae; Cryptococcus;
OC   Cryptococcus neoformans species complex.
XX
RN   [1]
RP   1-1194300
RX   DOI; 10.1126/science.1103773.
RX   PUBMED; 15653466.
RA   Loftus B.J., Fung E., Roncaglia P., Rowley D., Amedeo P., Bruno D.,
RA   Vamathevan J., Miranda M., Anderson I.J., Fraser J.A., Allen J.E.,
RA   Bosdet I.E., Brent M.R., Chiu R., Doering T.L., Donlin M.J., D'Souza C.A.,
RA   Fox D.S., Grinberg V., Fu J., Fukushima M., Haas B.J., Huang J.C.,
RA   Janbon G., Jones S.J., Koo H.L., Krzywinski M.I., Kwon-Chung J.K.,
RA   Lengeler K.B., Maiti R., Marra M.A., Marra R.E., Mathewson C.A.,
RA   Mitchell T.G., Pertea M., Riggs F.R., Salzberg S.L., Schein J.E.,
RA   Shvartsbeyn A., Shin H., Shumway M., Specht C.A., Suh B.B., Tenney A.,
RA   Utterback T.R., Wickes B.L., Wortman J.R., Wye N.H., Kronstad J.W.,
RA   Lodge J.K., Heitman J., Davis R.W., Fraser C.M., Hyman R.W.;
RT   "The genome of the basidiomycetous yeast and human pathogen Cryptococcus
RT   neoformans";
RL   Science, e1252229 307(5713):1321-1324(2005).
XX
RN   [2]
RP   1-1194300
RA   Loftus B., Amedeo P., Roncaglia P., Vamathevan J., Utterback T.,
RA   Van Aken S., Fraser C.;
RT   ;
RL   Submitted (20-MAY-2004) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1194300
RA   Janbon G., Paulet D., Chon C.C., Mornico D.;
RT   ;
RL   Submitted (17-NOV-2015) to the INSDC.
RL   Institut Pasteur, 25 rue du Dr Roux, Paris 75015, France
XX
DR   MD5; 821310c59c1c7685b38cc9d7ae8a5a9d.
DR   BioSample; SAMN03081418.
DR   EnsemblGenomes-Gn; CNH00310.
DR   EnsemblGenomes-Gn; CNH00590.
DR   EnsemblGenomes-Gn; CNH00680.
DR   EnsemblGenomes-Gn; CNH03340.
DR   EnsemblGenomes-Gn; CNH03530.
DR   EnsemblGenomes-Gn; EFCNEG00000000018.
DR   EnsemblGenomes-Gn; EFCNEG00000000020.
DR   EnsemblGenomes-Gn; EFCNEG00000000023.
DR   EnsemblGenomes-Gn; EFCNEG00000000032.
DR   EnsemblGenomes-Gn; EFCNEG00000000072.
DR   EnsemblGenomes-Gn; EFCNEG00000000088.
DR   EnsemblGenomes-Gn; EFCNEG00000000100.
DR   EnsemblGenomes-Gn; EFCNEG00000000113.
DR   EnsemblGenomes-Gn; ENSRNA049504410.
DR   EnsemblGenomes-Gn; ENSRNA049504433.
DR   EnsemblGenomes-Gn; ENSRNA049504438.
DR   EnsemblGenomes-Gn; ENSRNA049547999.
DR   EnsemblGenomes-Gn; ENSRNA049548023.
DR   EnsemblGenomes-Gn; ENSRNA049548041.
DR   EnsemblGenomes-Gn; ENSRNA049548065.
DR   EnsemblGenomes-Gn; ENSRNA049548101.
DR   EnsemblGenomes-Tr; CNH00310.
DR   EnsemblGenomes-Tr; CNH00590.
DR   EnsemblGenomes-Tr; CNH00680.
DR   EnsemblGenomes-Tr; CNH03340.
DR   EnsemblGenomes-Tr; CNH03530.
DR   EnsemblGenomes-Tr; EFCNET00000000018.
DR   EnsemblGenomes-Tr; EFCNET00000000020.
DR   EnsemblGenomes-Tr; EFCNET00000000023.
DR   EnsemblGenomes-Tr; EFCNET00000000032.
DR   EnsemblGenomes-Tr; EFCNET00000000072.
DR   EnsemblGenomes-Tr; EFCNET00000000088.
DR   EnsemblGenomes-Tr; EFCNET00000000100.
DR   EnsemblGenomes-Tr; EFCNET00000000113.
DR   EuropePMC; PMC1287864; 16278457.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00026; U6.
DR   RFAM; RF00069; SNORD24.
DR   RFAM; RF00335; snoZ13_snr52.
XX
CC   This record represents the complete annotated sequence of the C.
CC   neoformans JEC21 genome. A small number of gaps exist which are
CC   represented by NNNNs within the final sequence. The genome has been
CC   annotated by TIGR and the annotation data is available for viewing
CC   and download from the TIGR database
CC   (http://www.tigr.org/tdb/e2k1/cna1/).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1194300
FT                   /organism="Cryptococcus neoformans var. neoformans JEC21"
FT                   /chromosome="8"
FT                   /strain="JEC21"
FT                   /variety="neoformans"
FT                   /serotype="D"
FT                   /mol_type="genomic DNA"
FT                   /note="MAT-alpha"
FT                   /db_xref="taxon:214684"
FT   gene            complement(77..2412)
FT                   /locus_tag="CNH03875"
FT   mRNA            complement(join(77..490,538..841,894..1026,1075..2021,
FT                   2075..2412))
FT                   /locus_tag="CNH03875"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(77..490,538..841,894..1026,1075..2021,
FT                   2075..2295))
FT                   /codon_start=1
FT                   /locus_tag="CNH03875"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5S8"
FT                   /db_xref="InterPro:IPR013947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S8"
FT                   /protein_id="ALO69499.1"
FT                   /translation="MASAPIASASEQPLTSTNPQLGPEPYFTYPTPTPDQLEEELPPYF
FT                   ENENVSLGLVLDRFARKGNHDLRVLLGEVLPQLSIRERPKPIIEYAKTTRQALLKYLAV
FT                   LRWKTSVDIASTSTGSSVANTAGPASFPTPHSNNDPNDNSPDAFAGKGKSKTQADESVI
FT                   KGKVTDAKRIAHFMEHQNQQHEVAIEHVKHVTKVVEGLRERNPDLLTALSLLATGTYNR
FT                   LPASLVDPYLPKPVLTNSAILKVLRRLNRQIRYRLRCLDYLPPELIVEDIKDGRMYARG
FT                   DGWRAELTVVGFEDTSRWWLTGVEWGWKAKEKGVDDPGGRVTKKFTGEERQGILDIANG
FT                   EVLPPRELPENEMEVDTVITEDPQVKKSEVVEVVKKTVDAPLVRVYNLLQHLSLSYRLE
FT                   VLFTQAIALSQGKWRGQLIPEMDREDKTLRLKYWLRERPMQVQRQDSTSIKRPQAPATL
FT                   PASRQTMVGGIIHITLAEKTTPRSELDNLLSDIACGGLVPSERVLRLELNVKWVVDEAG
FT                   VGGGLKSGDVMDNSMLHLDPDALSVEDLLHVCTRTHASHLTRSHGTSLLTSPRFLNASS
FT                   VQPSLQESTDPSARPLTLRVPLPSRYAVSHLLIGVSSFSGLLEVEDEGAKGNDARAERA
FT                   AMSMKSVNEGKTKLVDDITRLTTAVSSVNKWFINVKY"
FT   gene            2802..5415
FT                   /locus_tag="CNH03870"
FT   mRNA            join(2802..2935,2984..3518,3572..4178,4227..4418,
FT                   4471..4619,4679..5415)
FT                   /locus_tag="CNH03870"
FT                   /product="xylulokinase, putative"
FT   CDS_pept        join(3243..3518,3572..4178,4227..4418,4471..4619,
FT                   4679..5335)
FT                   /codon_start=1
FT                   /locus_tag="CNH03870"
FT                   /product="xylulokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45238"
FT                   /db_xref="GOA:Q5K902"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K902"
FT                   /protein_id="AAW45238.1"
FT                   /translation="MTSPLFLGLDASTQSLKASLLSVNLDVVAECAIHFDSDLPQFGTK
FT                   GGVHFGSDGQVHSPVMMLVGAMDLLFDKIKIAGWKVDDIRGVAAAGQQHASVYWSKTSP
FT                   KILASLNSSLPLSSQLVEAFSRPIIPNWQDSSTTAECQALDAAVGGPAALAQLTGSRAY
FT                   ERFTGAQIMRFKRVDPVAYDQTDRIGLVSNSVTTLLCLDGEVKGIDESDACGMNLWTMN
FT                   RKQRGWNQELLKAIAGDDGAAELSRKLGTVETDGGRVVGRIGKWFVDRYGFSSECCVFP
FT                   GTGDNPATFLSLTLRESEGLVSLGTSDVVLISTSAYHPDPDYHAFFHPAQIAPPSEQDD
FT                   QNRQGAEPLRYFNMIVYKNGSLTRQHVRDLYFDGSWDKFNAAIEELRPKSVIDLPSRTA
FT                   FWWLLPDIVPHGAHGIYKYITEPTAGTLFEVPAAKKVDQFPDIRQEALALLESQLFNYR
FT                   SRASVILDDSSTPYDPSSPNVDAFLPRLTKVYATGGASANRTILSLMADVLSTKVCKNV
FT                   EYLDGKWKDADWNACSVGVAYKARWGWERVIAADGDERKWVGFDTVIRECREARKKIRG
FT                   DEGRGLELEEEGIRIVASPGPGSRAYERRIEWWRELERKALAEQRAEKTA"
FT   gene            complement(5971..8335)
FT                   /locus_tag="CNH03860"
FT   mRNA            complement(join(5971..6973,7029..7886,7931..8335))
FT                   /locus_tag="CNH03860"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(6069..6973,7029..7886,7931..8240))
FT                   /codon_start=1
FT                   /locus_tag="CNH03860"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K903"
FT                   /protein_id="AAW45237.2"
FT                   /translation="MPTRLSQRSALAPTRILEPKRHSSDQSFGGIKLQIRQRVPQLSIS
FT                   KDKFRNESLRTKTLDQQEKEDGEFYYQQEDAGMPSEAYVCEKNIAKKPSRPFVSKGSHQ
FT                   LKVIASLPSISTSPSAFSFPEQPLRESISKSIDLWFDDFKTDSFISTSTIDNPPPTPPP
FT                   KITIESDEQPTPKATQVAFNIATAVREAPSINSFTANGSFLGLPEEADMLYRSNIVWGD
FT                   LDHSEDQQTSHKKLAAAQHLSPASAGSQKHIKAADLRFEDAESEASRARNEGSCDLNDN
FT                   TEKSEPLDKPLPHLPDDSGPSEYSMTTYSQSSAIISKTAESPEVLHSLNSQPLPQWKSS
FT                   TPRRLRHHTVSTKSYEHCDEPEQGEEEQGAAVRNQTRHSSSGWEPPRQDAQVKPESTRA
FT                   RHGKAGSVSSTATAKTIGQSHYPAGSTLTRNHIRAVAPQETSRLVIDHSIAPAKPIMDT
FT                   VTNRINSAKGSKSTRGSFELNDHAVVRASTAENQTIHSLVEDDDVEIIGDFTFASSRRP
FT                   SVSSSVKTMGTVSFASATAARAPRISLRSPHDRNTSSQDSPAQHPVRARSQSEDPVPRC
FT                   IFGISAIFSQSKPGPNRKGHRSILDPFSSFDPHVPIVPCKTVPNDNWILITNTAEDDIL
FT                   RPGWKDVEMRWVEGESFGGWMMRRIRGECWNTVVAREKRADEQLRMMELRDGKGG"
FT   gene            complement(10492..11349)
FT                   /locus_tag="CNH03850"
FT   mRNA            complement(join(10492..10623,10675..10759,10812..10858,
FT                   10914..10960,11011..11088,11150..11237,11286..11349))
FT                   /locus_tag="CNH03850"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(10552..10623,10675..10759,10812..10858,
FT                   10914..10960,11011..11088,11150..11237,11286..11288))
FT                   /codon_start=1
FT                   /locus_tag="CNH03850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45273"
FT                   /db_xref="GOA:Q5K904"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="InterPro:IPR011171"
FT                   /db_xref="InterPro:IPR029006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K904"
FT                   /protein_id="AAW45273.1"
FT                   /translation="MSRTVDIPQDVLDALKQFRFKNSKGTTAISVKIIKNSLTMAVDEE
FT                   FEGQSIEEIAEELPENAPRYVLLSHELKHKDGRISYPLLLINWAPTTSPIELMTLHASS
FT                   LSYFQQVSETAKVLEARDGAEGLTTEAVDEKLLSH"
FT   gene            11490..13101
FT                   /locus_tag="CNH03840"
FT   mRNA            join(11490..11792,11872..12032,12084..12181,12232..12326,
FT                   12381..12570,12623..13101)
FT                   /locus_tag="CNH03840"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase,
FT                   putative"
FT   CDS_pept        join(11604..11792,11872..12032,12084..12181,12232..12326,
FT                   12381..12570,12623..12999)
FT                   /codon_start=1
FT                   /locus_tag="CNH03840"
FT                   /product="1-acylglycerol-3-phosphate O-acyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45236"
FT                   /db_xref="GOA:Q5K905"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K905"
FT                   /protein_id="AAW45236.1"
FT                   /translation="MGISWLLKPVALVSTVALSTLGVLSRRYQRARFYFNLTIYVSTLG
FT                   LMSVWGVVVSILATAAGQRLNINYYVARSLYGLSGPLLGIKFEVEGEEHLEGLMTARDG
FT                   QHQGAVLLSNHQSFLDILYIGRIFPKQAAIMAKKELKWTPLLGQFMSLSGAVFVNRKNR
FT                   HDAVKALAIAGEDMKKKGVSLWIFPEGTRSSSPEPTLLPFKKGAFHLAVQAQIPIVPIV
FT                   CENYHRLFDGRTRFESGVLKIRVLPPIPTTGLTVDDVTSLAESTRESMLHALREISEPG
FT                   PSSSTPIPTSAEVPLAPPISRNTTQPPAGDSIQLDISESGALRQRGVHSSGVSSEWSEG
FT                   KFEAQSEETTEDEMDEDVVLLKKPKENVA"
FT   gene            13287..16763
FT                   /locus_tag="CNH03830"
FT   mRNA            join(13287..13443,13499..13635,13710..13814,13868..14113,
FT                   14162..14561,14629..15008,15058..15249,15302..15478,
FT                   15533..15711,15767..16763)
FT                   /locus_tag="CNH03830"
FT                   /product="clathrin binding protein, putative"
FT   CDS_pept        join(13419..13443,13499..13635,13710..13814,13868..14113,
FT                   14162..14561,14629..15008,15058..15249,15302..15478,
FT                   15533..15711,15767..16193)
FT                   /codon_start=1
FT                   /locus_tag="CNH03830"
FT                   /product="clathrin binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45234"
FT                   /db_xref="GOA:Q5KDA3"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KDA3"
FT                   /protein_id="AAW45234.1"
FT                   /translation="MAMAPPRKGENWELRQQLNSEYRDKRADAIKRVIANHTIGKDCSG
FT                   LFPDVVKNMQTDDLEQKKLVYLYLMNYAKTQPELVILAVNTFVKDTADPNPLVRALAIR
FT                   TMSILRAEKILDYLASPLSRCLKDENPYVRKTAALCVAKVFDLKPELAIEYGFIETLRD
FT                   LIGDGNPMVVANAVAALGDIHEASLNLPSSQPGSPNDDESPSSVRPNQSLFIIDPATLT
FT                   KLLVALNECSEWGRIAILTTLARYRTNDEKESEHICERVMPQFQHVNAAVVLGAVKVIM
FT                   IHMKNVTKEDLLKSLTRKMAPPLVTLISSPPEVQWVALRNINLLLQKRPDILASEMRVF
FT                   FCKYNDPSYVKVEKLEIMVRLANEKNVDTLLGELKEYASEVDVDFVRKAVRAVGQVAIK
FT                   IDEAAGRCVEVLMELIETRVSYVVQEAVIVVKDIFRKYPHSYEGIIPALCANLEELDEX
FT                   EAKASLIWLIGEYAEKIENADELLGAFLETFSEESYPVQLQTLTAIVKLFLKKPDESQA
FT                   IVQKVLQAATKDCDSPDVRDRAYIYWRLLSSDPAAAKSVVLSVRPPISLPQTTVAPAIL
FT                   EELIGEISTLASVYHKPAATFIGKGRLGADEMHKKSLDAEDDVSREKALQAVVAGNQAE
FT                   NLLDFDDEPTPTNGESSIPAPGAGLGISSQAIASAAKSTNPLDELMDLFSTASMTTPVV
FT                   QPGQPAAQAQTSAQSSGGLGGLNGLAGLSSPPQSVSPQPGAPQSQKQQQQAAAQDDLLG
FT                   LF"
FT   gene            17286..19100
FT                   /locus_tag="CNH03820"
FT   mRNA            join(17286..17641,17713..17750,17803..17846,17912..17923,
FT                   17977..18040,18093..18117,18175..18288,18353..18383,
FT                   18442..18473,18527..18646,18721..19100)
FT                   /locus_tag="CNH03820"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(17389..17641,17713..17750,17803..17846,17912..17923,
FT                   17977..18040,18093..18117,18175..18288,18353..18383,
FT                   18442..18473,18527..18646,18721..19004)
FT                   /codon_start=1
FT                   /locus_tag="CNH03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45279"
FT                   /db_xref="GOA:Q5K908"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K908"
FT                   /protein_id="AAW45279.2"
FT                   /translation="MRNKEILTSNSLVVTYVDNATAFKDGLAFWTSDGIPGIQVDHWSD
FT                   TAVGANRNSVRITTKSLFEGGLFIIDLALMPWGCGVWPAFWTLGYEGTWPETGEIDIIE
FT                   GIQSNTNNQMTIHTMPGCSINYSTSNLYSGTLTNQDCDSSTGGSGCSIISASNSSYGMP
FT                   FNSAGGGVFAMKWDTDGIRMWNWNRAQIPSDITAETPDPDAWDLPTAIWDASICDLESF
FT                   FKAQVLVLNINLCGDWINSVWDQYPYCPGTCPEYVSNPLNLNNTVMLINYIKVYQQSDA
FT                   EVTTQQAETNSNLTGAGGPVGVINGATIRRPWWRTAREKMLGMVSVVPVGLLFAGWI"
FT   gene            19466..20861
FT                   /locus_tag="CNH03810"
FT   mRNA            join(19466..19644,19699..19739,19808..20287,20341..20571,
FT                   20623..20861)
FT                   /locus_tag="CNH03810"
FT                   /product="FMN adenylyltransferase, putative"
FT   CDS_pept        join(19526..19644,19699..19739,19808..20287,20341..20571,
FT                   20623..20660)
FT                   /codon_start=1
FT                   /locus_tag="CNH03810"
FT                   /product="FMN adenylyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45274"
FT                   /db_xref="GOA:Q5K909"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K909"
FT                   /protein_id="AAW45274.2"
FT                   /translation="MANISQSLHALLERAQKQDSLGKLIIEALVLIESVIDILGEETVA
FT                   ISFNGGKDCTVLLHLYAAVLYARHTPSLPPHLFPKPSPKITIPPLPSRTPQEPLSPQPV
FT                   LPPSLPACTPPSITPPASNPSPPFSHPRSTHHHPPTDLPYPPIRSIYITAPNPFAELDE
FT                   FVLSSTKLYGLDLYRFGGGMKAALEEWLGCGGGRGVKGVLVGTRQGDPNDAVDIIAPTD
FT                   PSWPQFIRVHPILHWTYSDVWDFLLELQVPYCILYDQGYTSLGSTTNTLPNPLLKSESV
FT                   EGGWEPAHRLKDASQERAGRH"
FT   gene            complement(20857..24566)
FT                   /locus_tag="CNH03800"
FT   mRNA            complement(join(20857..22293,22342..22437,22493..22563,
FT                   22616..23490,23536..23689,23739..23824,23887..23928,
FT                   23989..24010,24069..24210,24388..24566))
FT                   /locus_tag="CNH03800"
FT                   /product="telomere maintenance protein, putative"
FT   mRNA            complement(join(20857..22293,22342..22437,22493..22563,
FT                   22616..23490,23536..23689,23739..23824,23887..24010,
FT                   24069..24210,24388..24566))
FT                   /locus_tag="CNH03800"
FT                   /product="telomere maintenance protein, putative"
FT   CDS_pept        complement(join(21165..22293,22342..22437,22493..22563,
FT                   22616..23490,23536..23689,23739..23824,23887..23928,
FT                   23989..24010,24069..24210,24388..24566))
FT                   /codon_start=1
FT                   /locus_tag="CNH03800"
FT                   /product="telomere maintenance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45233"
FT                   /db_xref="GOA:Q5KD99"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD99"
FT                   /protein_id="AAW45233.1"
FT                   /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSNR
FT                   CTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGKGH
FT                   SPVVTMTDMSANAPPPPPSDFNSDINRSVTPLMTNLLPSAVGSDGRVNLFVGNLPYRVR
FT                   WQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLMGSREDAARAIDRYNGYTWQTRTLE
FT                   VRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFPGPSHTPFSIPGHITPQSGQGWLPGQ
FT                   IPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSSTPIPGAQSPPSVFGAQPLPLSVQNTGL
FT                   NAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRRDSLTPFGASLTTFDSAAAPLSSTSPNM
FT                   AVSRPTSSSGSVKPPSPGGSRAPPPGTLGPLPPSLFAGIKPAPAVDAIAPTIAGDVPAQ
FT                   SPNGGAGRLAAAPIPQLEGLANQGMGLGPPSTLHDRVIFVSNLPLSMQWQDLKDMLRPA
FT                   GTIIRADVATDAHGKPRGFGTALFATEADATRAVLLFNDREIGGFRIRAHLERDIHPEV
FT                   SQRSARNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGITPIDTSVPSTKPSSTSPIAKL
FT                   PWSLNTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHPGPISMPPFHMEHGNPISPLH
FT                   TRGLPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPFSPGIPVTSPGAFQYNPFLNP
FT                   APGAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGYGQYAGPPGGALQGKSENSPQ
FT                   ARQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRSSPLSGGDGQNDSDEETRAPS
FT                   AVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLGSSAAVSPRGGRASMDDGKLGR
FT                   H"
FT   CDS_pept        complement(join(21165..22293,22342..22437,22493..22563,
FT                   22616..23490,23536..23689,23739..23824,23887..24010,
FT                   24069..24210,24388..24566))
FT                   /codon_start=1
FT                   /locus_tag="CNH03800"
FT                   /product="telomere maintenance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45232"
FT                   /db_xref="GOA:Q5KD98"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD98"
FT                   /protein_id="AAW45232.1"
FT                   /translation="MTCLQYMGVVFERHWRDPIISVTQSHGCESSYRPTVSYSILPSNR
FT                   CTPSPPLSTPQSSQPSQNIHSASAASSHMSSLFEAAAAFEEAAAHGANPVILERSGKGH
FT                   SPVVTMTDMSGASSRAPTSAEIDAVIAAAIANAPPPPPSDFNSDINRSVTPLMTNLLPS
FT                   AVGSDGRVNLFVGNLPYRVRWQDLKDLFRKAGTVLRADVSLGPDNRSRGYGTVLMGSRE
FT                   DAARAIDRYNGYTWQTRTLEVRPDRLPPEYEPQSHPIHHNANPRSAMYSFHNFPGPSHT
FT                   PFSIPGHITPQSGQGWLPGQIPSSRPFSAAGGLIPGGMGVPSSSSAVGLTSSTPIPGAQ
FT                   SPPSVFGAQPLPLSVQNTGLNAFHSLGQSPLAGSLTSGTGAAMPAGVSAVRRDSLTPFG
FT                   ASLTTFDSAAAPLSSTSPNMAVSRPTSSSGSVKPPSPGGSRAPPPGTLGPLPPSLFAGI
FT                   KPAPAVDAIAPTIAGDVPAQSPNGGAGRLAAAPIPQLEGLANQGMGLGPPSTLHDRVIF
FT                   VSNLPLSMQWQDLKDMLRPAGTIIRADVATDAHGKPRGFGTALFATEADATRAVLLFND
FT                   REIGGFRIRAHLERDIHPEVSQRSARNSVSGEATSLGIQDHLTGVPEGVKDMLQSNGIT
FT                   PIDTSVPSTKPSSTSPIAKLPWSLNTSLQTHTAPGHGQPPHGEPSPTSHTPVFRHPHHP
FT                   GPISMPPFHMEHGNPISPLHTRGLPPMTPSMPGFVFNYPETPPLHGHASHFMSPAAGPF
FT                   SPGIPVTSPGAFQYNPFLNPAPGAPVNRFPSTPGNHPQAGSAALGTPTTQAFPNGPIGY
FT                   GQYAGPPGGALQGKSENSPQARQGQDYFANAIPPQHATSTAGNRTLGVGALGGKDKLRS
FT                   SPLSGGDGQNDSDEETRAPSAVGDELAKMAEELTVDDENEDGEPGRQSSSGLSLSGLGS
FT                   SAAVSPRGGRASMDDGKLGRH"
FT   gene            complement(26252..27645)
FT                   /locus_tag="CNH03790"
FT   mRNA            complement(join(26252..26607,26664..27123,27543..27645))
FT                   /locus_tag="CNH03790"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(26477..26607,26664..27123,27543..27557))
FT                   /codon_start=1
FT                   /locus_tag="CNH03790"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45272"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD97"
FT                   /protein_id="AAW45272.2"
FT                   /translation="MTRTERNQYPAAVLKDRHSRTGLDKTQWNHKNGDGAHNWGSTARK
FT                   GDDEASGRLDGEAEAEAALDELPSSDVFDLDEEINDPVGAMPVTDSGNDFKPMDLGKRG
FT                   SIQGQSNIATSPTDSMSSLDSGDRPGMGRRMSAVSDEEREKMRLYREGVLHKKQGVDLA
FT                   HIAXSSHGIAXSPPTNSYLGPXSPSNXRYGFNFVSVQL"
FT   gene            complement(27880..29725)
FT                   /locus_tag="CNH03780"
FT   mRNA            complement(join(27880..28002,28053..28143,28196..28306,
FT                   28365..28644,28704..28858,28916..29001,29131..29259,
FT                   29318..29393,29468..29511,29628..29725))
FT                   /locus_tag="CNH03780"
FT                   /product="chaperone regulator, putative"
FT   CDS_pept        complement(join(27950..28002,28053..28143,28196..28306,
FT                   28365..28644,28704..28858,28916..29001,29131..29259,
FT                   29318..29393,29468..29511,29628..29712))
FT                   /codon_start=1
FT                   /locus_tag="CNH03780"
FT                   /product="chaperone regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45231"
FT                   /db_xref="GOA:Q5K913"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K913"
FT                   /protein_id="AAW45231.1"
FT                   /translation="MLPTTLFFLLTLALLGGCLAESLYNVLGVRKDASDADIKKAYRKL
FT                   SKKYHPDINPDEAAHEKFIQVSKAYEVLSNSETRTIYDRHGEQGLKQHEAQKSGGSQDP
FT                   FARFFGGGAAQEQKGPGLITNVEVSLADLYTGRTLEFQIPRRVICPHCHGSGAESEKDI
FT                   HSCNKCGGQGVVVQRHQVFPGMFTNVQMTCPHCNGKGKQITRSCHVCHSEKTVQTQHTL
FT                   ALHIPAGAPEGFEEVFHGEADEQIDMEAGDVVVRVRSKLNEGEGAWRRKENGILGRVTL
FT                   SVAEALLGFERRLTHLDGRTITLSRTGTTQPGEVEVIEGEGMPSYMDIPPGDMFIEYSV
FT                   VFPTAVSSETRQKLSDILKYAPPVHHDEL"
FT   gene            29948..32622
FT                   /locus_tag="CNH03770"
FT   mRNA            join(29948..30200,30255..30665,30738..30951,31009..32622)
FT                   /locus_tag="CNH03770"
FT                   /product="expressed protein"
FT   CDS_pept        join(29997..30200,30255..30665,30738..30951,31009..32495)
FT                   /codon_start=1
FT                   /locus_tag="CNH03770"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45230"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR036865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K914"
FT                   /protein_id="AAW45230.2"
FT                   /translation="MADKEELQERTKVARQEYREYLPLAQQLQGDLRDDAEQLRVQEGW
FT                   DEDTWNGVEEWVDDVGSIWRALRRNRYDQNKTHSFLLSVLSTRLSLSLHGPIPSILPYS
FT                   DSPLFHILPLPSHTDKLNRPIVVLTAREIVRDEQGMLDDVKEWIWWALEMCRRTSKDWW
FT                   SKGMWDGSGVDGYGRGKGKARGEGGEGIVLLVDAAGAGYRNLEVDLLPTLLSVGHNSFP
FT                   GLLEAVYVINVGWTGRSMWAVVKHLLPKSALERVAFLDTKESLAEVFELDKIPQAYGGD
FT                   SPYTFSPSNNPIYAYYSRHSSHSFIASISRSTSCTSIADVYYTARNTPFPSRRTSPLIS
FT                   RQNSASSGMMKAMFRAGYGNDLRMTKSRDERSRKVEGDDDGDEEDEMTRVISASDVAAV
FT                   GPMTGLITQSLTEPEDPQPILSRASSTLTSRSKPPTRAPSSAAVSRIKSLSDFHLYLSP
FT                   SRLARIDLLSDSSDSEDEPPPPPSIPSLPRRKVLRPALLEKSLAGTPDEREKRTNRPAL
FT                   RLMGLPGHLADDDPVRSYSGRLQMHHAKWLEGWKGTPEELGLEDNHKLGGVKHEEEENA
FT                   PIPRTISVSPPIDRPPSPSGTLEPSPSPSPIHSPAMTPQPHDIQPYSTSNPFFGYPVVQ
FT                   FGSSIRPRYPRNRKRDLVKTLLFLFMLKLQSWRDSVERALGLNRLRIPSLSQPYCSSSL
FT                   YTPGPNRRNPAEGLVRSAATPGTYSKQVAKYRRWDKDWWWMIIGMLLLRGTWGRIVLAP
FT                   LEALGLGLSEWKAIWGAV"
FT   gene            33763..35429
FT                   /locus_tag="CNH03760"
FT   mRNA            join(33763..33947,34006..34070,34123..34562,34611..34798,
FT                   34848..35429)
FT                   /locus_tag="CNH03760"
FT                   /product="UDP-galactose transporter, putative"
FT   CDS_pept        join(33934..33947,34006..34070,34123..34562,34611..34798,
FT                   34848..35379)
FT                   /codon_start=1
FT                   /locus_tag="CNH03760"
FT                   /product="UDP-galactose transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45229"
FT                   /db_xref="GOA:P0CP32"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP32"
FT                   /protein_id="AAW45229.1"
FT                   /translation="MGVLRLAVCISGVYAAFLLWAIAQERLSKPFPSVHPHPHQQPHSP
FT                   SDPPPGDKFPSPLFLNFAQALASSLSALCYLSFKAWRDGWKGRGLGQLLGLKEVFGKSQ
FT                   TALNGDAKANKKESELNEKTKEVVEKAPKPPKKSLLALLVQVSVFQTIASPIGFLALRH
FT                   ISYPTMVLGKSCKLIPVLLLNVLLYRRKFSPHKYIVVALVTVGISMFMLFAETSKKKKG
FT                   GSDSMWGLVLLLVNLLIDGLTNSTQDQIFSSYPSYTGQQMMFTMALTTQIILLPLLVLP
FT                   LPTNPISLLAHLPPPFGSSVPTSTLSFSPPAALESISFLLSHPSALAPLFAYALLGGLG
FT                   QLFIFETIQHFGSLTLVMVTVTRKLFTMLLSVVVFEHRLTKGQWLGVGVVFAGIGVEAG
FT                   MKRKDVMKKAKKD"
FT   gene            35859..38633
FT                   /locus_tag="CNH03750"
FT   mRNA            join(35859..36013,36074..36328,36385..37625,37679..38200,
FT                   38248..38409,38467..38633)
FT                   /locus_tag="CNH03750"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(35918..36013,36074..36328,36385..37625,37679..38200,
FT                   38248..38409,38467..38623)
FT                   /codon_start=1
FT                   /locus_tag="CNH03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45228"
FT                   /db_xref="GOA:Q5K916"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K916"
FT                   /protein_id="AAW45228.2"
FT                   /translation="MSVPTQRFSDIRRSRPSYSCQVCRDRRVRCDQARPKCGNCVRNQA
FT                   QCVYQSNLSQKRKDPITDDSANKMPRRNKSSGSERSPSPLETGKLKPGYLVLNSGGRSR
FT                   YTESTFWACVDAEGLELDRILRNLPLFPRTGGPDDLVTPPAFSSSPGAATSVPNPSTGT
FT                   SPDRISWGPVRLAKLLQPLPPKLVCDRLFRAFMDCIHPLIPLMHIPSFESAYDEFWSWR
FT                   LTRPAQNISLSILHRNPSFLPLLISVLSAGSITIHEPWSDRVGQKLRGLMPEALRVIGF
FT                   PYYPSVYSLMAYILANSTLIREEDAFSSCSFVAVALRVAQSMGFHRDGTEFELDPISTE
FT                   ERRRVWWHLMHLDTMTSIAQGLPGIMSSSRCTTQVISEMKDELIGKIKSTDSLDRELWV
FT                   EPKYVLAAGRYEASTQLRTILERLQEAPNITLSDIAPLEMQIEDLRRRQSRRLESVNLH
FT                   AHSASLQEILDQLSVRVGGDDFTDHRPPPPTTASKAIQQWNQALLHLTTVKAYCILYQP
FT                   FMSDKVIWANLRSRALPHFQYFLALFLEMTTNPSYRPFHWLYPGSYQPLQPCAVLLSDL
FT                   SAHPHSSDKMLSMQLIDRVFSLLGPAGRLVSPGSYQSLPSLTGAKQVWTVLEKLRAKVW
FT                   HDLGYDHTLFWAEDEKGDDGLAHRGSMDFWLTGNLAGHSADRSDTATSSYPPPMPQNGE
FT                   AIADSTTHPTSYAESGATSTSSIPLPVAALNEQDWQNDMDALSWIPWGTSNDPPFQSIQ
FT                   NSLTTSNYMPESTDSGEAEIAPGQMIVPPGNETDLFGLYPPTESQLSSTRYQGQNFF"
FT   gene            complement(38844..44135)
FT                   /locus_tag="CNH03740"
FT   mRNA            complement(join(38844..39022,39076..39495,39545..39629,
FT                   39691..39978,40029..40152,40202..40209,40259..40351,
FT                   40409..40773,40823..41793,41851..42309,42372..42429,
FT                   42482..43554,43625..44135))
FT                   /locus_tag="CNH03740"
FT                   /product="catalase, putative"
FT   CDS_pept        complement(join(38946..39022,39076..39495,39545..39629,
FT                   39691..39978,40029..40152,40202..40209,40259..40351,
FT                   40409..40773,40823..40859))
FT                   /codon_start=1
FT                   /locus_tag="CNH03740"
FT                   /product="catalase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45227"
FT                   /db_xref="GOA:Q5K917"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K917"
FT                   /protein_id="AAW45227.1"
FT                   /translation="MTEKTPTYTLSEGCPIADATTAQRLGSCPVKGLMLMQDTQLIETL
FT                   AHFSRERIPERTVHASAVGAWGEFEVTHDNSDITSAAFLNGIGKKSKVLMRISTVGPEA
FT                   GTAETVRDVRGWSMKIFTEEGNQDFVFNSIPVFFIRDPIKFPSVNRSHKRHPAKHTADS
FT                   SMFWDFHNNNPEGTHAIMMYFSNRGLPYSLRQINSYSGHTYKLTKSDGSFVYVKLHFKS
FT                   NQGVKGMTQAEGVRTAGEAPDFHTTDMWDAIERGDYPTWTLYAQVMKPEEAENYRWNIF
FT                   DMTKVWPHKDFPLRPLGKLTLNRNPENYFSDIEQAAFSPSTMVPGVAPSGDPMLQARMF
FT                   AYPDAARYRLGVNYQQLPCNRPVSEVYAPYQRDGAMRYMTNYGGDPNYVRSSLKEVNFK
FT                   GQLGAKGHSTGGNEKHNEWVGRVAAYTSEVTDEDYVQARMFWEVLGKAGDQEDLITNVS
FT                   CHLSKAIPSVQKGAVEIFAKVNVDLAKSIEDRLAELNKGK"
FT   gene            42149..44173
FT                   /locus_tag="CNH03730"
FT   mRNA            join(42149..42329,42381..43446,43509..44173)
FT                   /locus_tag="CNH03730"
FT                   /product="glucose-methanol-choline (GMC) oxidoreductase,
FT                   putative"
FT   CDS_pept        join(42184..42329,42381..43446,43509..44063)
FT                   /codon_start=1
FT                   /locus_tag="CNH03730"
FT                   /product="glucose-methanol-choline (GMC) oxidoreductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45226"
FT                   /db_xref="GOA:Q5K918"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K918"
FT                   /protein_id="AAW45226.1"
FT                   /translation="MVHAATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLVE
FT                   AGVNNPSEITDITTPAKAMGLRNSQYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGSTAL
FT                   NYYTWVRGSAATFNDWEEFGGSTWNWENTKEYFNKSTTYHDDLGLFPDDIKSIGNKGGP
FT                   VDISHSDLVPELKPWRDALERAWVSKGHELTVDVYNGVQKGLFKCVNSIYKGVRSTAAA
FT                   FLEGKPNITLASSTISKKIIFEGKTAVGVTVIGPDDREYDFYANREVIVAQGVYESAKI
FT                   LMLSGIGIKSDLEALSIQCVVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLLRAGAEH
FT                   DGAISSYRKNHNGPLSSGLLELVAFPRIDNRLENHKQYRDYKAQNGGKDPFGPDGQPHF
FT                   EIDFVPMFADAFQWHFPTPPTGDYMTVIVDLMRPISQNGVVKLTSTDPFEQPYINLNFF
FT                   SHDLDLIALREGVRFVDDILINGEGMKDIVEGDYPWPMPRNSDEGMIRQILERSQTGFH
FT                   PCGTARISKDIDHGVVSPELSVHGVKNLRVADASVFPLIPDCRIQNVVYMVGEKAADFI
FT                   KAAHPDLYKEAK"
FT   gene            complement(46387..48348)
FT                   /locus_tag="CNH03710"
FT   mRNA            complement(join(46387..46816,46871..47150,47203..47249,
FT                   47302..48171,48231..48348))
FT                   /locus_tag="CNH03710"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(46705..46816,46871..47150,47203..47249,
FT                   47302..47792))
FT                   /codon_start=1
FT                   /locus_tag="CNH03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45271"
FT                   /db_xref="GOA:Q5KD90"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD90"
FT                   /protein_id="AAW45271.2"
FT                   /translation="MGLFRSSDGMRFNPLWHSFSLLLTLISFILLMVVVFYNAPIDHAH
FT                   STLEGKVGLRMWFLTVNETSSSFPTWTIGTKRYYDAGEGEVPGRGIGLAAPARNKERAA
FT                   DTGSGGDGGLHAYGFGIWGWCEWTNSRWTGDAVCTRKTGYKLPDDSDSSWDSIYELELP
FT                   YAVTHVLSGAAIPILITPFVVLSYFIILCLAILFPGPYPPWPVPSKYPAEVKHYRTRCA
FT                   WLLRDWRFNLYYFLAMLVLGLSMIVTVLVGRGKVNTEGGGLKARPGTGFGVFFAAWACW
FT                   ICSQMLCMWKTGIIMRREGKERTKYSKG"
FT   gene            48671..51401
FT                   /locus_tag="CNH03700"
FT   mRNA            join(48671..48807,48870..48962,49014..49144,49194..49221,
FT                   49287..49404,49455..49709,49773..49840,49893..50024,
FT                   50076..50129,50178..50295,50348..50414,50463..50826,
FT                   50880..50987,51049..51163,51228..51401)
FT                   /locus_tag="CNH03700"
FT                   /product="glutamate decarboxylase, putative"
FT   CDS_pept        join(48880..48962,49014..49144,49194..49221,49287..49404,
FT                   49455..49709,49773..49840,49893..50024,50076..50129,
FT                   50178..50295,50348..50414,50463..50826,50880..50987,
FT                   51049..51163,51228..51260)
FT                   /codon_start=1
FT                   /locus_tag="CNH03700"
FT                   /product="glutamate decarboxylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45225"
FT                   /db_xref="GOA:Q5K920"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K920"
FT                   /protein_id="AAW45225.1"
FT                   /translation="MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVEDE
FT                   VPRYRLPSKGVNGRATYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKNLV
FT                   DQDEYPAAQQIHERCISMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQEKMK
FT                   AAGKDIHNPGPNIVMGAEAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKYVDEN
FT                   TIGVFVILGSTYTGAFESVKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAYPHYQW
FT                   DFQIPRVHSINASGHKYGMSTVGVGWIIWRSMEYLPKELIFELHYLGATDYSFNLNFSR
FT                   PAHPILAQMFTFLNLGFEGYKRIMDKNLTVARLISRALEHSGYFICLSKIHHPKALTES
FT                   SSSAEQSNILPAVADAANTVLHGKKTTVDDAEYYCEGLPVVSFMFTDEIKKKYPGVKQA
FT                   WIQMQLRSIGWIVPNYPLAPDCEKTEILRVVVRESLSGDLARKLIHDILQVTEDLLNDA
FT                   GPSYSMSTATRRHENLDHGKLDNIDAVHIKQHTSTYSKPC"
FT   gene            51643..54335
FT                   /locus_tag="CNH03690"
FT   mRNA            join(51643..52338,52408..52479,52533..53465,53518..53580,
FT                   53630..53664,53715..53786,53842..54335)
FT                   /locus_tag="CNH03690"
FT                   /product="expressed protein"
FT   CDS_pept        join(51982..52338,52408..52479,52533..53465,53518..53580,
FT                   53630..53664,53715..53786,53842..54244)
FT                   /codon_start=1
FT                   /locus_tag="CNH03690"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45224"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K921"
FT                   /protein_id="AAW45224.1"
FT                   /translation="MQPKRTAETRNSTTKRARTVQSGKDETADPPVAVAEDIRSIDSRL
FT                   KGRAKGRKGKNKAEGTSDSPPPGPKKRVRKPFAAKEATWRDIPDWGDRTDVPLFRLPAE
FT                   VLDLCFGTKLNLGLQLRDYVALAGVSRYFRFHFTDDVFREIYLKSHPNYMKLRPCARRS
FT                   PIKHSQLIFTRAVKDWRQDPPLKRFDHLEIHMRSIPPREEWTQKDYEFVIRADKIIAQA
FT                   RQIWADARAERANIKKEKMKKRRVLRKVIVDGISRTVLATVPGLKHGETQGPKNELGVP
FT                   IMTDENGKEIGLGASHAEEGNDGHDDDDDEESDDELNFYSTLQEWEWEESVHNKDGELW
FT                   QKIYKLEDKMRLLRRTYDNYDKGEDFSDLSSEDEADEGKEGDRSTRKKGKKKQTKKFVR
FT                   DPNWVLPPEEKPKRPHATLVEYDPLTGERLPHDAYPSPWRARAVEAANKKFINRADAIR
FT                   VFKVGEAELLCLKHYLVPNPLNPKTPSSIYSLAAIQALALRSHGGPIGHHYHVESANER
FT                   ALKSLATRQANAAKRKADPTYVEKEPKSRQYPQTTVDPDDIGAKYGVDKDCGIWHYQGT
FT                   FIDFVADWREHRAAKAARKAQRVANGEGSETSDEDGSSQDELLPVPNVPWNDVNEYMYS
FT                   FTDEEDDLW"
FT   gene            54549..57324
FT                   /locus_tag="CNH03680"
FT   mRNA            join(54549..54992,55052..55363,55410..56932,56986..57324)
FT                   /locus_tag="CNH03680"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(54621..54992,55052..55363,55410..56932,56986..57103)
FT                   /codon_start=1
FT                   /locus_tag="CNH03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45223"
FT                   /db_xref="GOA:Q5KD87"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD87"
FT                   /protein_id="AAW45223.1"
FT                   /translation="MQASTPSPTTIQTPTLSFPDTPQMDETPKTAVLRTPRATFDGGEV
FT                   RIEGSVSGSERGSIDMGTANGERKDKGKERAVESAEDKDEEETGFDMEQLTRLQSRVNE
FT                   LEANGKTGDEWVQRDELLGMVKTLLPLTLNHLPFLQERLAAQKSTIATMQQQAKISEQL
FT                   MATERERHAVERDSWHKEMRAVMVSKEEEKVSNKRKVLDLDVGYHKELEAANKRLEMDN
FT                   RLMAPRLVDTQRQIDRLVNELRLLRPHVILNTSALTSKPTELTPATSAPPVFLPQYMPQ
FT                   LENSKGIHRSSRATMGDARTEHLLLAAKAIRSMRKTNDRLGRLTMGELKKAGVVGPEGG
FT                   MGYKEGYGEQPMSDVEEDASEEEPLIDQRASGSVTKGKSKSQATPLLSRTKRSTKKNVQ
FT                   NASISTIPQTPSKSRTTGQSSLPQTTPGGSNFNDLLRAAEMATRPNSPVHGEPILSTLS
FT                   ATRSTTRPRPDSSDIERGSPKRRRGDVWXGGGSHKAHQHSASAGSASALDLLAQASQLD
FT                   VASSTAPSSVVQSSPAVPLTSSTPQFGGLLEKDSSPRSHGSSLGAPIDLTPRNRTMANV
FT                   RLKAHPASDDFVVDPSLQTPTHRIRGSSTTSESLTPARGYASSQIYPTPGGELDERLPP
FT                   AGASSSAINPTSTPGVISEGGGGPGAGNGNFASPSGKVVPGLGKYWHYTSEMPIKRVRS
FT                   PYLKWTVEEDELLARAVAIHGEKWDLVSKGVPTRSYHQVRQRWLRKTGAFDKKNQAAKA
FT                   EREAKTESANEAKSSSTEREV"
FT   gene            complement(57005..59845)
FT                   /locus_tag="CNH03670"
FT   mRNA            complement(join(57005..57637,57701..57772,57830..57840,
FT                   57909..57989,58052..59140,59211..59282,59351..59652,
FT                   59711..59845))
FT                   /locus_tag="CNH03670"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(57607..57637,57701..57772,57830..57840,
FT                   57909..57989,58052..59140,59211..59282,59351..59652,
FT                   59711..59738))
FT                   /codon_start=1
FT                   /locus_tag="CNH03670"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45222"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K923"
FT                   /protein_id="AAW45222.1"
FT                   /translation="MTSTFRQPSLFDHFHRIPNPYAQKGLEYVTPGKELRKLKRKEQKE
FT                   RRIEQRRAHLKKRSQLLAERATIVAKRPVWHDIPDWGDRTDCPLFKLPPEILDLCFGTE
FT                   LDNDLSLREYIALAAVSRYFRQQFTSEVFLAIFLHVTGDCRESLDKHAEHIFSTHVEDW
FT                   REEKPLPKISESIYIASMPHDQWTRAEYEYHTALQKFYRSRYMVMYLRGEIHRCPSGGT
FT                   NKWIGNVSYTHSNTMGDKSIYYSSTVPGLKDGETYDPKDPTCLHADVLDKSIYPCCSDW
FT                   SMDTEIDEDEPELNKWKTIVENYHVTYESDFWNRKAEEILRRRRRKRYRRKQSSRPGEP
FT                   AKRVDTKLDLSSSDDSGYDTDDLQKLVNDDELGNETEDGLDGYDGDNEDTAEGKNDEIN
FT                   SEVPENQEKLELMMLRTLAIKARDSREAYEKRKEGEETKDEPESDDGWVVPLPGDPERE
FT                   ALALKFLEYVLEPEPHDHWPSHVRRTIARNINSHAVAEDDAIEVYGVTKEELYGLKHYH
FT                   GALWEKTDLVLYPRMAVEALTLRSHGGPLGHYRFIIDRHARKLR"
FT   gene            60244..62780
FT                   /locus_tag="CNH03660"
FT   mRNA            join(60244..60461,60508..60703,60768..61261,61313..61829,
FT                   61884..61954,62007..62082,62144..62780)
FT                   /locus_tag="CNH03660"
FT                   /product="alpha-amylase AmyA, putative"
FT   CDS_pept        join(60367..60461,60508..60703,60768..61261,61313..61829,
FT                   61884..61954,62007..62082,62144..62515)
FT                   /codon_start=1
FT                   /locus_tag="CNH03660"
FT                   /product="alpha-amylase AmyA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45221"
FT                   /db_xref="GOA:Q5K924"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015340"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5K924"
FT                   /protein_id="AAW45221.1"
FT                   /translation="MPVLSKLISLLPLLAIAQGATSDEWRSRSIYQLITDRFAPPSDDT
FT                   TCPLGATNYCGGTWQTIISKLDYIQNMGFDAIWISPTALNIEGNTKYGEAYHGYWTADP
FT                   TKLNPHFGQASDLKALSVAVHDRGMYLMVDIAINALAATSYSLDASALASDADGTLLFK
FT                   DPSDFHTRCDISWGNHTSEQVCWLVTGDDNGDVALLDLKTESDSVASVLKDWVGGYVTE
FT                   YGIDGFRIDASKHMSKEFQHDFCEAAGTFCMGEVAGDNTEYAGEYQSAGGIDSVCGFGL
FT                   MYGFVNVFTGGDKMSTLEYYINLAASSYPDPTVIGTFLDNQDLPRFNSLTSDASLVYNA
FT                   IVGMFMYGGMPIVYYGLEQDISDGPTDPQNREALWNYNNYATDGVTFGRITNLNNIRNR
FT                   LGGVGELYNAVATVLAIQDQDIALQREEALIVLTNRGQSGTGTWAIKNTQFGGSVSVID
FT                   LLSCSTSTTDSDGSLTVTWTSGQPFVFVASDVADKAGLCGSLSNSTNATTVSSSSSAST
FT                   SIDTATSSASISGNLAVITDGSSSPSFSATSSALSSSISWYTPTSAASSVSSSELVVVV
FT                   AAVSTASTAVTSSGSICRRSKKRAMSKRQL"
FT   gene            complement(62776..63663)
FT                   /locus_tag="CNH03650"
FT   mRNA            complement(join(62776..63021,63076..63131,63265..63326,
FT                   63411..63663))
FT                   /locus_tag="CNH03650"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(62939..63021,63076..63131,63265..63326,
FT                   63411..63455))
FT                   /codon_start=1
FT                   /locus_tag="CNH03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45220"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD84"
FT                   /protein_id="AAW45220.2"
FT                   /translation="MPGNDSIYYRGTNSQGNRYDSRVDTATGQTGYHYSNTNGSYYYNN
FT                   TNGSTYYNSGDGYAKYTSPSGQSSNYYGNNAGGDKK"
FT   gene            complement(64073..65561)
FT                   /locus_tag="CNH03640"
FT   mRNA            complement(join(64073..64354,64439..64499,64572..64758,
FT                   64810..64855,64936..65089,65157..65561))
FT                   /locus_tag="CNH03640"
FT                   /product="membrane protein, putative"
FT   CDS_pept        complement(join(64250..64354,64439..64499,64572..64758,
FT                   64810..64855,64936..65089,65157..65455))
FT                   /codon_start=1
FT                   /locus_tag="CNH03640"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45219"
FT                   /db_xref="GOA:Q5KD83"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD83"
FT                   /protein_id="AAW45219.1"
FT                   /translation="MNEEVFTAVPDADIGLSSQQQNLLPGLAYLTKFGSPVHPTFSHES
FT                   QLSATKVGIQDGMHQGGDDISRSITPGGNPIDTSQPGFPVFHRKFGTPAPVGLIPFVGG
FT                   AFLLNLYTVQARGVTKPNMILGIALGFGGLGQIIAGILEWACGNTFGAVTFSSYGAFWL
FT                   SLSTLYIPQFGVAAAYAENPAMLENALGLYLCVWGIVTVLFLIASHRSSVVLICIFGAL
FT                   SLNFFILSAGYLSESPKCIKTGGAIGIITAIFGAYTSLAELVTADTGFFRVPIGNLTPK
FT                   DH"
FT   gene            66964..68084
FT                   /locus_tag="CNH03630"
FT   mRNA            join(66964..67026,67085..67106,67250..67290,67540..67620,
FT                   67907..68084)
FT                   /locus_tag="CNH03630"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(67021..67026,67085..67106,67250..67290,67540..67620,
FT                   67907..68044)
FT                   /codon_start=1
FT                   /locus_tag="CNH03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45218"
FT                   /db_xref="GOA:Q5KD82"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD82"
FT                   /protein_id="AAW45218.2"
FT                   /translation="MASGFGYSGGRTRCFPFWQEFSKCYANAEKPSDCVAPKDDYMECL
FT                   HNTKEIARAKQVKSHFVQKELQESHDSRKAAEKAATGVIVSLGLVEEEGK"
FT   gene            complement(68164..69408)
FT                   /locus_tag="CNH03620"
FT   mRNA            complement(join(68164..68492,68555..68603,68685..68858,
FT                   68926..68949,69021..69108,69191..69206,69274..69408))
FT                   /locus_tag="CNH03620"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(68231..68492,68555..68603,68685..68858,
FT                   68926..68949,69021..69108,69191..69206,69274..69332))
FT                   /codon_start=1
FT                   /locus_tag="CNH03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45217"
FT                   /db_xref="GOA:Q5KD81"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039135"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD81"
FT                   /protein_id="AAW45217.2"
FT                   /translation="MRLNENTVLFGDRVILVPYRAEHVPTYHEWMKSSELLELTASEPL
FT                   SYEEELDMQRKWHIDEDKLTFILLERPSSLPPTAEQNQKVILPPSCLARCRMVGDVNLF
FT                   LPEGLEGDGECEIMIASKDDRRKRFAIEALSLFLAYLTTALPFPPTHLIARIGASNLPS
FT                   IHLFRKLGFGVVKHVQVFDEMELRWGAKDVECLSLEGLDEVTTVDWRETSLQGRIGVYD
FT                   A"
FT   gene            69540..70721
FT                   /locus_tag="CNH03610"
FT   mRNA            join(69540..69677,69737..69771,69829..70054,70141..70415,
FT                   70483..70721)
FT                   /locus_tag="CNH03610"
FT                   /product="proteasome subunit alpha type 3, putative"
FT   CDS_pept        join(69609..69677,69737..69771,69829..70054,70141..70415,
FT                   70483..70648)
FT                   /codon_start=1
FT                   /locus_tag="CNH03610"
FT                   /product="proteasome subunit alpha type 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45216"
FT                   /db_xref="GOA:Q5KD80"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037555"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD80"
FT                   /protein_id="AAW45216.1"
FT                   /translation="MTSIGTGYDLSVSTYSPDGRLFQVEYANKAVEAAGVAIGLRCKDG
FT                   VLLGVERILHSKLLVKGANRRIASLDEHIGMAGAGLLADGKHLASRGRDEASNFRDTYN
FT                   TPVTVQILSDRLSAYLQAYTSYGSVRPFGLSALVGGVDKTGPKLFCVEPSGVYYGYRAC
FT                   AVGKGKALAKTELEKVVNKEVETGEAITVREGVMELARIIYLVHDENKDKDFELEMTWI
FT                   CEESGNKHALVPEDLLAEAEAKAKAALEEGMEED"
FT   gene            complement(70964..73936)
FT                   /locus_tag="CNH03600"
FT   mRNA            complement(join(70964..71623,71686..72105,72170..72604,
FT                   72666..72846,72906..73518,73583..73936))
FT                   /locus_tag="CNH03600"
FT                   /product="pseudouridine synthase, putative"
FT   CDS_pept        complement(join(70998..71623,71686..72105,72170..72604,
FT                   72666..72846,72906..73518,73583..73911))
FT                   /codon_start=1
FT                   /locus_tag="CNH03600"
FT                   /product="pseudouridine synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45215"
FT                   /db_xref="GOA:Q5KD79"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD79"
FT                   /protein_id="AAW45215.2"
FT                   /translation="MSAQENTQKRPAEDTEKQDVEAKRFKAEEIAPSNTPSLTDHLNAP
FT                   HRTIPNPVSKMGLVPAIPDLPPSLKMVTGIEADMVARRGFVGEEECGIRGFVGKGKGVR
FT                   GVIKQRFTDFLVNEIGLDGKVLHLKDITKPQEPGSNEKDKEAATVTEEEIANGQTKSTT
FT                   EVASQSEEPEVAVDLPENLRFAAHPQWSTSTTLKLRPHFSDETIISLHQLVEQGKDAPP
FT                   KGDSGWGGRKKDTESASEENAEREEEKKEEGEEAAFNDSASKGRGQGRDRGRGRGKERG
FT                   RGRGGRGGRGGGRNADSGSWWLTYEDEREVLSQPVISKEERAAAHKILREVFPGMFESS
FT                   TREVKGEEGQRLVIKWSSGAGQSSFHGKGARRAPDAPRLPAYIHFTLHKSNRETMDALS
FT                   HLQRLLNVQAKDLTVCGTKDKRAVTVQRVCLKRSGRNLQTVWRALNGVKQGWRTEQQAV
FT                   EERGDRGVRVGDFEYSDKYLELGMLKGNRFLITLRNVEAESVEEIDRTMESVRDLGFIN
FT                   FYGMQRFGTSSMPTHVTGLFILRSNWSAALDSLLFLREGEHPDCVAARLAWLEDGDYVK
FT                   ALEKMPRRAVAERSIWEFWKRGGRMEDKVGALGVIPRNLRTMYVHAYQSYVWNLIVSER
FT                   IKMSATEPLVGDLVIEKSDDDEPVDPENVPAHRKDRHGRTKSWKTSSSPTVRRLTAEDI
FT                   TNKTHTIFDVVMPLPGFDVDYPGGEVGELYDSILKADGLDKDRMRREQREYSLPGSYRL
FT                   ILLRPLSLTWTHLQYTDPDLPLVQSDEDEILSLNPPAANDPEGKFRAVKVDMQLGASTY
FT                   ATMVLREITREETSSWFQRGRTMKGEDQEFKGIKKDDEGQGGEEGEGGEMELMNE"
FT   gene            74080..75440
FT                   /locus_tag="CNH03590"
FT   mRNA            join(74080..74230,74282..74370,74437..74580,74649..74967,
FT                   75022..75090,75166..75440)
FT                   /locus_tag="CNH03590"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(74125..74230,74282..74370,74437..74580,74649..74967,
FT                   75022..75090,75166..75326)
FT                   /codon_start=1
FT                   /locus_tag="CNH03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45275"
FT                   /db_xref="GOA:Q5KD78"
FT                   /db_xref="InterPro:IPR003166"
FT                   /db_xref="InterPro:IPR016656"
FT                   /db_xref="InterPro:IPR040501"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD78"
FT                   /protein_id="AAW45275.1"
FT                   /translation="MLKRNTPAWAVPKSPSVKHELKDEPGEEPDTKRIKTGNVKPILTA
FT                   THGMFKENRTAAYALLNQLKKSMTIGWEDAFFWIQDTSPGSDPTEALEIFKALERVEFN
FT                   KINRVFTYIPELTLTTTNEIRNHIRIHSTPTSGIPIKTLREAMPNGIEPLKDLEARGDI
FT                   LIMRGLTGAWKDIPLPRLGRKNVNGQELMEGGSGRWKTVFWDHLREAGRAGKRVDDEFI
FT                   YSWADVPIAETDDVAKLLADQELSASSAIPAAPKATANAASKKKKKRTRALKITNTHMK
FT                   EQGIDFSKDYVKPA"
FT   gene            complement(75442..77983)
FT                   /locus_tag="CNH03580"
FT   mRNA            complement(join(75442..76564,76637..77116,77196..77388,
FT                   77488..77666,77776..77983))
FT                   /locus_tag="CNH03580"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(75569..76564,76637..77116,77196..77388,
FT                   77488..77666,77776..77916))
FT                   /codon_start=1
FT                   /locus_tag="CNH03580"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45270"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD77"
FT                   /protein_id="AAW45270.2"
FT                   /translation="MSETPPVPLPEGKRTSSPPHNAPTTKRAKRGPQGGGMGGHVTESD
FT                   LVKIVHETVRILCGMPAPNYQGNLAPDKWPTPDPVNAKDGRMKDEQGKDVWRPDWGKLG
FT                   ALSTMNFVVHATIACRNHPMYHESITDSILTDRVKKYIQSIHKGRKKTPKRKEAKNDRR
FT                   AIRERQRRLQDFIVKNFDDTPLGHCRERSLLREAFKPNGILATLRIVHHSQVLQHGLRT
FT                   VSHSKASVRVKRRDVVNGGGGNGVVDETGMSVREGVGDVDEDQYDGEDAEAEDEESQGA
FT                   NTLASAMEQAMGECGQIPPFDEFQIYTDAWWGEAATPFYVSLDVWWWSELMRWAVWTAY
FT                   ECYRLSPISSERPPPAHLPIEKIDLSSSFRFTNSPPRTRSGPGWPSIWACPGMIDYPTV
FT                   QSINPNSIPPPTSLPPNPLPSPSDLLLPPLKDLLRKPQHSKLYTSVTKHLEHPRLLSDD
FT                   QLAELWVLRQNMRTRREYEFALGSLTGDGKRRSIVGEGGLLRGLGLGPGLGSPGDGERA
FT                   EGVIGIESVEGNVDGEVRDGEEGNAINPEHAPPQSLSNSLLPTRSTQPRDVPLARQAQG
FT                   PQAVIHSVNPTTAEQPEQPKQLESELGPEPELGPEQTQLIGLEALGEVVGNAIHAAALA
FT                   ELKKKGNSDDEVDEEIEMLEGYEDISF"
FT   gene            complement(78284..79275)
FT                   /locus_tag="CNH03570"
FT   mRNA            complement(join(78284..78572,78675..78815,78916..79143,
FT                   79199..79275))
FT                   /locus_tag="CNH03570"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(78407..78572,78675..78815,78916..79143,
FT                   79199..79227))
FT                   /codon_start=1
FT                   /locus_tag="CNH03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45214"
FT                   /db_xref="GOA:Q5KD76"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027496"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5KD76"
FT                   /protein_id="AAW45214.2"
FT                   /translation="MKAYIYDDKPGDQRLPHDTGIDIPEPTLAKLGVVYQRIPIDSEGA
FT                   WESKIDEFAKERGYKNRDRITVTREGLGEAYEEKIKSFFDEHLHEDEEIRYILAGSGYF
FT                   DIRGAEGVHEEQWIRIALEAGDLIVLPAGIYHRFTVDSANTITAMRLFQDEPKWTPYSR
FT                   KADGTDKLGSRDKYLETVRVGVTA"
FT   gene            79446..83074
FT                   /locus_tag="CNH03560"
FT   mRNA            join(79446..79620,79678..80037,80087..80130,80182..80345,
FT                   80397..80547,80607..81606,81752..82064,82134..82506,
FT                   82619..83074)
FT                   /locus_tag="CNH03560"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(79937..80037,80087..80130,80182..80345,80397..80547,
FT                   80607..81606,81752..82064,82134..82506,82619..82656)
FT                   /codon_start=1
FT                   /locus_tag="CNH03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45213"
FT                   /db_xref="GOA:Q5KD75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD75"
FT                   /protein_id="AAW45213.1"
FT                   /translation="MPSPKQAEKLANPAVAYTLLEKLGAGNFGTVWKASHNDTKQIVAI
FT                   KMIDLESSDDDISEIQAEIAHLSSCWSDHVTKYYGSFVRGARLWIVMEYLAGGSCLDLL
FT                   KPGVFTEAQIAIVCRELLLGLEYLHMEGKIHRDIKAANVLLSASGDVKLADFGVAAQLS
FT                   SHKSQRHTFVGTPFWMAPEVIRQAGYDSRADIWSLGITAIEMAKGDPPLSEYHPMRVLF
FT                   LIPKARAPTLDPEEGWSEEFQDFIEKCLQKDPRDRATAKQLLQHRFIRSAKKTTDLIPL
FT                   ITRYQSYKSSHPSSKPNTTPSKTLNRLAAGLGGLTIDGNGYGQGTMGSEWNFDETIRST
FT                   TRGVPINLNLEDMDEGFDEDEGEDDWDAKMAEMERWDGTVKENGGDLLVAGALTGSEMS
FT                   SPMIERQPNRRNSTPPPGASASNTDTREEGERKGVDEPKTPPSSTSPSPSQRSLQSSTG
FT                   SVSSGKSTWKQRNDKVRGTVVKEGDVGDGFSTVKPMKKIDAVASQRLSTSYIGAGSVRR
FT                   ANVSGPTRNSGSTTESPTKFRPSAPLVSENIPRQTPQNQTQTQGKGASAEPDPRSLAGQ
FT                   ALAEQVILPILSSTSSNPKHDLPAPTLESLSLLSKGFSDLSASSPELTYRLVMDILGGI
FT                   RGNGVVMELVGRMTMGKEVGLDVGDGPGVGAGVELDGVDGVSGMRDGQCVGREEIEEGE
FT                   AKVKGDLVKERSAIADLLYLRWLDGMRMKWPKA"
FT   gene            complement(82840..85721)
FT                   /locus_tag="CNH03550"
FT   mRNA            complement(join(82840..83475,83609..84265,84325..84702,
FT                   84759..85117,85171..85721))
FT                   /locus_tag="CNH03550"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(83359..83475,83609..84265,84325..84702,
FT                   84759..85117,85171..85711))
FT                   /codon_start=1
FT                   /locus_tag="CNH03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45212"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD74"
FT                   /protein_id="AAW45212.2"
FT                   /translation="MQHRTPLTPIPQNRSPPSATSSNAPSTPTPKRPSSAKRPPKLAPI
FT                   FLAKRARPERERQENTAWGVSAKKRVHLAGPSSIPPLAAGSRSAPIASDGEDASQSSDD
FT                   QSDSEDDRRLYTQRKSQSIHDYFLPSTSRYGRVKDERQDKENTRVIEPITKEECVWKRK
FT                   RRRLGVKGQGSSLANQRLIPPPQAYLSTLLHSLLPYHPLRPPASILLPSIHPPTGRPRD
FT                   FAPPLAVSFNHIAKQYTSSDARSQGLRRLIGIAGEEGGVRILDVDEGLGMHREEKGWWW
FT                   RAHGNAIFDLKWSPDDTKVLTASGDQTSRLHALTTPVPTLLATLRGHTSSVKTVTFLDP
FT                   SRSANNPSQSSVIASGGRDGNILIYDVRTKGRDPELGEYDAGPARREGSRERYRDGIPG
FT                   FAPQTSGEVLDPVIVIKGAHGDGKRSGRTATRSVTSLLALSSIPGTLASGGSFDGIIKL
FT                   WDLRFPAPTNRSSNPRPTCTPSGSLPDATLSGESPAKRARSINAMVESPVNGDVYALCG
FT                   DSKVHVLRPSAALIQHHPTHSSGAFNAFTEEETYAEAVQPATYSDPSMLISNFYIRLSL
FT                   SPDGRYLAAGSCKGGLMTWDTQERGQDMNRRRDASTTVAKKLGMGFEVGMSEIGGKDRE
FT                   VCAVEWGKDILAATSDGSLTRIWRSEPEIAKQIAENPGAYANEWAGAI"
FT   gene            complement(85839..89072)
FT                   /locus_tag="CNH03545"
FT   mRNA            complement(join(85839..86239,86302..88036,88096..88642,
FT                   88711..89072))
FT                   /locus_tag="CNH03545"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(85888..86239,86302..88036,88096..88642,
FT                   88711..88989))
FT                   /codon_start=1
FT                   /locus_tag="CNH03545"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5W8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5W8"
FT                   /protein_id="ALO69500.1"
FT                   /translation="MFPVPSHLHRSGGEHISSEAEAEVSVQGNQPSVEAQCEQAQSKVL
FT                   DLLEPLLRPPLDSSDKRNNERKRKVSRWNVDEIKKVKENLENAIEENKTKTHEILMNNL
FT                   PSISSHIQISSNLCSDFAELKIKLKALESQVDVSDPATSFMPPLLSLLNKHFNSISARD
FT                   TSQGHIAALKALKAKVEKVKKLEEVVWAGQGVEDWVVDSAPLAKKETGAEANEIAVDGL
FT                   EATAICKALEEKESVLRTLLRDQLVDGFKRAVVVQKDGMKLDVRQEIRLSSPNASRPDY
FT                   LQTTTASPYPLSSLYKALSSLSLLPNLLQALQTQLLTTIILPVVSSQRRISISSSSGIF
FT                   SLKSDQVSGDMEDQEVLTGLKQVLDFTSRTLYPEEANTPEREPFIREITVKTLESLLDH
FT                   LIIPSIPSSPSSIPGWLNLIVSSVAIEDTVLPVSSANDQLHHSRPLKTFWEKQAGKEYA
FT                   NKRRYDTADLVRVLVLNEWGRWEGTEKKREREVSVVVEVEVSSDDEDQPVKEQSKEQGE
FT                   AGEAQGDGWGFGETSENQIEQAGVKQVNREDAEEAEDGWGFDEESIPPASSADQAPQEE
FT                   DEADGWDLDVAASTSSSLPESSPSLPQLDPSVELEARTEHAPEPQPQPVSQHEPQHEPQ
FT                   RESEPQPEPKPVSAPAPTSAPTKPLREAKRLGKKVAKKSKTEEYDPWDQPFDNENSLSA
FT                   STSTFTSASTSSLSNPTRALSAETPSNNDIPPIKKPPKEAKKLGKKVGKKTNKEAERDF
FT                   WDTDIPVEDLGGGESSVHHTAGVLGDKVEGGGGGNGDGRSRDDDPTSTSPQMTAPPQKR
FT                   RTELREEKRVIEEKYFVSTACEKLLDIGRGLLKEVEELQSSSFASPSFTFDSTSPIIIQ
FT                   SLTDIFSLYRALLPIRYAQQLQDIPGITMQAYDDGNYLASQLGSFALPASSTLSLDDEI
FT                   ARLRALSERIYEDFLKNQREGIDEELDSLKGVEGTADYSI"
FT   gene            89211..92847
FT                   /locus_tag="CNH03540"
FT   mRNA            join(89211..89343,89431..90015,90083..90990,91153..91949,
FT                   92035..92367,92434..92847)
FT                   /locus_tag="CNH03540"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(91287..91949,92035..92205)
FT                   /codon_start=1
FT                   /locus_tag="CNH03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45211"
FT                   /db_xref="GOA:Q5KD73"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR032549"
FT                   /db_xref="InterPro:IPR032567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD73"
FT                   /protein_id="AAW45211.2"
FT                   /translation="MLEILERFSTNTTSITTNSRAPETRHLAKEPDSFSGNPTELENFL
FT                   TSCVLYMDCYPGTFNSDKAKINFIISHCRHKVMKSLRPLMNRAQQPELLQNYEEFLKYL
FT                   RRHWGDPDEKWNAKREIRNRQERRYLSGYKDPGGLTNITLRFFKPNLPAHVQPMDAGII
FT                   SAFKSRYRAKVIPFALANYEDGVPPHLCYKVDIKSAMEMADDSWNEITGETVENCWKKV
FT                   LHVLNLGPASLRKNSQYGAPTTAQRSKATASSIATIMYASSIVNGIAKITPRDFH"
FT   gene            complement(93182..93289)
FT                   /locus_tag="CNH03530"
FT   tRNA            complement(93182..93289)
FT                   /locus_tag="CNH03530"
FT                   /product="tRNA-Lys"
FT   gene            93410..96168
FT                   /locus_tag="CNH03520"
FT   mRNA            join(93410..93941,93994..94111,94169..94243,94297..94408,
FT                   94457..94625,94676..94768,94818..94926,94996..95071,
FT                   95125..95208,95262..95351,95405..95553,95622..96168)
FT                   /locus_tag="CNH03520"
FT                   /product="histone deacetylase 1 (hd1), putative"
FT   CDS_pept        join(93597..93941,93994..94111,94169..94243,94297..94408,
FT                   94457..94625,94676..94768,94818..94926,94996..95071,
FT                   95125..95208,95262..95351,95405..95553,95622..96067)
FT                   /codon_start=1
FT                   /locus_tag="CNH03520"
FT                   /product="histone deacetylase 1 (hd1), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45210"
FT                   /db_xref="GOA:Q5KD72"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD72"
FT                   /protein_id="AAW45210.1"
FT                   /translation="MLSAQPPIDPSPPPSSSSSRRVAYYYDQDVGNYNYYLGHPMKPHR
FT                   IRMAHNLIVNYGMCDEEGQEHGPAEVWGEGKRAVNDEIAQNWGGGEMGDAEVKWEKAAL
FT                   RGSRSKTMQVFKPRRATKEEMTRFHTDEYIDLLEAVTPETADALTGGGTRCLIGEDCPA
FT                   FDGLFEFCTISAGGSLGAAERLNAGAADIVINWAGGLHHAKKTEASGFCYVNDIVLGIL
FT                   ELLRIHPRVLYIDVDVHHGDGVEEAFYVTDRVMTCSFHRFGEFFPGTGDVRDVGMKKGK
FT                   GYAVNVPLRDGITDDSFQSIFKPVIDRIMSHFRPSAVVLQMGADSISGDKLGGFNLTLE
FT                   GHAECARFIKSFNVPVMMVGGGGYTVKNVARAWTKETAIMCGVDLAEDLPYNQFLEYYG
FT                   PRYKLEVLPTNAVDHNPPEYLERIKNQVFENLRSLPFAPSAQMRSVPSKTIGQVLGITD
FT                   GGDEEPEDEIDQRIKKLLKRRRANVLDVDASSSSESETDTPAFSRPGRARRQGGNFSGR
FT                   GRSSRLAQLQRNRERREAAQEASNEVEDDPCGVLGKKKRSFFKVVPKLNGVGVEPIDAT
FT                   GFGIGVVTNGLNGVGGLKDRLGIPVVEQWKGDGIVSRGGTPASIA"
FT   gene            97332..99805
FT                   /locus_tag="CNH03510"
FT   mRNA            join(97332..97427,97502..97592,97709..97817,98232..98379,
FT                   98447..99805)
FT                   /locus_tag="CNH03510"
FT                   /product="v-SNARE, putative"
FT   CDS_pept        join(97426..97427,97502..97592,97709..97817,98232..98379,
FT                   98447..98459)
FT                   /codon_start=1
FT                   /locus_tag="CNH03510"
FT                   /product="v-SNARE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45209"
FT                   /db_xref="GOA:Q5KD71"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD71"
FT                   /protein_id="AAW45209.1"
FT                   /translation="MSSEPYDPYIPSGSQPPAGPSSSGNNAQSTKIQAIQSQIDETIDT
FT                   MHDNITKVAERGERLDALQDKTDTLAVSAQGFRRGASRVRKQMWLKDMKMRIIIAVGVC
FT                   VLIVIIVVPIVKAVQK"
FT   gene            complement(99658..100798)
FT                   /locus_tag="CNH03500"
FT   mRNA            complement(join(99658..100113,100174..100236,
FT                   100293..100361,100428..100609,100712..100798))
FT                   /locus_tag="CNH03500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(99846..100113,100174..100236,
FT                   100293..100361,100428..100480))
FT                   /codon_start=1
FT                   /locus_tag="CNH03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45208"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD70"
FT                   /protein_id="AAW45208.1"
FT                   /translation="MKFFVAAVALVPAVMVNAYTTCMLTCMSEQQPTYCPSASSYNETS
FT                   CLCSDDFITYVKNCLYQSDCSTDVPVWYDLSEDACNTTSSSSSAAAASTASSQSSSSDA
FT                   AASTSSASTAETSSASSGAASVFGNAAAFGSVAIGVSAVIGGALLL"
FT   gene            101925..103746
FT                   /locus_tag="CNH03490"
FT   mRNA            join(101925..102124,102161..102401,102460..102550,
FT                   102605..102754,102806..102871,102933..103013,
FT                   103064..103149,103218..103385,103438..103746)
FT                   /locus_tag="CNH03490"
FT                   /product="expressed protein"
FT   CDS_pept        join(102285..102401,102460..102550,102605..102754,
FT                   102806..102871,102933..103013,103064..103149,
FT                   103218..103385,103438..103479)
FT                   /codon_start=1
FT                   /locus_tag="CNH03490"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45207"
FT                   /db_xref="GOA:Q5KD69"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD69"
FT                   /protein_id="AAW45207.1"
FT                   /translation="MLSLTHILPLALAAASGASASPTTIQKRDISYPGVLGFLEPTPRG
FT                   WDYSTMGTSPCGGFTTVNQTYYGLSTGMEFQVSNDVSNVVISYSTSSDMSNAVTLATIE
FT                   SATAGTMCLDGENLFEDEGFNFGDDITLQVFYHDEVTEQDGYQCADISFTSDHVMSVTC
FT                   SNTSTIITKNGGSSTSSDSTTTVTVTAKSGKVTPLQAGWIGACVTIAVFGFALLALWYF
FT                   GAIFFSRNALRRSEIQLGSHRMAEHSLDDISLHRRTTVDHKTPL"
FT   gene            complement(103670..107083)
FT                   /locus_tag="CNH03480"
FT   mRNA            complement(join(103670..104788,104841..105050,
FT                   105104..105251,105313..105827,105876..107083))
FT                   /locus_tag="CNH03480"
FT                   /product="ubiquitin-protein ligase, putative"
FT   CDS_pept        complement(join(103826..104788,104841..105050,
FT                   105104..105251,105313..105827,105876..106826))
FT                   /codon_start=1
FT                   /locus_tag="CNH03480"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45269"
FT                   /db_xref="GOA:Q5KD68"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD68"
FT                   /protein_id="AAW45269.1"
FT                   /translation="MPVRPSRSNSDSSIPYVTNSSLASSYRPTSIRERETSPINTFNQL
FT                   SLERSLTPPKAPRLAPQVTHDPKYTRHKRTQVLRNTSGTPSAASTDDEDDQDERGRGGI
FT                   DEEVKSWLELRDGQGWKRIGKYKSVNKRGEIKNDLTNQLPPEILIQIFRYLPGNKDLLS
FT                   VLLVSRFWCLCAFSLLWYKPTLPTITQLASIVRVIHSPTRSLPYANAIRRLPLIQLGPT
FT                   LTDELFTSLLVCSRLERLNISGADKLTSGALRNVIACMPNLVSLDLTGVINTDDAVLVI
FT                   VGETCQKLQAINLSECRLVGDEGVLALAKESRALRRIKFEKCHRITQKSLIPLIRACPL
FT                   VLEYDFQDVISLSSSVLHTVFLHASHLREIRVNGCVSLNENCIPNLLDLSEMQDDGVAK
FT                   VSEDVGIKIEPAEGVTMWRPVTTTFEYLRVVDMTGCTDLGDKAVDNLITNAPKLRQLTL
FT                   NKCPALTDKSLESIGKLGKHLHNLHLGHVSLITDDGVINLARSCTRLRYLDLACCTLLT
FT                   DACVAEIGENMPKLKRFGLVKVTNITDEAIYSLVRKHTSLERVHLSYCDQLSVKAIAYL
FT                   LNKLAHIKHLSLTGVSSFKVPELQEFCRPPPDFFNDHQRAAFCVFSGSRVVDLRDYLNN
FT                   HYLPSMEVDTSEDSGHDGAASSTSSLTIPRAAPTPDHSSISNSVAQHSNLVYRQSLSNL
FT                   NDVWEDAPSPISPTPMSRPQPPHILTASIQYQSVQPGEGAPFPIASTSTSPPTFTSSSS
FT                   ARLTPNPTSAAPSYFNISSSPSLHNRFAYGGTTLPTHLDYLVPPSQESSRSSSMSSNGD
FT                   RFPFIPHQVLSERSRGPDAPSRRDRPSGPRVPSDSYNVSPSYANEFASYWSREGRLPPA
FT                   SDAEVGMARTHIAEEPMTQVPNLSHRPGANGSSSSSAGAQREGGRGSRWLQRFGNGR"
FT   gene            107759..108818
FT                   /locus_tag="CNH03475"
FT   mRNA            join(107759..108201,108256..108454,108530..108818)
FT                   /locus_tag="CNH03475"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(108341..108454,108530..108751)
FT                   /codon_start=1
FT                   /locus_tag="CNH03475"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S3"
FT                   /protein_id="ALO69501.1"
FT                   /translation="MFHMDIQSQPEYFCKGCGHVYEDSPDHPAHGEKCTKCDKVLFDRV
FT                   NWIKPGERPIVRNTYTFCNFRSSYCTEVGSYWQDEEEGLEDLCRIMIDNSEVPENTARL
FT                   SHNCRNK"
FT   gene            complement(108993..113104)
FT                   /locus_tag="CNH03470"
FT   mRNA            complement(join(108993..109190,109272..109475,
FT                   109528..109585,109643..109785,109862..110068,
FT                   110125..110314,110366..110454,110515..111190,
FT                   111243..111343,111392..111499,111553..111835,
FT                   111885..112723,112768..113104))
FT                   /locus_tag="CNH03470"
FT                   /product="protein transporter, putative"
FT   CDS_pept        complement(join(109051..109190,109272..109475,
FT                   109528..109585,109643..109785,109862..110068,
FT                   110125..110314,110366..110454,110515..111190,
FT                   111243..111343,111392..111499,111553..111835,
FT                   111885..112723,112768..113047))
FT                   /codon_start=1
FT                   /locus_tag="CNH03470"
FT                   /product="protein transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45268"
FT                   /db_xref="GOA:Q5KD67"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR032630"
FT                   /db_xref="InterPro:IPR032631"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD67"
FT                   /protein_id="AAW45268.1"
FT                   /translation="MSTYSHTPNYPLRTLSQRSNSAAMPQLEPEETSSSSRTKLTSWGR
FT                   SKKKRVSDATEEEALLEENSSYAFEQELGTEIRHGGKSKGRTIPLQPASPKSPYPANVV
FT                   RNQKYSILSFLPLVFYEQFKFFFNFYFLVVALSQFIPALKIGYIVTYVAPLAFVLAVTM
FT                   GKEAFDDYSRYLRDREANSTRYLVLVPQPPSPNPSSDGEQTPSLPRPQTRSTPASSIKV
FT                   GDMVLLEKNQRVPADMVLLTTSEEEGTCFIRTDQLDGETDWKLKVAVGETQKMGEAFVG
FT                   SAEGSLYADPPIKDIHTFYGVFTLRSTSPGEQTETSTPLSVENVLWANTVLAAGSAVGL
FT                   VVYTGKETRAVLNTSEAGTKMGTLEKEVNKMAKILCTVTFALSVILVALNGFRGQWYIY
FT                   VFRFLILFSSIIPISLRVNLDMGKTVYAHQIQTDKEIPETIVRTSTLPEELGRVEYLLS
FT                   DKTGTLTRNEMELKKLHMGTLVFGWDSMDEVSHLLSQALDETSGPHGRQGSLPGGNQRG
FT                   RRDMTGRVRDTVMALATCHNVTPVVNDDGTTTYQASSPDEVAIVQWTESVGLTLTSRDR
FT                   TSMVVRSSAGRSLTFDILSIFPFTSESKRMGIIIRDRETGGITFVQKGADVVMSKIVQK
FT                   NDWLEEETGNMAREGLRTLVLARKKLSEEAYAAFDKAYRAAQLLPSESRASSITSVISQ
FT                   HLETELELLALTGVEDKLQEDVKSTLELLRNAGLKIWMLTGDKIETATNIAVSSKLVAR
FT                   GQYIHQAAKLTTADQVRDMLDFLHTKLDCALVIDGESLQLSLDRFRSEFIILATQLPIV
FT                   VACRCSPTQKADVAKLIREYTKKTVCCIGDGGNDVSMIQAADVGVGIVGKEGKQASLAA
FT                   DFSINQFSYLTKLLLWHGRNSYKRSAKLSQFVIHRGLIIAVIQAVFSSIFFFAPIALYQ
FT                   GWLQVGYATLYTMAPVFSLVLDKDVNEDLALLYPELYKELTKGRSLSYKTFFTWLTISV
FT                   YQGGIIMLLSLLLFESEFLHIVAISFTALVINELIMVALEVTTWHSYMVLSELGTALVY
FT                   FGSMAVLPEYFDLAFVLSSTFVYKVTVIVAVSSFPLYVIKAAHQRLNPAAYKKVAGI"
FT   gene            113248..114834
FT                   /locus_tag="CNH03460"
FT   mRNA            join(113248..113530,113578..113618,113671..113749,
FT                   113811..113956,114008..114606,114666..114834)
FT                   /locus_tag="CNH03460"
FT                   /product="coenzyme A transporter, putative"
FT   CDS_pept        join(113302..113530,113578..113618,113671..113749,
FT                   113811..113956,114008..114606,114666..114717)
FT                   /codon_start=1
FT                   /locus_tag="CNH03460"
FT                   /product="coenzyme A transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45206"
FT                   /db_xref="GOA:Q5KD66"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD66"
FT                   /protein_id="AAW45206.1"
FT                   /translation="MYNRDQPGSSSSTTSPNGKQRASIMTEQGSLPGLLVNTPLEESVW
FT                   PPARESDRWTASDFWRKSRERAKTDRNSWDYVLSSGIAGGIAGCVAKTSIAPLDRVKIL
FT                   FQTSNAEFTKYAGTPMGLLHAISVIYKSSGVRGLFQGHSVTLLRIFPYAGIKYMMYDWL
FT                   ERLLIKHPDQRSPQRFFLAGSASGVCSVLCTYPLELIRVRLAYQTKTSERTSLLQVIKT
FT                   IYHEAEIPVNKKQSQSVSPFIRNLPLYPFYRGFSMTIFGMIPYAGVSFLTYGTLKRYAA
FT                   DYIPYFGNHATARDLACGAVAGAVSQTSSYPFEVVRRRMQVGGTLGNGGIGWREAVKRV
FT                   YESKGWRGFFIGLSIGYIKVIPMTSISFATWQLMKRLMEIS"
FT   gene            complement(116146..118163)
FT                   /locus_tag="CNH03450"
FT   mRNA            complement(join(116146..117630,117685..117795,
FT                   117856..117979,118038..118163))
FT                   /locus_tag="CNH03450"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(116317..117630,117685..117795,
FT                   117856..117979,118038..118120))
FT                   /codon_start=1
FT                   /locus_tag="CNH03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45205"
FT                   /db_xref="GOA:Q5KD65"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD65"
FT                   /protein_id="AAW45205.1"
FT                   /translation="MENSWAALAALGILIQLSVQQKVLRTVWLLLNVNDTFRALRLVRA
FT                   NGRRIGVNTRRKSMRGALVCWIIYLIGTTLSPLSSTLLGWIPLYSPIKSILGCCFLIMR
FT                   LSCSVAIFKSLVPLVKPYETPIDITVHLFESLFILVFHFGVQIPIIHAAAWIKSVGEVN
FT                   FKLPIEILQRWRRQLLSSFTTVSLPKAIRRLSNSKDTPSQIVTLPTPPRSAPSSPTATQ
FT                   TSPAHPSTRSRQPRQPKRKPLQPIVISPTPSPPPPPAPAPVLVFAPSTPVRRMAMGEPA
FT                   VVKKNGFLDVEREVEVRRSPRKNKGKRKDNATEAQREPEKDMEVEDDSQRVKSKKRVRE
FT                   EEQQLQPRLTKSIAISHTMNRPGMNKRSVKRAEIQPSKSGIKKSVSGLKRGATMSNVSD
FT                   LHAGKGMEDVEITVREPKHPRLPPSRSVVSLSERNVPFETSLPKFIDKALPLQQPTSVP
FT                   IAATRTREPQTLTFSTSTRRMQESAPNGVAEPEKPLISAAGRARAAKAKAKALTREEED
FT                   RKGAGEKRKAAGGGQREGAGKKARVM"
FT   gene            118346..119814
FT                   /locus_tag="CNH03440"
FT   mRNA            join(118346..118440,118507..118601,118658..118833,
FT                   119033..119814)
FT                   /locus_tag="CNH03440"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(118412..118440,118507..118601,118658..118833,
FT                   119033..119716)
FT                   /codon_start=1
FT                   /locus_tag="CNH03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45204"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="InterPro:IPR025609"
FT                   /db_xref="InterPro:IPR025761"
FT                   /db_xref="InterPro:IPR025762"
FT                   /db_xref="InterPro:IPR025768"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD64"
FT                   /protein_id="AAW45204.2"
FT                   /translation="MAVDYDQFKGKPFQVISKLGVRYTGIFDHISQEDQTICLAQVYNH
FT                   GTEDRPTARKLPGSTKSLGWVRFRTESIESLSLVENYNHPGAEPEPQEDPILASVSQAP
FT                   PPNAVAAGPSSPSPQTTSQPYQRHDLPAKPSQSAISAATAMSRVERSLSELSVDDRPRR
FT                   PSRQAQARPPAVPDAEFDFQKANEKFEKEKEAFKSAADGQGADVAVLDEPVNQPHPSAV
FT                   VQSPSEGEPKTAVYNKSSFFDSLSHSSSKISRNEERHRNLDTFGEAGGNGMGGRGGYGG
FT                   RGRGRGGYTAGGGHYNGNGYGGGRGRGGYRRGGYQNQSQPGESVNL"
FT   gene            complement(119815..120637)
FT                   /locus_tag="CNH03435"
FT   mRNA            complement(join(119815..120199,120304..120406,
FT                   120482..120637))
FT                   /locus_tag="CNH03435"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(119820..120199,120304..120406,
FT                   120482..120541))
FT                   /codon_start=1
FT                   /locus_tag="CNH03435"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M616"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M616"
FT                   /protein_id="ALO69502.1"
FT                   /translation="MLRPHSPSEYPSLLLYILDETHITVTLTTALAILYTRNAHIVWLA
FT                   IGALGSSLTAKALKKLIRGPRPPPPPDSSASPVRPKKTYGMPSTHSTALTFYAAYILPS
FT                   LSSLPLPYLLGLGVVGYWAAGLWSRKELGYHTWEQIGAGALTGGILTWIWRGIWNNWDV
FT                   EGTLQPLIDHVWKTIVG"
FT   gene            120760..121507
FT                   /locus_tag="CNH03433"
FT   mRNA            join(120760..120912,121046..121154,121251..121507)
FT                   /locus_tag="CNH03433"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(120848..120912,121046..121154,121251..121394)
FT                   /codon_start=1
FT                   /locus_tag="CNH03433"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5V1"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5V1"
FT                   /protein_id="ALO69503.1"
FT                   /translation="MPQPACQLAKEELLACLLRTDCVLKSGKTPQECLQKPQELPLQCQ
FT                   HLITRFADCKKGMLDMRRRFRGNHLSEEAKERARGTGTVDIRPADDIAPDRPDDQSNRQ
FT                   Y"
FT   gene            complement(121544..123477)
FT                   /locus_tag="CNH03430"
FT   mRNA            complement(join(121544..121763,121857..122024,
FT                   122118..122202,122320..122412,122479..122580,
FT                   122642..122760,122835..122943,123028..123040,
FT                   123100..123214,123297..123356,123408..123477))
FT                   /locus_tag="CNH03430"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(121696..121763,121857..122024,
FT                   122118..122202,122320..122412,122479..122580,
FT                   122642..122760,122835..122943,123028..123040,
FT                   123100..123214,123297..123339))
FT                   /codon_start=1
FT                   /locus_tag="CNH03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45203"
FT                   /db_xref="GOA:Q5KD63"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="InterPro:IPR016580"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD63"
FT                   /protein_id="AAW45203.2"
FT                   /translation="MRFRTGISNVGLLHKIIRSLAALARSCVIKLSEEQVYFIVPGSES
FT                   ATGVQVWSQVKVSTLFEDYRIESNSNNEIWVEVNLDSLVKVLRSADNSVGGINENMRNS
FT                   AALSQAEVTLKLNKKQNQPIWAFDIKGYTASRKSMIITHEINVKILSSRRQEDLKEPLC
FT                   PRPDIHVVLPNLQELRNIVSRLAPVADDVDVSANHEGTMELAVRSSKVNLTTTWKDLPI
FT                   PVTNLEEEGEEAEQPPPPGQMMTTTVTIKALLKFLTSYVISGEAIMCICEGYCVIAYVY
FT                   IGPIDNAEGVLTFYVPGKATDDN"
FT   gene            complement(123647..127182)
FT                   /locus_tag="CNH03420"
FT   mRNA            complement(join(123647..125490,125585..126029,
FT                   126115..126256,126397..127182))
FT                   /locus_tag="CNH03420"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(124309..125490,125585..126029,
FT                   126115..126167))
FT                   /codon_start=1
FT                   /locus_tag="CNH03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45267"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD62"
FT                   /protein_id="AAW45267.2"
FT                   /translation="MSSSEEPLTKGKERENPRPFNVTNLSGPARLPTTGSTDPSHVAYS
FT                   HRNLRDALTGGPADPSMITDLSSDVNKYHSILNSDAVKRTSLPVSGAQRHHFFILPGIT
FT                   DEGQFAYGTLLALREMSKYKQSSLDSWKESEWCKPPEVETWWDEEVKKGTEWYKEYCKV
FT                   TGFDPTDPSNKQRALSEWSSTISSRLRQKLKSEHRFQQSCNFPTLSVITEKDIDVALKF
FT                   GSYSEAENDRRIDINPQAMMHDWSILRLERENNPNVWRSPLPPIGSHARVLVHSNYSYS
FT                   GLPEVVTKLALPSTSEDLCKTSPEIYAMFDPENRDDEQSLQGVIDRATAAFSEFDRDIG
FT                   RSKQIKDGICGGTWQNWEQYTLDPQKKAQCLSAYTSAYLQNEFNQRTRDTNLGGSSQQP
FT                   YLTPQVLPVHGYDDYIWNTSLETGTFDPSFSGNSGIIADLVAEDVLLRARTIINGVTSQ
FT                   ATPEGAPPPYEYSEISPVRCEAGSSNLAASTQIPERGKSTKNDMLPSQSEETVSLPFRP
FT                   NDNDHTTTTSLSNEPVGRRQRWSSIMARKLLCGSSQNGDISD"
FT   gene            127888..128818
FT                   /locus_tag="CNH03415"
FT   mRNA            join(127888..128323,128382..128818)
FT                   /locus_tag="CNH03415"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(128210..128323,128382..128471)
FT                   /codon_start=1
FT                   /locus_tag="CNH03415"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S2"
FT                   /protein_id="ALO69504.1"
FT                   /translation="MYNFSETPSTEYYCSHCGFVYEASPRHPAEGEKCYKCKGVLYSKG
FT                   DDIKPEERQVIMFGGIYRGKGI"
FT   gene            complement(128839..130881)
FT                   /locus_tag="CNH03410"
FT   mRNA            complement(join(128839..129536,129593..129946,
FT                   130003..130089,130146..130881))
FT                   /locus_tag="CNH03410"
FT                   /product="transcription cofactor, putative"
FT   CDS_pept        complement(join(128997..129536,129593..129946,
FT                   130003..130089,130146..130406))
FT                   /codon_start=1
FT                   /locus_tag="CNH03410"
FT                   /product="transcription cofactor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45202"
FT                   /db_xref="GOA:Q5KD61"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD61"
FT                   /protein_id="AAW45202.1"
FT                   /translation="MSSLALPTIQPSQSHTPSPSAPAPSAPQPATSQRTRKRSTPPLEE
FT                   DSDEEEEEDKRRGTGPSKKKASGVWGWEDMGDYKYMVEIRQMMFVFGEVQTPLPETVKL
FT                   VEDIVRGQIIEIVTRARLLTHLRSSRFLSAEDLIFLIRDDRGKVNRLRTYLSWKDVRKR
FT                   AKEEAERAGEDIDLDVDEDKAMKGRKQMVKLPWELLTPFTSFLRSMPGKEEEDDEDDDE
FT                   LQAHEDSMQRLREADEITKKMTKNEYAQYSECRQASFTYRRARRFREFINFSAYLDVRP
FT                   NDDIVDILGFLAFEMVRSLCVTALDLRERLEKTKTTGGGEVGSTIGSAGTSAQKQDGNK
FT                   RSSAEPGAISQNKTPSSSNPPSLFAPPPSARQPLQPCHVLEAFAQIQRAQAANRVGGMG
FT                   NFRGGVGKKRMALV"
FT   gene            complement(133048..137320)
FT                   /locus_tag="CNH03400"
FT   mRNA            complement(join(133048..134377,134432..135377,
FT                   135436..135664,135715..135835,135882..136149,
FT                   136200..136349,136398..136662,136711..136820,
FT                   136871..137320))
FT                   /locus_tag="CNH03400"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(133180..134377,134432..135377,
FT                   135436..135664,135715..135835,135882..136149,
FT                   136200..136349,136398..136662,136711..136820,
FT                   136871..137123))
FT                   /codon_start=1
FT                   /locus_tag="CNH03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45266"
FT                   /db_xref="InterPro:IPR019350"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD60"
FT                   /protein_id="AAW45266.2"
FT                   /translation="MSFPPSVNHLVLPRTKRRNYNTHNNQTEYSEDNQFQDDVEEERDQ
FT                   VDDAVGVGGPTVEFGRQGGVSLQRKRGSWGWMWSVEDRQDLKWRTGKEAIHFFPATRTP
FT                   EIESDPEISLREVINSSVQYAEDLCLPYERDGLRDVITDILMEEHAAGPSGTSKQPAGP
FT                   LRKLEEDAFDETQIYQGSIVAVIQNSRGKSARTFVAFPTGEVGHHLNIAPFLATSTTRV
FT                   DKRSRFRFTPTVKPIDRFPTSILQICSSPMISPFRIDHDATALLVRTRTTTHLLNLHPS
FT                   LTPFSPYITSTRIAELSFSDTEDRRHVDVVLDPATWSRALVVDEGGGIWMWWEDKEIRG
FT                   GRLEKVMNLRKIRDKITDDKDQFFRISFGTQPGTALVLSSREATLIDIDNHDHPATSLI
FT                   TLSGFNRRFTFLEKTALERDSRYTTICTTHEVFWLDETGKGVPALGFRHEYGVTDIEAI
FT                   IFPGQGKDQMTTLLYSPSHPFITALATPKSDPVRFLTPPYALGLPLHRDMTLKELSYLS
FT                   LNSNRHPPSLIALDQEGGLWCIPLISSRNTRFGAIDSAEGREGQKQKQEIIPISAQWDD
FT                   EVSSLAAKREDREELGVGDGWLEKAQVAYKEIDLRWVWLAINEQDIKIFSPEPSVASLS
FT                   DTEGEGEEEASGELMTRNDWVTDDERESGEQDLDKEGGRENVGNEEEGAADSSLEEPGH
FT                   EGRYREGRGAIESDEATANAANIAAEEVEKDDDDGDESDWEDEEGEGEEDLKRMQCQGE
FT                   KTESWFRPEEFAQYLRELEAPMDGLVTGSELALDMCFPSASSLDEEQVRRWDDVEEDAP
FT                   LQTLTIHPYAIRSTLEGMDELVLSKFVPIIHTLHSGFPSFTESRPLLPLPYQRPFQLYR
FT                   FFLDSFPPSSLRDNLSAAQLALNLYLSTLIFSPSDYLPLAPAAHDRLIDAAAEEEQQGD
FT                   EVELFVQATSQLSLNDPAPPLIEFNVVKPTLAPVRPLYKSLNAVESGSEWEDVVEGDEK
FT                   GKEEKRMERLQTHIARTLIDDWKLGQDLTYWTWTPMGLEDTQWDPERATDPTRGDAPQP
FT                   MDGVSSMQKESDRRIRPLPGSRSHPSLSLSQPRSRVQPASPPRTSRSHPFSHLIPPSLS
FT                   TSHSMPSIPSLVQGPRSSPPPTMSQMGIVTSSQPEGENQNQEMGWASTQVERGKFGGKL
FT                   EKKKKNKKRLGGF"
FT   gene            138639..141371
FT                   /locus_tag="CNH03390"
FT   mRNA            join(138639..139004,139073..139156,139209..139311,
FT                   139378..139954,140019..140565,140642..140750,
FT                   140817..140957,141048..141371)
FT                   /locus_tag="CNH03390"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming), putative"
FT   CDS_pept        join(138762..139004,139073..139156,139209..139311,
FT                   139378..139954,140019..140565,140642..140750,
FT                   140817..140957,141048..141247)
FT                   /codon_start=1
FT                   /locus_tag="CNH03390"
FT                   /product="alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45200"
FT                   /db_xref="GOA:Q5KD58"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD58"
FT                   /protein_id="AAW45200.1"
FT                   /translation="MTTMSSDVPNSPTSTSFTGTFSPAATAANTAANARTRDAPSPTTS
FT                   SSGPKLETNKDQRLIVVSNRLPVTISKDDNGEYHFKMSSGGLVSALSGCKKTMSFTWIG
FT                   WPGKDIPMQDRETVNRRLLEEYNCYPVYLSDELADSHYNGFSNSILWPLFHYHPGEMNF
FT                   DSAHWLAYREANMRFADVVSSLVQAGDMVWVQDYHLMLLPMLLRSMITGESAQGEMVRQ
FT                   ELGRVKEGVDDTVVKEVLKMGPGVAQAEDEGVEMLDDVEEEGGEMDVKTSPKRPHYGRG
FT                   MSTFQKQELVAKEKGKEGIRIGFFLHTPFPSSEIYRILPVRREILLGVLQCDLIGFHTY
FT                   DYARHFLSSCTRILGLETQPNGIEFDGRYCQVGTYPIGIDPNQFIEGLQKESIVKRLRS
FT                   LEARFDGVKVIIGVDRLDYIKGIPQKLQALETFLTQHPEWIGKVVLVQLAIPSRQDVEE
FT                   YQDLRACVNELVGRINGRFGTVESVPIHYMHKSVPFEELTAMYALADACLVTSTRDGMN
FT                   LVAYEYISSQAERHGSMILSEFAGAAQSFNGSLLINPWDVQSTADAINQALTLSPQQRK
FT                   TNWQKLFNYVSKYTAEAWGVSFVNELNRLSGQRPAGPTGLAGRRKSGSLSRTSSKASMQ
FT                   RRKSSQSGIATGLGAAAGAAVNWAQAQVGTQT"
FT   gene            141783..145371
FT                   /locus_tag="CNH03380"
FT   mRNA            join(141783..141944,141995..142251,142325..142703,
FT                   142765..142931,142995..145371)
FT                   /locus_tag="CNH03380"
FT                   /product="glycogenin glucosyltransferase, putative"
FT   CDS_pept        join(142002..142251,142325..142703,142765..142931,
FT                   142995..144991)
FT                   /codon_start=1
FT                   /locus_tag="CNH03380"
FT                   /product="glycogenin glucosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45199"
FT                   /db_xref="GOA:Q5KD57"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD57"
FT                   /protein_id="AAW45199.1"
FT                   /translation="MSLPNAFVTLLTTSSYLPGALVLLHALQDLHPAPRDFQIVALVTP
FT                   ETVDAATIGELRRAGYDLVIGVEPIGSGKAGQVGLELMGRPDLNFALTKLHLFRLAPFF
FT                   STLIYLDADILPLRPISHLFTSTAPHVFSACPDTGWPDCFNSGFMVIRPRESDWDGLKG
FT                   MLKDGEGEDGLYREAGNGSFDGADQGLLNEWFSEEGGGGDWNRLSFTYNVTPSAAYTWA
FT                   PAYKRFGHKISNVHFIGPNKPWTSLPGRPAGVSNVKGKENSYDYLSLIDRWFAVYDKHV
FT                   RPASALDPDISRRFAVPQTIAAWDSHANRARAAATVLSEDKLELSELKAATERGVNAFK
FT                   PGQYTSLPLEGRVDLIMPKPKPVPRAAISQLAAASTVAPSVSPSALTPPPADAVPAPAP
FT                   APVLTQTEQQTAQPFVWDAQRSSPPASAPPEMSVPHTYYRNAWEAPLSQQSSYYAHPES
FT                   HQPQAEHKEPEYPTLPKEVTGDSWYARFATSTPDKRAVSAVFPWEEKTGSHGYGHGSRP
FT                   KPERVFPKGEEPLPPLVQQLIHPLQPPSISIQYATPTDSYQSQHPSHATGMGMAGQAQA
FT                   PKSPSPPPRHVSMVEAMASYKNVWDDIPQIGKYVDIMSGKTGGRSVRGLSTRGHGHGQG
FT                   HIQGHSQGQKQSQAQSHERNVSLQSLQSVPGTPRTQYSTFGKSPRLTNARDLERRGSLE
FT                   QPEDSADGDDENSTSASEEEGGKGGEGKSSKPYKGNRKYRDRWAQTDRVKTVDETVQTQ
FT                   THAGEEMAGGGLKMWGLPHASAHGRKSSKEIPFPSGSGNGRAGGGGQREAQTQHQSTYY
FT                   EYQQQHPHSQQPRQGSTASPSQKPELNARLPDYSFDFKGATSHAQGIAQAQAQAQSQAQ
FT                   GQGANSNLNAQHRHKPSGSFSTIYGGRGRVWDPNTDVEVRRRDSQEVLARFMQGNLGRG
FT                   "
FT   gene            complement(145810..148887)
FT                   /locus_tag="CNH03370"
FT   mRNA            complement(join(145810..146360,146429..146654,
FT                   146722..147971,148048..148887))
FT                   /locus_tag="CNH03370"
FT                   /product="ubiquitin-protein ligase, putative"
FT   CDS_pept        complement(join(145821..146360,146429..146654,
FT                   146722..147971,148048..148851))
FT                   /codon_start=1
FT                   /locus_tag="CNH03370"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45198"
FT                   /db_xref="GOA:Q5KD56"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD56"
FT                   /protein_id="AAW45198.2"
FT                   /translation="MAPSHSHPAHYRRPPSPLPDLGAPLFSLAPSASASASSRTARPHG
FT                   DTDSVQDVAEMSLESLTLSPPTTATTITTTVAPPTPTTPTSSSTAAATHPVATGGTAAE
FT                   YPETAAAGIATGAVFTGIGINPPTPAPSPGPHIRGFDDSDTHIREHLEQLLYHGDTTTD
FT                   PHGQNLDHVQVQAKPHAKPQAQGKTLPHEPYPSPSPAPTPTPTPQTVLSQYTSLPPLLR
FT                   SKFLNLLIPHLALHEALSLSRKIEPLLRRDFLRELPWEVALHVLSFVDDPQTLARAAQV
FT                   SRYWNTLLQDETTWRDLLARHHHRHRYASGGGIGISGRDPPQHARATSREGMEGMTGKE
FT                   EEEKGWDVGSGLGPPADPNAATSTNTNTNTNTSSRRGGSTSSSQAGTSKQRSKTRDNAL
FT                   GTGSGTKQACCIKRVTPFGLEKRVLNLSSGLTGLPPPISPFSPSPSPFPSPSPSSQHSY
FT                   KTRVKLAYLTETNWLTAGVLLAKHLSADDSVVTTLSFDETWIVVGMANSKIHVFSAFNG
FT                   GWKRSLEGRAAHTQGVWAMVLVSPPPRTATATQTATANQMQMQEQDMKRMRGTRGMGWY
FT                   GAQASASTSTSTSPNGWFGINPPSSYPHPQTQTQTQTQSETQENETPYQHGRENQSRGQ
FT                   DQGGNENEDEDENEGSNLCGSVRGWQGLKTSLVVSGGCDKQVKVWDVETGQCIHSLPGH
FT                   TSTIRCIKVLPHRPIAVSGSRDYTLRVWDIQRGRCLHTLRGHTKSVRCVEIWGNMAVSG
FT                   SYDNTAKLWNLDTGECLQTFTGHYSQIYSIAFNGSLVITGSLDSTVRVWSPTTGECLAL
FT                   LQGHTALVGQLQLSGSKLVTGGSDGRVIIFDLSSMSCIHRLCAHDNSVTCLQFDKRFIV
FT                   SGGNDGRVKLWDVKTGGFVRELTKPCDAVWRTSFRGERIVVLCQREGRTCLEVVSFRPG
FT                   EGERRGKGI"
FT   gene            complement(149007..150307)
FT                   /locus_tag="CNH03365"
FT   mRNA            complement(join(149007..149879,149943..150307))
FT                   /locus_tag="CNH03365"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(149180..149879,149943..150295))
FT                   /codon_start=1
FT                   /locus_tag="CNH03365"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S5"
FT                   /protein_id="ALO69505.1"
FT                   /translation="MPYSLRPRPAPLAELPLDSFLPERPSASPTPTGSTGPQRHQSASS
FT                   PVASSSKHPSPMHPHRRGIEPGDGMKSPVKKRTRTVTPRVKQVLDRDDLGVGKSPARRL
FT                   FATSVAQSSSHPSLGGISGAILTPPLNDTRATQNQTPIQNQYLLEDGNGNGEDMNIHDP
FT                   GFVVRRDPEGSVVGRPRTRSRSRSASPFPSSTLSELDIDNQENIPPPLLPSTSACSISI
FT                   PDTPHSQSGGSTSTSSRVDSYLCTFPSTVSPSSHHHWSPYSRSSHGHTPGSRKREQSKL
FT                   VNELLLLRGEDVPSKTQIKTRARTESESGHRHRKMEEVIIQDELTPGRRTTRGMARRGK
FT                   DLLAKEVDGV"
FT   gene            150486..152911
FT                   /locus_tag="CNH03360"
FT   mRNA            join(150486..150850,150910..151612,151666..152021,
FT                   152092..152911)
FT                   /locus_tag="CNH03360"
FT                   /product="metallochaperone, putative"
FT   CDS_pept        join(150508..150850,150910..151612,151666..152021,
FT                   152092..152621)
FT                   /codon_start=1
FT                   /locus_tag="CNH03360"
FT                   /product="metallochaperone, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45197"
FT                   /db_xref="GOA:Q5KD55"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD55"
FT                   /protein_id="AAW45197.1"
FT                   /translation="MPHPDLSIPLLPDADDLPLPHPHYTWPEAGPSSPRAAGFLGNVDA
FT                   EYAYTHRRRPPGETTGDARGRIRERQGNGQAGEDERDGDGDTGTDPSKAGLFGAKAIAA
FT                   MTGAMATSLLMTPFDVLKTRLQTVPPHLHPSSVAAALPPSASTVSPGSASAAAAAAADC
FT                   CQTTYSGAGTSIKPEHPLVCTHSSSVSIPSTKTGMDISSIRPSPSPSPSPPLASSSSLS
FT                   SGASTSTSASVNALRPPSGCLNPSKWAGIWGEPIPSGVPGGAGGVLVLREGPGVALGSL
FT                   HLGGAGGAGGSSSIGVKSLLSSMKSSTGAVSAGIGSTATGAGGFWKEMATVRAESGIRG
FT                   LWKGVGTAITMGIPSSAIYMLGYEYLSTIISPYFLDSSKPVYTTPASTSSIPEPESFGE
FT                   VDTVVFESLSTLSSASATSTAATTATTRTLTASLTPAPLIAGSLARTLSATVISPIEMF
FT                   RTRLQALPIPGRPSPTYTSVTKDMYRLVQSRGPIILYRGLGPTLWRDVPFSGIYWASFE
FT                   LLKTSLTSPDSPLPFSPLSTTLDLGPIPISFFSGFVSGTFAALLTQPFDVLKTRRQVFN
FT                   PTPGCVTDRQGGMIRVAGTVSLVRHVVKTEGWRALYAGTSARCGKVAPACGLMIACYEG
FT                   VGRLLGGE"
FT   gene            complement(153083..154190)
FT                   /locus_tag="CNH03350"
FT   mRNA            complement(join(153083..153586,153678..154190))
FT                   /locus_tag="CNH03350"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(153125..153586,153678..154085))
FT                   /codon_start=1
FT                   /locus_tag="CNH03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45196"
FT                   /db_xref="GOA:Q5KD54"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD54"
FT                   /protein_id="AAW45196.1"
FT                   /translation="MSQQDPEAQPLTAEDFEFEQSSSFQDTSRPVPSRSPYHLPASEQL
FT                   QGVANRIIFSRYYILFYGAMMGLSLATLVLSLVATRTFYHFVNNCENRMAANLVVAVDK
FT                   GECPSIAWHIIEFVLNALMVLEVTTRWIANGRKYPMTPLNIIDLTLVCFCVLTLLLVFF
FT                   NPCGSGTRNEELLDTILIVARNTVQFLRLGSILRRSGHSWLNPPKPIDLSQARDASRAL
FT                   DFDLDDEEDTERRFYGGGRGRSLLSGGGRRGYEPVSGEEEWMEGTGVRDNAGREQLSEQ
FT                   DQELWDRL"
FT   gene            155881..155952
FT                   /locus_tag="CNH03340"
FT   tRNA            155881..155952
FT                   /locus_tag="CNH03340"
FT                   /product="tRNA-Gln"
FT   gene            complement(156061..160958)
FT                   /locus_tag="CNH03330"
FT   mRNA            complement(join(156061..158091,158160..159172,
FT                   159253..160958))
FT                   /locus_tag="CNH03330"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(156228..158091,158160..159172,
FT                   159253..160320))
FT                   /codon_start=1
FT                   /locus_tag="CNH03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD53"
FT                   /protein_id="AAW45265.2"
FT                   /translation="MPYSFDATTAGRPNLAKRNTAPSPVTLLQLPSLEALPTPHKDRAR
FT                   RAASQSHLPSLEDSSIKPQSIFQKLRSKRPQSSLTAMPPLLKSRRPSSPKEQTSFFHFD
FT                   LTAMVTAFELRPKATRTNTSRSTKNESMPSSLLPGESFTPFSTPSNTYSMPSLAALPSI
FT                   QHVMDAYDITHSKNSMYQEKQQERVSKEQKKKKRETIKLPMMKPPPKLSNYCSKREELE
FT                   ILDGDDWEYDFLRDISTSLTQPPTPTVPTHSHNHRQRNYSIPVALDYTIRIPASQRDPR
FT                   SPNIRSHNSGSFEQDIGSFGTDRSHDIWLQNQVDTLEEVERGAVRELEQMSGRLMTDGW
FT                   GYGNGSASCRASGRANRASQPELPVTHSPLPPEPLTAPILVTETPTPQPQKHVSEHDQT
FT                   DKFRQRERSHIQGSNIISVPRARPVSEQRPPTKELLSTSPNVYSPVGRVGSSNSLGGGG
FT                   HGGSASAKVEREDKRCGSFTMYANTNIPLPPAPPPPTGVPLPAPPIGGVCVSQQVPLYL
FT                   AGADEKVEWSSGASAGAGVVGVKNQFKVSENDRPVEVTYEVLTNTRATLGLAAAAVIAP
FT                   PPIPPRSAERGYSGRKEIKRTTSNSYPVTHHAAHAIATAEPLHQQTTSSSIHDSQHDKL
FT                   ASVDGQGETKEQKGKLQTDGTAVNGLSLGMLKPKRASTGGKKRGDRDILLPKRQDSGSS
FT                   AQSQPIQKRPLPPIPIQPSSPGTSLISKHRRRPSTAPVPAPVYFSSPRSTDSHSHSNSN
FT                   SNPITPEKPRRLLPRDEPRLSLSPSSSTHTRDESFSHDRDRDRERKKVRQDLFAMGFLA
FT                   LDEMYLRQSLALAQQPPTPPMPSKIAFGAMGAAKGMVKGLKARVSNAPSMVSHSGFVTT
FT                   PPTHKVNGQKRESSAPQRKEGGAREEGDSLDFSVNDNEGWSRPTSAEAVYIMPPAERSK
FT                   IGSHEVDKKRSRHQSRGAEKAKQQKGEGIEDEFQGEFGSGSSVPGSEERSGEEGETSIG
FT                   MISLWGHGKEGRKEEWHTVKEYDSTKHLSLKLAQGRQAAQTMLFSLPTGTATHTKARPP
FT                   PIDVSSATIDGWKIKEIEKRGHRPSLLPPPRPRRMTASGQGRGGSTESSKGRPVSPLDG
FT                   VVDKRNTFFNLSRPSKPVIPDAAYSPLIQTPAQAVAQNYFPFIPANIIHTSAHDIPRRP
FT                   SDHASEHHQHLPQRQGQAHPFLPYSTPTTPKSKPRPHTSNSAHHSFTSLSLTLSSISAA
FT                   SDSTADKEKEEKERQRKLLMSAWLASKPVRRSKQEQAGETAPAALGGGGTAGEVRKEGR
FT                   PGTISAGMGMKRDEDAGSAYRRASLDNRRF"
FT   gene            complement(161416..162532)
FT                   /locus_tag="CNH03320"
FT   mRNA            complement(join(161416..161635,161696..162287,
FT                   162343..162532))
FT                   /locus_tag="CNH03320"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(161416..161635,161696..162287,
FT                   162343..162487))
FT                   /codon_start=1
FT                   /locus_tag="CNH03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45195"
FT                   /db_xref="GOA:Q5KD52"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD52"
FT                   /protein_id="AAW45195.2"
FT                   /translation="MPFGEITLNDGHRIPAIAFGTWKIPKEVTPFQVGQAIDVGFDHID
FT                   TAQVYHNEEEVGQAIKESGLSRNQLWVTTKWSGIDGKGARQSIGESLEKLGLEYLDLYL
FT                   IHSPQVTKGDIKGAWKELETLQKEGKTKSIGVSKQVYYQTIFFASLSDVWDSFNKEQLQ
FT                   ELLAHATVKPVVNQILLHPYVITRTAPLLEYLEEQNIVAEGYSTLIPLTSRPGGPVDKP
FT                   VNQIAERLNVKPEQVLLAWSRAKRAIPVTTSSRKARLEGYLDVGDITLTEDDVKAIDKA
FT                   GAKGELWFDCKARFEKVLIGAVFLIALIWLFKTYCRH"
FT   gene            162835..165793
FT                   /locus_tag="CNH03310"
FT   mRNA            join(162835..163054,163104..163200,163257..163374,
FT                   163439..163600,163659..164066,164132..164282,
FT                   164333..164706,164776..165062,165126..165139,
FT                   165208..165267,165359..165600,165663..165793)
FT                   /locus_tag="CNH03310"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(162941..163054,163104..163200,163257..163374,
FT                   163439..163600,163659..164066,164132..164282,
FT                   164333..164706,164776..165062,165126..165139,
FT                   165208..165267,165359..165600,165663..165678)
FT                   /codon_start=1
FT                   /locus_tag="CNH03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45194"
FT                   /db_xref="GOA:Q5KD51"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD51"
FT                   /protein_id="AAW45194.2"
FT                   /translation="MESVVDVVTTVFQAILAVNVVFTVGYAYNGKRASTLSKTLSALSN
FT                   NLLLPLLILTTFAASPSLTWKRLLQLWPLAIISLTTHAASLVASILSCRYFGAPGWAVE
FT                   SLTYNNVTSYPFLVVYALYRVSAVGGLNHLHWRIKDTTAEAFERATIYILTNFLITEFF
FT                   RKFLNPFIVQSGLMDKEQEDADENVEDGFYAETVEATVDEDATERTSLLSRAQQPDSTK
FT                   LAIIRTAHSPILLSAILGLTIGLVKPLQRFITGVGVEGSSGGWLWLAAGSALNAMGGSF
FT                   PLFAILATGAAMRAGEQPPSPEYKTPPTLGTVLLFGFWRYICIPAITLPIVKSFHKIPS
FT                   TKVFLQDPVFSFVLVLTVITPPLLPSHLSPFRSSVLFSTFYSSLITAVPLALAIGLFGR
FT                   GISYDLDFDLVSALKSAAGGGLAGAAAMVIQVLTLMPMRTIMNYQYRYGGGLKSAAVTL
FT                   YEDGGYRRYYAGLAAALFQGPLSRFGDTAANAGILALLSSLPWPVLVKTVAASVASACF
FT                   RMTLTPIDTIKTTQQTQGGGAGLRLIKERVRQQGVASLWYGALATAAATFVGHYPWFGT
FT                   YNYLQATLPLPHTIIQKLFRQAFIGFAASLVSDTSSNSLRVVKTYRQVHEGDVGYLTAA
FT                   KRIVEAEGWRGLFGRGLGTRLITNGLQGLLFSVLWKLFADLIAGK"
FT   gene            complement(165801..169781)
FT                   /locus_tag="CNH03300"
FT   mRNA            complement(join(165801..166024,166128..166198,
FT                   166286..166387,166482..166683,166766..167258,
FT                   167327..167465,167556..167632,167686..167745,
FT                   167806..167891,167962..168099,168166..168349,
FT                   168411..168513,168571..168745,168861..169001,
FT                   169057..169781))
FT                   /locus_tag="CNH03300"
FT                   /product="microtubule binding protein, putative"
FT   CDS_pept        complement(join(165932..166024,166128..166198,
FT                   166286..166387,166482..166683,166766..167258,
FT                   167327..167465,167556..167632,167686..167745,
FT                   167806..167891,167962..168099,168166..168349,
FT                   168411..168513,168571..168745,168861..169001,
FT                   169057..169077))
FT                   /codon_start=1
FT                   /locus_tag="CNH03300"
FT                   /product="microtubule binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45193"
FT                   /db_xref="GOA:Q5KD50"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD50"
FT                   /protein_id="AAW45193.1"
FT                   /translation="MSRFVRPSKYRHVYGSKSKVNYENVKISGSAWDTDLVAAGGKYLS
FT                   VNWQASGGGAFAILPLFSPTSPPQPAGFPTKLPDIVPLARGHTAPVLDTAWNPFDDNIV
FT                   ASAGEDGKIFIWKVEDSAFEGWGEDHWEPEDFNPALKLSAAGRKVGQVIFHPTSSNLLT
FT                   AASGDHLVRLWDISSGADEPKLVLKGHGDSIQSIAWNSIGTTLATTCRDKKLRLFDPRA
FT                   GSDAVRITDGHAGVKGSRIVWLGDRDRIATTGFSRMSDRQVSLWDTSSLKNLDTQSIDS
FT                   SAGVLMPFYAEGNDVLFLAGKGDGNIRYYEFEGDQLYFLNEYKTSDPQRGMTLLPRRAL
FT                   DTQEHEIARAYKLSGGCVEPLSFIVPRKSESFQSDIFPPANSAEPAQTAADWFTGKDVR
FT                   PNVVDLETGGVSASKEAVPTPTSSAPAPAPAHVSAPSSTPSPTPAPAKEEPKPATVHTP
FT                   SPPATSTPIPAPAAADVPIAVKKEIDTVPEITAKGLEIEQPEEPSEDEQEDKGPVEKVQ
FT                   DSLKSLTVGKEEPKTENNSVVAPSNTLLVKKLSPFATLPTRGSSLSAGYDLYSAEETVV
FT                   PARGKALIDSGLSIAVPEGTYGRVAPRSGLASKHSIDTGAGVIDADYRGPVKVLLFNYS
FT                   DADFTIQKGDRIAQLILEKIVMAPISEVEDLDTTARGSGGFGSTGGFGKAVKDVAGSLI
FT                   "
FT   gene            170428..173315
FT                   /locus_tag="CNH03290"
FT   mRNA            join(170428..170960,171023..171110,171171..171208,
FT                   171270..171433,171511..171670,171749..171891,
FT                   171974..172126,172216..172333,172420..172450,
FT                   172513..172597,172659..173315)
FT                   /locus_tag="CNH03290"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(170898..170960,171023..171110,171171..171208,
FT                   171270..171433,171511..171670,171749..171891,
FT                   171974..172126,172216..172333,172420..172450,
FT                   172513..172597,172659..173154)
FT                   /codon_start=1
FT                   /locus_tag="CNH03290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45192"
FT                   /db_xref="GOA:Q5KD49"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD49"
FT                   /protein_id="AAW45192.2"
FT                   /translation="MGEKLRVAIVGGGAGGLSALWVLNNFSQNEVHIYEKEDWWGGHAH
FT                   TVEFQQPGKEKCEIDTAFIAINSKNYPNFYRFVLDHSVELIKTTMSFSLSRDRGAFEWA
FT                   SNDLWSLFCQGSNFFKPRVYRMMWDIFRFHIFAKDLLSEEGESEQLSIGEYLDREGYSQ
FT                   SFKEDYLLPLTAGIWSIPPEKVALDFPAMALVRFFHNHQMLQLWGKPSWLTVKGGSSKY
FT                   VEKIIKQIPKEKLHLGEGVQAVVPQADGSFIVREVSGKEEMYDKVILATHTDQAVSLLG
FT                   ENISPEEKAVLGGCEWSANEAVVHYDEELMPIRKKAWTAWNYLTSTKPISPSHESKTSA
FT                   SAVNTISITFDLNVLQSLPVSKHGHIFVTLNPPTPPSPSKTLSRWIYHHPTLNPALLRA
FT                   QQQLPSIQGVRGLYFVGAWTGYGFHEDGWRAGMEVAYRPEFGVPLHKRPWEVRRVSGKD
FT                   VKKEMGEWALRPVIGTVDWGVKGLVTWASWTLGLYMSAIHVVAGRVIKEKKKVA"
FT   gene            complement(173491..175907)
FT                   /locus_tag="CNH03280"
FT   mRNA            complement(join(173491..173681,173761..173898,
FT                   173965..174705,174799..174911,174980..175153,
FT                   175224..175339,175432..175601,175686..175907))
FT                   /locus_tag="CNH03280"
FT                   /product="isocitrate lyase, putative"
FT   CDS_pept        complement(join(173544..173681,173761..173898,
FT                   173965..174705,174799..174911,174980..175153,
FT                   175224..175339,175432..175601,175686..175745))
FT                   /codon_start=1
FT                   /locus_tag="CNH03280"
FT                   /product="isocitrate lyase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45191"
FT                   /db_xref="GOA:Q5KD48"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD48"
FT                   /protein_id="AAW45191.1"
FT                   /translation="MSSEKAEFDAEVKAFEAFAKSPRFARTTRPYTAADVVSKRGTLPI
FT                   SYPSDVQAKKLWKILESKARGEGGGCTATYGALDPVQLTQMAKYLETVYVSGWQCSSTA
FT                   SSSLEPGPDLADYPSNTVPNKVAQLFTAQLYHDRKQRYTRSAALANGQDPGERIDYLRP
FT                   IVADADTGHGGLTAVMRLTKMMVESGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINR
FT                   LVAMRLQCDIMGTTNLVVCRTDSEAATLLSTNIDPRDHSFILGSTNPSLPPLNDLMIAA
FT                   EMEGKYGQELQKIEDAWTKQAGLKLWPDVLADALSKHGVSSKKITEFREQSIGTSHAST
FT                   LQLAQSFGLPPSATPYWSWDTPRSREGYYRYQGGTQCAINRAIAFAPYADLLWMETKSP
FT                   IYAQAKEFAEGVHKVHPGQWLAYNLSPSFNWEKAGLGKKEMKEYVWELGKLGFVFQFIT
FT                   LAGLHSNAYINDLFANAFSKEGMKAYVELIQSREREIGCDVLTHQKWSGADYADAMLMT
FT                   VTGGVSSTAAMGKGVTENQFVDDKTKDALHKL"
FT   gene            176107..179324
FT                   /pseudo
FT                   /locus_tag="CNH03275"
FT   gene            complement(179674..182256)
FT                   /locus_tag="CNH03270"
FT   mRNA            complement(join(179674..180264,180417..180527,
FT                   180696..180851,180944..182256))
FT                   /locus_tag="CNH03270"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(179842..180264,180417..180527,
FT                   180696..180851,180944..182233))
FT                   /codon_start=1
FT                   /locus_tag="CNH03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45190"
FT                   /db_xref="GOA:Q5KD47"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD47"
FT                   /protein_id="AAW45190.2"
FT                   /translation="MSKPKPGLGKGIGKGIARTLSVAHSTPDYALVPTWDPPEIVLAHP
FT                   ARLRHPPASTRLPIFRLSAIPRPYLSQPYSCPYPYSYSYSTLSTSPPPPAQPMPLSPDR
FT                   VLYSYPSLPPSTSIDVLLSALEINSHTSYTSLFNSSSIALDSSPSSSSPSSSSSARPNI
FT                   LPVPYSPAGPRDPPSPRSTQQSLKSRSLNSLSSSLDSSSSAPPPPGHSSGGGGGGGVTF
FT                   GAVIPPLATSDGGGLPSSSFIFHLGASGLAKDRPRTSSSSSSPARPSIPPRPRSFPLLS
FT                   IPSPPSSALRSISIGEDSYFTRPDGLCIADGVGAWARSGRGKADAGRWSALMTHFCEEE
FT                   VGNWWSGKDIYLRNPRGKGKGKGKERDKSSSVQSKESSGRGNDKSNVKGKGKSSAMEEE
FT                   VTEGEKERRPLDPVEIMQRGYEKCLSCAISEGINGSSTCLLALLHNSTLHVANLGDCCL
FT                   LLIRGGKVVFRTEEMQHAFNFPLQVGTHSRDEPMKDAMRFDVPVKKGDIVVVGSDGLMD
FT                   NMFDEDILEVLSQLSPSPSPSPSPPPPQPVSSSPQSPSPTHTHTHTDTHTLTLNPQKAS
FT                   EALCTRARQISETTTTTTPFMCAAIEEGIDFVGGKKDDISVLVGVVGVRSLKEVSVKDG
FT                   LEGVEEQGQAQGKEGGKERLMLYH"
FT   gene            complement(182369..185506)
FT                   /locus_tag="CNH03260"
FT   mRNA            complement(join(182369..182601,182672..182744,
FT                   182812..182946,183057..183456,183543..183691,
FT                   183769..184086,184160..184439,184523..184671,
FT                   184778..184857,184948..185091,185352..185506))
FT                   /locus_tag="CNH03260"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(182474..182601,182672..182744,
FT                   182812..182946,183057..183456,183543..183691,
FT                   183769..184086,184160..184439,184523..184671,
FT                   184778..184857,184948..185091,185352..185433))
FT                   /codon_start=1
FT                   /locus_tag="CNH03260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45189"
FT                   /db_xref="GOA:Q5KD46"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013180"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD46"
FT                   /protein_id="AAW45189.2"
FT                   /translation="MDIDKMFKLPALPSGGNKRKMGDLPNPETLKKYKPSEPQAASEMM
FT                   PPPPPGGLNGKGKGRAVTVEDDDVEAEYSRDVGEDVYDGEDDEEGRFFGGGLNREQEQI
FT                   LDIFDAAGEGEQGPALDLPALRRQIGKFQRIVLKNAEQRGKYSDDPSKFIDSESDLDTS
FT                   LKAFLPLTQNPPLFYPELVKSGIIPIFANLLSHENTDIAMDVVEVIQELTDEDVGGEVD
FT                   DLDHEEETGSETRMAMGQLIDELLNNSLLDLLVSNLSRLDESEDTDSQGVFHILGVFEN
FT                   LLSFMPPLADQIVEETALLQWLLQRIKKKEYDSNKQYASEIIAILLQDSRANVLKLGQL
FT                   DGMDVMLQVLSQYLKTDPGDSEEVEFMENVFDSVCSSLAQPEMKKAFFDAEGVELMVLM
FT                   MKEKRLAKTRAIKVLDYALQTESGSPACERFVQALGLKTFFSAFMSSASSKAGGKKSKS
FT                   KLGAAAATSAIEDEEHMLGILASLFTNLASDSPERIRVIAKFVEGGYEKVERLLEVREA
FT                   AEGRLGSVIKEIEYEREVMQANEEEITDVEETEWYLRKMDAGLASLQNADYVLAWVCME
FT                   DDGAMTHARLLLSRKNMNFKTIAAVLTEFKNNVGDNDEPNEEDGQREADDAVNTQKMIL
FT                   EHLIAFLEGL"
FT   gene            complement(185626..190456)
FT                   /locus_tag="CNH03255"
FT   mRNA            complement(join(185626..185890,185987..187393,
FT                   187476..188721,188779..189536,189629..190456))
FT                   /locus_tag="CNH03255"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(185736..185890,185987..187393,
FT                   187476..188721,188779..189536,189629..190352))
FT                   /codon_start=1
FT                   /locus_tag="CNH03255"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S4"
FT                   /protein_id="ALO69506.1"
FT                   /translation="MPPPENPPIDPFPPLRPTFSPVESRSASYAAVVRRNTNTNANTNI
FT                   NTNTDPSALTNTDTNTTGASSVERDTEERYSGESLSGRERVHPWRENIHPWRDRIMESS
FT                   GNGNQRDMDGGMGNASGRVDGNTSINANISATSSSSAHSDALADTNSQTNNPSAPFTLR
FT                   EMLRNVQASSPAPATSSPAWASAPGSSQAPASRSTSRIGINGLPHVRHYDFNHPIRDGN
FT                   GRNVGMIMRENDDRPSVSGLLSRMIDSSDSTSVSATAQNQSPNQNQNRSQTGAQTQSHD
FT                   QSAYPPLPFNRPSAARRGPPIITDGSNRYALGSTPMAQGQEQQRNHFGPIYPLPLRNTN
FT                   NTNINRDGNSGGNMTAAGEGDDNDVIVSFLPSPPRLFDSDGDSLHSLTDDEDDSNRVYE
FT                   DGGDGRELWDEVEWMREVLDGDHASGSGAGVGAGGAGARNERSFPLRRPGLGSAQADGP
FT                   TGQGADLQRGGFNRRRDYLDFLDHMVNLPNNSSIPSALHTHSHSHVQDLINDNLNTDPN
FT                   RNTTTNTNVGSIAEGQAHGVSRPLEYALNISRSSSRAESRAAGLSPTNLGPIQAGVEPP
FT                   VLVSSTSASSSRLSRGRRARSAGPDLDVDGRREGAEGGLSEDSPARKRSRTSASSSPSA
FT                   SSSLNGNTGSALSSSSSGASSSAQAQSRPRTGPARHFRPPYLSYSSLPIDTLLPLDLGF
FT                   PQPPSSAHLTLSSHIHRPSPTLSPASLAANTETETGTESKAGSGRRVARESENIPPRPN
FT                   IAPSDPRYPIIRPRITFSHPRPTRTDSDATSLMTTLPVPRGVGIFYWEAEVLAKGEEGF
FT                   ISVGWIAGLPTPVIIPEQKDSTNANVNASGSGSGSGSRTLNANTIPNTGGAGGHAGVPM
FT                   RNMRRLVGWSKGSWGWHGDDGRLFAGQGMGERFSETWGEGDIVGLGLDQTTSTLFFTKN
FT                   GKLVGSKTFPSLPSCCPPPPPSFSPSPFASHRHPVITKSTDTLLYPAVGLRSQGESVAV
FT                   NLCGPFKYDIEAHVREVKERMSKEVGRVEVKRVSSVVDLVDDQDIAGTNAEQAEGFEEK
FT                   CEGGKESEMKESIDTSRIGTPIHRISSATTPTSTTAPGPTSSNSQKLPPSAPLDPLRQT
FT                   TTAFVLDYLNHHGHTKAEGTMRRAIGERNWIGASTSSSSSSSSVSNTHISNLITSDNIP
FT                   MAKPNPTLQDFPTISSALLYLSNLIRKPFEERVPWPLWRELALLDEDSAQSREDMKGKG
FT                   KRKGKGKERARGNDIRNVKYEADKTDGMEREELELEGSLLVYDFLHAAMFSAADHDSIE
FT                   VDGEEGEREEQGADADARTIAIGRKIQKRLQRPSTSLPTSTSPAVLKPQLQADDWVIYA
FT                   KEAFGAIVNPQGYSTSERWAHWRERLATRLEVFLRQRRGLPQISRLETAIIQTNAVIHA
FT                   LAQKRPNSGAAFVDVKEALGLNEAKGK"
FT   gene            complement(192112..194460)
FT                   /locus_tag="CNH03250"
FT   mRNA            complement(join(192112..192649,192743..192992,
FT                   193087..193926,194031..194153,194245..194460))
FT                   /locus_tag="CNH03250"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(192538..192649,192743..192992,
FT                   193087..193926,194031..194153,194245..194299))
FT                   /codon_start=1
FT                   /locus_tag="CNH03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45188"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD45"
FT                   /protein_id="AAW45188.1"
FT                   /translation="MFIYNVHTPSKTFALIHKEDEPHQKLFDRIYTKAGLKEEDKSKTG
FT                   LVYEYKGSRWSLDDDEDLHILLSRYPPSSTPSVTLHLTHPSGGDASGHSYIQSQSQTRG
FT                   KALGKAPSQARATKSTGMNGTNQTLSQNESNDGDVLPPAYATSPTAKTTAATSTTPAAA
FT                   ATTPKAKTKAKSKSQAEKARAKSVLDSNTRANAQNLSAGTGSDTGFVRHGLEDETLSEG
FT                   TAFLAPAPKKKLEGEYHLASPVPPYTSDLPANPADRDGASSASAPGQSYPASAYVAGGA
FT                   ADRPKSRARSVYSTVSRKSKYGDPDAEPLGDVKRREWHEFHGNNGVRTVIGKVGDVPNV
FT                   RMLLKSGHRQIYLSRQFAIKHGFLPKKFGAANGGFAYAGILPLPGPITLTIGSRTSAHK
FT                   AYVTEENKFDVILGRAWIEKMGVKIDPLDQTILTYMDTGEPIACDVVVLKDEKGDIITI
FT                   T"
FT   gene            194701..196130
FT                   /locus_tag="CNH03240"
FT   mRNA            join(194701..194897,194965..195513,195607..195674,
FT                   195766..195838,195929..196130)
FT                   /locus_tag="CNH03240"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(194703..194897,194965..195513,195607..195674,
FT                   195766..195838,195929..195997)
FT                   /codon_start=1
FT                   /locus_tag="CNH03240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45187"
FT                   /db_xref="GOA:Q5KD44"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD44"
FT                   /protein_id="AAW45187.1"
FT                   /translation="MPFLRPALRARPLAALPRAAPPAALHTARPRLHPAGSKPPAPGGG
FT                   ERAPLSPEDDPKQGGKGFLGALFYGSKEAKAEGLIDPDPSKQAHSTIIGRGKYVHEKIT
FT                   HAVVPAHRAQYLASAEKYFTSMVQRNGELGGVKLMGSWESIVGDVGSFTHLLEYEGYKG
FT                   FDATRRAIAADKEMSSLQSDMLPHLISRQSQLLSEFSFWPSSPPHDSGYPDGGIFEMRS
FT                   YLLQPGKLLEWEYAWRKGLEARKRFVQPVGAFFSQAGQLHEVHHIWQYPDMETRKRTRD
FT                   QAWSVGSWADTVRDTVKLAYGMKSTIMVPCSWSPIR"
FT   gene            complement(196141..199565)
FT                   /locus_tag="CNH03230"
FT   mRNA            complement(join(196141..196978,197076..197846,
FT                   197904..198278,198319..198459,198505..199466,
FT                   199534..199565))
FT                   /locus_tag="CNH03230"
FT                   /product="arsenite-resistant protein ASR2, putative"
FT   CDS_pept        complement(join(196328..196978,197076..197846,
FT                   197904..198278,198319..198459,198505..199461))
FT                   /codon_start=1
FT                   /locus_tag="CNH03230"
FT                   /product="arsenite-resistant protein ASR2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45185"
FT                   /db_xref="GOA:Q5KD43"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR007042"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR021933"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD43"
FT                   /protein_id="AAW45185.1"
FT                   /translation="MSEPAEQTSPKPGFTRGGFAPIPHRHSDIAPLPSTTSPTLAMALS
FT                   PSRVEWERGRGKERELPRRELDPEPEDRERRREWDEYPPRRESRGHWEDDFDRPKRRRS
FT                   PSPLGPSHRPRLNSPSPPPPRFNIPDPASIETLLPFRTFAEWFRTSHPQTARVDEEETR
FT                   KHKEMIESGQATEQEAKEKVGMAKRYERYRKEFTSRQLYALFLTHRDSAWFKEKYLHFP
FT                   EYVALRRRLNRQGRIPQVAQYISELRSGAHDHVSYDQIEDVPGVKLDEDEPEGLNRALG
FT                   DKGEWGEDGAVRVEIAPRTKQVFVKTVPPNCSRKALEDLFSRVPGFQWLAISDPSQKRS
FT                   FHRVAWAQYAEDTDVSKVIEQLDSTKIEGFTFHLTINTTPTIGRVRIAPLSVSNLDRLL
FT                   LDGTRAKSLALKLEEELLGDDEESVVEGEGEKTKPEGDVKVEDEAAEEKPKVAKSLGLS
FT                   EKGSDVVEEIIMKMVEERGLTGEDLDEEQKVQKAKITLDQWIAYLRHGLSTCYYCIAPC
FT                   AFMEELQRKCIAHVRAHPSSSTAEHEHEHEHEREHDTEEHARAEVEDVVKSEVVDGADG
FT                   GTELKAEVEVEKEEEEKEAEGEEVGKEVNDDDREMREDGQDQSKTLPAAHPSNAAANDR
FT                   SDRERERKSRKNTFPQKTAEEKWIESHDLRIAPLLIPSAALNLPEEEGGLRLGDYGGRD
FT                   PEEELKKLCAPLIKQEEQSKYRCKECNKLFRAPEFVIKHITTKHTDVTQGRIDDVLYLN
FT                   NFVLDPQHIQPSVSTLAAIDDKLPASSSNPLNPSHPSSLPLNPFDPSVAGAAFNHAQMN
FT                   GMPMSMGMGMNPGGGHGTPSGQGHGQFNLMQQQMMMMLQMQQAMMMGQMGMGIGTGMGG
FT                   GTGGGVNASPMAAGSGAGVGAGGVGGGGGAMSTPSRGGGQLAGRMGGYAPSPANLAPLP
FT                   PPPPGGEDPRARRGRVSYQDLDEPGAGGGGGLPY"
FT   gene            complement(200117..202288)
FT                   /locus_tag="CNH03220"
FT   mRNA            complement(join(200117..200972,201033..201068,
FT                   201126..201161,201238..201339,201422..201428,
FT                   201482..201529,201609..201729,201861..202288))
FT                   /locus_tag="CNH03220"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(200389..200972,201033..201068,
FT                   201126..201161,201238..201339,201422..201428,
FT                   201482..201529,201609..201729,201861..202138))
FT                   /codon_start=1
FT                   /locus_tag="CNH03220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD42"
FT                   /protein_id="AAW45184.1"
FT                   /translation="MSSLHHLVPLLFLIAPALSQYTATYSPYSLPETTEQGQYGTNACG
FT                   TSSSQDSKCQNVYVNGVDDFCLWGPPETTSNEGDGTSKIGNVEQIVVSYCLKDGYGTRL
FT                   IPPGSITGAHFVKVLSEKVSYVQVTGVGDLTKLLIPAGDDGGELDPHSWTGLGNPQGGL
FT                   VFTNAFTGSYEQTHEWTSFMSADEFCIRACRDGDNAAAYCQHIYDVLSCSFTIPGDMSP
FT                   GFDSCLGEPTEEAPGVYSGSTFRQGDPTTPAPHPAGATSECQVYSSVGGGNANIGQGAV
FT                   VSAATTTRSSSSAEETNSPSSISAIDSTTSYTSYTSPSNTTVFASATSTLSNLSTVATT
FT                   TTIITSASSSSVPSFSSTSSSSSNAATTTALNNAQSNGYPKAIEGMGIASVCIAGMFAF
FT                   SFFI"
FT   gene            203633..209557
FT                   /locus_tag="CNH03200"
FT   mRNA            join(203633..203868,204048..204103,204192..204263,
FT                   204395..205908,205968..206134,206186..206325,
FT                   206385..206489,206542..206617,206681..206761,
FT                   206813..206908,206971..207213,207271..207481,
FT                   207534..207605,207658..207762,207823..207918,
FT                   207973..208179,208229..208319,208371..208387,
FT                   208451..208543,208595..208675,208720..209025,
FT                   209085..209557)
FT                   /locus_tag="CNH03200"
FT                   /product="expressed protein"
FT   CDS_pept        join(204439..205908,205968..206134,206186..206325,
FT                   206385..206489,206542..206617,206681..206761,
FT                   206813..206908,206971..207213,207271..207481,
FT                   207534..207605,207658..207762,207823..207918,
FT                   207973..208179,208229..208319,208371..208387,
FT                   208451..208543,208595..208675,208720..209025,
FT                   209085..209369)
FT                   /codon_start=1
FT                   /locus_tag="CNH03200"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45182"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD40"
FT                   /protein_id="AAW45182.2"
FT                   /translation="MDPDLEDIGFSFAKPDCAPKNSFESIRSMKPFLPSNSNAASNNYT
FT                   RLPGRNTGSDSSSSAATIAARPHGMFPSFRFQNAHPLSQSILPENSHSPSSVSTGAVTA
FT                   ASADGVVASKSPSATAPETPNVKGKASTPQLPFGGPGRRLLPTESAPFQTPTSSRTPFA
FT                   SKGFSPAQTNLAPEHQSYSSLSLPFSTPNPAKQGNQIMSGANTHKVTMATENPHRHSRG
FT                   WAEPPMKDRAKDEELFHREAREEDKEVTMEVEDGQTYEQDNEDGTLEVEKRETYESTIR
FT                   QDEMEEDRRNAYNMGRREERTEVATGQQSHPSHENNGQDIKATSRHDLYQDESHEALYP
FT                   ESLPSQIADSGLPSFRRDAHNSSELLGHGPSLPPAQRHCHTKHSSYKTPDRPPPSSTFC
FT                   SLSNPKPVPRSMSFLEGVSNHDISGCATAMFKPSVPPLTKQQQKKDNDVDQGRSTLPKT
FT                   TADLRVELEKGGGSEQMLLMMLQTKNGEIDNLKDEMFRLQELIGAKQSLNDDLAQETKR
FT                   LEDIYKQSEQIWKTSIGNAKKWRDTIKQKEMSKNQALKELKDGYDEQSHTYSEALASLS
FT                   KEFIAFREESMTKTKEDLEVHSSTLANIRTALQSVKEDLTANSNAVEELQNTKSLNAHL
FT                   EDEMKAKNEELSFARNQASELQDKLKTFEETLAPNLERMMGDMIQVKASASTNSQALEA
FT                   ALLAQKELYEELSEKEKENVALRQESQEIRFVRDNLDSQLREAANYYHALGCEAKNLKD
FT                   MVQELERKHKEALQKGVAKTETVEREWKHKLELADTHVSNLEKSLSSIKADAHLFAQRA
FT                   VQTETDLKADLVARSSEGQARIHSLEKELKVAVTERDKLIRSLDETRAREQTLKDKITG
FT                   LTQSTKESQLQLQGAQASLQDARKQGHILEDQVKSLIKQLESRSQKSESAMKFDDHFKR
FT                   LQIKLEELQSTQGNILELERAKAEVIHKQSRIQDLQKSLNESHSTIEDINNDIRRLRLT
FT                   IDQITEENGRLKIEIVGRGQSGKELVERWERDELNAEEVVLVQKITQQIRRGEQAICRQ
FT                   ELDEKSNAVRKLESRCKKLEAQISALSHGRMTSNLTTPSALSRITHEAASLLSSPLSNP
FT                   PTSSTAASHITVHSSSDSPNRPSAKSASSPLAAIAVSHKPSVESAVNLAPTANSNSTAA
FT                   NSKKRRLLDSQDVDDSEESFGHEVMIDEIFANVDEALLNHPSLTQGPAKLQKKTRFAEI
FT                   IEHSSPSPDSQPEDADDPIDPPTSQPQPNLHQLAPPPPSQVTKTYARNKGAMRARPSLE
FT                   NVTTNSGNASGATGYEKGNRKLRGGRKSY"
FT   gene            complement(209587..211648)
FT                   /locus_tag="CNH03190"
FT   mRNA            complement(join(209587..209794,209865..210154,
FT                   210228..210286,210347..211009,211098..211423,
FT                   211508..211648))
FT                   /locus_tag="CNH03190"
FT                   /product="ARF GTPase activator, putative"
FT   CDS_pept        complement(join(209759..209794,209865..210154,
FT                   210228..210286,210347..211009,211098..211423,
FT                   211508..211573))
FT                   /codon_start=1
FT                   /locus_tag="CNH03190"
FT                   /product="ARF GTPase activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45181"
FT                   /db_xref="GOA:Q5KD38"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR038508"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD38"
FT                   /protein_id="AAW45181.2"
FT                   /translation="MDPTKAQTTATFAHLKAQKANKQCFDCHAKNPTWSSVTFGIYLCL
FT                   DCSSVHRNLGVHISFVRSTNLDSWSIQQLRTLKVGGNASCAEFFNKNGGGNLLAPQSTD
FT                   ARARYTSRIASLYKEELAKRTQDDAARYPHGIHIDGLELTPLASPAKAAATDDDFFSSW
FT                   DKPTSKPATPAASAQAATVPSIGLTRAPAPRTVTSSSLRSSTTSAPSSRPASASRLSSS
FT                   TTTTTGAAPKVSKLGASKLGAKKAAAPIDFEEAQRKALEEEERAKQLSAENKKKEEEAA
FT                   KAAREREAEEAKKAKAAAAAAASANASVGSSRSGTPANGAAKKSVVNSAPVPGRLGFGQ
FT                   TVGVAAPAQSKTRAAVADDVRTARDKFGNQKGISSDMYFGRGTYDPSAAAEAQTRLRDF
FT                   QGATAISSNAYFGREEENEEEGGLGGDGGMGGDDAIAGLERGIRDMAERVLANPEVQQF
FT                   GDQIRAGALKLSDYLASFEGR"
FT   gene            complement(212095..214548)
FT                   /locus_tag="CNH03180"
FT   mRNA            complement(join(212095..212484,212645..212863,
FT                   212943..213122,213190..213219,213278..213318,
FT                   213381..213696,213762..213918,213988..214548))
FT                   /locus_tag="CNH03180"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(212258..212484,212645..212863,
FT                   212943..213122,213190..213219,213278..213318,
FT                   213381..213696,213762..213918,213988..214113))
FT                   /codon_start=1
FT                   /locus_tag="CNH03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45180"
FT                   /db_xref="GOA:Q5KD37"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD37"
FT                   /protein_id="AAW45180.2"
FT                   /translation="MTAVQAPVSALHDSFNSLTIDSGLPGGPRTVTKRQLTEEEKQAKI
FT                   YGTSYEPSIEWWTANNKSYIKPADDPLPDGFPEQDNSSSAWDGKILINQPEKWLYRFTA
FT                   DDIALLETAYQHFVSLSLTKNDISRETFPIPTDSTLYKELRKSEYEINNGVGLRVLRGL
FT                   PVDDWEREKQLIIFAGVSAYVGERRIKQGIQNVVHLRDITTLDVDKRPAITVKGQTSGN
FT                   QVFHNDGSVGIVGLITVGVAETGGLSQLSSVANTYNQLARTRRDIIRELAKGDWVTKQF
FT                   PEGKPLFFAHENRVISSYSRRPFFGFYEADPDVPTLTKEKHLALDAVHFTAEKYSLDLD
FT                   LQKGDLEYFNNLTVYHARTASTDSDKNARHLIRIWLENKDQPLPAQLRTLYAKINAGQG
FT                   KTWPLEAWDTNPYLPTESAEEEKKEGEGASYD"
FT   gene            216336..217978
FT                   /locus_tag="CNH03170"
FT   mRNA            join(216336..216747,216797..216974,217032..217308,
FT                   217375..217557,217612..217978)
FT                   /locus_tag="CNH03170"
FT                   /product="Inositol oxygenase, putative"
FT   CDS_pept        join(216711..216747,216797..216974,217032..217308,
FT                   217375..217557,217612..217872)
FT                   /codon_start=1
FT                   /locus_tag="CNH03170"
FT                   /product="Inositol oxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45179"
FT                   /db_xref="GOA:Q5KD36"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD36"
FT                   /protein_id="AAW45179.1"
FT                   /translation="MPVAVQEFVRSDDPAGTKFDTISDAVDDINVAKLKAQHKDNAYEE
FT                   SKFDSEKEKETFRQFVDSNESSRRFYIEQHTKQTVEFNIEARRKAFEKPRATMGVWEAM
FT                   ELLNTLVDASDPDTSATQIQHLLQTAEAMRKDGKPEWMQVTGLVHDLGKLLYFFGSDGQ
FT                   WDVVGDTFVVGCEIPTEKIVYSDTFGANPDVNHPVYSTKYGMYKPNCGLDNVMISWGHD
FT                   EYLYMVCKEQSSLPKAALHMIRYHSFYPWHRERAYTYLENEADKEALKDVLAFNPYDLY
FT                   SKSDSLPDPVALRPYYEGLIAKFFPEKINW"
FT   gene            complement(218893..220564)
FT                   /locus_tag="CNH03160"
FT   mRNA            complement(join(218893..219109,219162..219685,
FT                   219732..219835,219874..220246,220301..220564))
FT                   /locus_tag="CNH03160"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(218999..219109,219162..219685,
FT                   219732..219835,219874..220246,220301..220490))
FT                   /codon_start=1
FT                   /locus_tag="CNH03160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45178"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD35"
FT                   /protein_id="AAW45178.1"
FT                   /translation="MRAHLQRLVSRRPTLSRPWTLSRSLTGFPPAVGPSPQAAVRVQSR
FT                   SRLMDPFSPEELNRFTQICGQVTEQSDYPLSSEIAHNAVVYSGDQLRKFITNGSQSRDD
FT                   IMAEIHKCLATGPGVLVIRKFVKDTDLIQRTNSVLSKIIEREREGAKGDHFSAAGNNDR
FT                   IWNSFQKHAIADPRSFVEYYSNVLLDMVSEAWLGPGYQLTAQVNVVRPGGKAQEPHRDY
FT                   HLGFQSERTASRFPIVSQIASAMLTLQGAVAHTPMPLASGPTQLLPFSQQFDHGYIAYR
FT                   QPEFVDFFHKHMVQTALDIGDAVFFNPALFHAAGDNKTKDLHRIGNLLQVSACWSKPME
FT                   TVDRNAIIRATWSDVKDYIANTQGGIDSPSSQALLKAICDAYSFPTNLDKDPPPADSHC
FT                   PETQLDRVTRGVAEKWSDDSLNQALDELAAKRAA"
FT   gene            220732..223827
FT                   /locus_tag="CNH03150"
FT   mRNA            join(220732..221039,221099..221263,221325..221410,
FT                   221472..221716,221773..221787,221842..222128,
FT                   222176..222319,222373..222492,222543..222635,
FT                   222690..222718,222769..222980,223049..223827)
FT                   /locus_tag="CNH03150"
FT                   /product="L-mandelate dehydrogenase, putative"
FT   CDS_pept        join(220902..221039,221099..221263,221325..221410,
FT                   221472..221716,221773..221787,221842..222128,
FT                   222176..222319,222373..222492,222543..222635,
FT                   222690..222718,222769..222980,223049..223182)
FT                   /codon_start=1
FT                   /locus_tag="CNH03150"
FT                   /product="L-mandelate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45177"
FT                   /db_xref="GOA:Q5KD34"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="InterPro:IPR037458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD34"
FT                   /protein_id="AAW45177.1"
FT                   /translation="MQSGLHAFRRTLLRSLRPSHKAYSTHAHAKRSWVLAGTTAVAVSG
FT                   LTLVFSAGFGNLTLLEDETRNPDQPKRTVLAGGQELISYDEVQKHATRDDCWVIIDGMV
FT                   YDVTEFLSQHPGGAEVILRNAGKDATRIFKPLHPPDALDILDESQRLGPIDPLSVPELE
FT                   EVETEEDKRIKEARKSLPPVDTMLLLQDFEDWGQQVLSGTAWAYYRSAADSENTFHENT
FT                   DAFRRYWLRPRILRKVAQGDTKTSFLGIDTETPIFISPAAMAKLGHPLGEVNLTRGAGR
FT                   AGIVQAISANASCGLDEIMEAREEGQKVIYQIYLNKDRKASEVLLQKVEKLKPAAVMFT
FT                   VDVPWQSKRTMDTRAKNTVNPPIQDTAGSEKKSRAPLGVSEAIGGYQDRDLSWEDIAFI
FT                   RKYISVPIIVKGVQSVEDIELCVKAGAEGVLISNHGGRSCDYAPAPIDILYELRCHRPE
FT                   LFNQIDVLIDGGVRTGADVVKALALGAKAVGVGRPFLYANGTHGQEGVERVCEILQEEI
FT                   TNTMRNAGATKVSELVPEMCGLAGPWVGGNRPPYAPKI"
FT   gene            224007..225722
FT                   /locus_tag="CNH03140"
FT   mRNA            join(224007..224120,224177..224494,224557..224809,
FT                   224872..225045,225096..225486,225553..225722)
FT                   /locus_tag="CNH03140"
FT                   /product="expressed protein"
FT   CDS_pept        join(224301..224494,224557..224809,224872..225045,
FT                   225096..225486,225553..225677)
FT                   /codon_start=1
FT                   /locus_tag="CNH03140"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45176"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD33"
FT                   /protein_id="AAW45176.1"
FT                   /translation="MTPVQVTAERLATIPIGNCIQCLGSHPNHTLERKFEALQKGGWKH
FT                   TEFSFAEYFKWVRQKEPNSVPNVDPETYGDAEAEAGEEEAWEALYRHAPEAKALATKHG
FT                   VKMWSLQCLGQVDSWPAGSKREIRGREKAVHWLELCSRLGLEFCQIGVNDQYDAVAPFE
FT                   KTVQDLVWIADQAAARGVKVAYESWNFAPKNNQWEATWAIVQAANHPSLGLCIDTAQCA
FT                   LAPAYGFDPTSGRGFTPVAVQALLERLASVPGDKIFFVEISDVLAPQPALLCGSPFDQW
FT                   HLDQGPGYRTGFTWCRCARVIPHIGRGTGKLVQGEKGLGAGRTAEIVKAILSTGFNGPM
FT                   FYECFEVAEQEKPDLSIPDELVQASVLSWERMSKAILS"
FT   gene            226737..228635
FT                   /locus_tag="CNH03130"
FT   mRNA            join(226737..227043,227104..227201,227257..227371,
FT                   227433..227544,227606..228033,228091..228149,
FT                   228211..228290,228340..228635)
FT                   /locus_tag="CNH03130"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(226957..227043,227104..227201,227257..227371,
FT                   227433..227544,227606..228033,228091..228149,
FT                   228211..228290,228340..228461)
FT                   /codon_start=1
FT                   /locus_tag="CNH03130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45175"
FT                   /db_xref="GOA:Q5KD32"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD32"
FT                   /protein_id="AAW45175.1"
FT                   /translation="MTIEIPSSNRKARIGVMGVGRMGKRHARNIAEFAPRAELVAVSDP
FT                   YPEALEWAKANLPSTVKTYSSSEELINDPDIEGILIATETAFHAEYAIKVIEAGKHALI
FT                   EKPISVDIELTKPVVAAAKKRPDLKVMVAFSRRFDASYQEAAKRIEDGQLGSAYLIKSC
FT                   TNDLYDPTGYFLNYAKKSGGIFMDCGIHDIDIGRYLLNVGNTDGLKNPAKQVSKVFATG
FT                   LNTVYPELAEMEDCDNALGIIEFENGSKLNIHLSRTSIHGHDVVCEVFGTKGKFVINAV
FT                   PNISRVEIRDEHGVRTESHPSYYERFFEAFKTEVQTFSSCILDDTPVPTPPHDALEAAQ
FT                   IATALTHSFRTGNPVYFDDNGEPILK"
FT   gene            229742..231779
FT                   /locus_tag="CNH03120"
FT   mRNA            join(229742..229819,229872..230275,230334..230431,
FT                   230493..230607,230661..230772,230832..231259,
FT                   231326..231384,231444..231523,231577..231779)
FT                   /locus_tag="CNH03120"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(230189..230275,230334..230431,230493..230607,
FT                   230661..230772,230832..231259,231326..231384,
FT                   231444..231523,231577..231698)
FT                   /codon_start=1
FT                   /locus_tag="CNH03120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45174"
FT                   /db_xref="GOA:Q5KD31"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD31"
FT                   /protein_id="AAW45174.1"
FT                   /translation="MAISQGNSNGKLRIGVLGVGRMGRRHASNVAYSAPRAELVAVADP
FT                   SQEALAWAKANLPSTVQYYSDSADVIQSPNVDAVLISTETSEHARLALEAAAAGKHVLL
FT                   EKPISVDVDLSRPVVEAAGKHPELKIMVGFSRRFDASYREAKRRIDEGTVGKPYLIKSC
FT                   TNDQYDSTGFFIAYSKASGGIFIDCGIHDIDISRWLLDVENPANLKYPKKQVTSVWATG
FT                   LNAQHPELASYGDCDNAICVVEYENGTKCTFHLSRTAIHGHDCFCEVFGTDSKLIINGN
FT                   PNMNRVEIRDIHGVRMESTPTYYERFRDAFISEVQTFCDVVLDDKPVPTTPQSALEAAK
FT                   IAMALTHSFRAGKPVYFDNEGEAIIN"
FT   gene            complement(232216..235223)
FT                   /locus_tag="CNH03110"
FT   mRNA            complement(join(232216..232340,232393..232503,
FT                   232560..232599,232642..232730,232789..233200,
FT                   233253..233429,233479..233628,233681..233690,
FT                   233749..234734,234810..234955,235044..235223))
FT                   /locus_tag="CNH03110"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(232242..232340,232393..232503,
FT                   232560..232599,232642..232730,232789..233200,
FT                   233253..233429,233479..233628,233681..233690,
FT                   233749..234734,234810..234955,235044..235082))
FT                   /codon_start=1
FT                   /locus_tag="CNH03110"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45173"
FT                   /db_xref="GOA:Q5KD30"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD30"
FT                   /protein_id="AAW45173.2"
FT                   /translation="MPILTCDQCRARKVRCMPPNEAGGPSSDRTRLRQGSKCLNCDRRK
FT                   EDCTYDYTPKKTGRPRAGTSSRRAPSTSSNVSRSRRSISPSASGLRQNSVQARSFNPRQ
FT                   IPSPRARISPSLASHPDHFRKSPPTASQTAALRVRHSTPNIHHSGPPEDFNFLVDDRSF
FT                   INPPVVESLYDSFRHLLGTPLPLSFDFTVPSEAEAQSSGQATAQAGSKHPHAFPETRDV
FT                   TENDPLKDPDPPISQPPGLPFGSQGLSVSPTSQTVGQSLEGDGVSILGPSPSQVPWSGI
FT                   GQSPFTNDSHLPNGLQSLDFAGSCSSGIPSVDLQGMLSGDGRTEWLGNSRVIPTIESVA
FT                   SWDEVGFFLSLYLKYQHPLLPLVHRPTFAQDVLHRRDRIDEAFRGLLLSIVAYTICHTN
FT                   ASMLEQRMDRARQETLFRRCQRGSRMIQIRHQMKPSLVILASTILDWITSQSASAENLP
FT                   ENLISDVRRLVYSLKLNQASPRGMKDLLEVEMCRKLYWVAYDIDKTNAMYLNPVAIQDS
FT                   DGVPPLPLEVDDDFITRDDMLLVQPGQQHSYMVGFNCVNRLFQILSQCMLRQRLLNSTP
FT                   SFGFNVWAHGEWVQGAMNELRQILADLPPQLRPEPGSGGDSSTSFNETQAANICITALC
FT                   VEMALLDLKVRFSPDVDIRQDRQSIAQRVFQQLQSIPIECLARNGESMRGKVAHVVLSL
FT                   LDASQDTSVTQEDSKMGESLWNWWNMYSRVLCLQVIPDRPASAVPTRPGTPETRRSFL"
FT   gene            235550..238013
FT                   /locus_tag="CNH03090"
FT   mRNA            join(235550..235966,236023..236145,236240..236432,
FT                   236489..236558,236614..236957,237013..237217,
FT                   237290..237406,237462..238013)
FT                   /locus_tag="CNH03090"
FT                   /product="sugar transporter, putative"
FT   CDS_pept        join(235656..235966,236023..236145,236240..236432,
FT                   236489..236558,236614..236957,237013..237217,
FT                   237290..237406,237462..237838)
FT                   /codon_start=1
FT                   /locus_tag="CNH03090"
FT                   /product="sugar transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45172"
FT                   /db_xref="GOA:Q5KD28"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD28"
FT                   /protein_id="AAW45172.1"
FT                   /translation="MVKTHAPDREHIPPLSNFDIDLHPDTVGYVQDSQALADAIGSNGL
FT                   KDVFASPIVFMAAFSACMGGLLFGFDQGILSIVLTIPQFLKVFPETDISVTSSAGLNKG
FT                   VMTALLELGAFLGAMQAGFISDKISRKRTIMVGACWFVVGSALQAGSKSFAMLVIGRFI
FT                   GGIGVGVLSSTAPTYISEIAPPNVRGAFLALEGSSIVIGIVIMFYITYATRHILDSWSF
FT                   RLPFTVQVVPCIALGIGLWLLPYSPRWLATVGRDQDALDSLVRLRQLPSTDPRLQAEWI
FT                   TIRAEAIQQREVVINAHPHLQGESGFVQDFKLEMHAWIDMFKPNIIARTMIGVMLMVFQ
FT                   QLQGINALIYYSPTLFEQLGLDYEMQLTMSGVINVSQCVATIVAFFLLDRIGRKPPLLI
FT                   GSVVNAICHFTVAGLIAKYSDNWAAHQSAAWAGVGLLITFMFFFGIGWSPVPWALPAEI
FT                   HSSSRRAKGVAITTCSNWFFNFIVGLITPPMLQSIRYGTFIFFGAFAVMSGIWAWFLCP
FT                   ETKGLTLEAVDQLFHNHAAQEELRQKHDIISRMIGMELTTTPQPELVDDEKKIYTVQHL
FT                   ESV"
FT   gene            239034..243607
FT                   /locus_tag="CNH03080"
FT   mRNA            join(239034..239542,239593..240710,240762..241289,
FT                   241355..241693,241742..242299,242355..242575,
FT                   242643..243141,243201..243607)
FT                   /locus_tag="CNH03080"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(239942..240710,240762..241096)
FT                   /codon_start=1
FT                   /locus_tag="CNH03080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD27"
FT                   /protein_id="AAW45171.2"
FT                   /translation="MYLDAGYQMFHLLRALAVCGTRFARVWTLSDHPEGRTFAVETSRP
FT                   LGNSGPMVAADFFSQVNLDLFPHNLIIPSPSMDSFAVDYRKCELLERTLSRVCDSILSH
FT                   TIESALQPRYEGTFDHGTEADPSAFTTQLLRDVEEFACQARPTLKKRRTGKEEVAQGRT
FT                   FQRRDRFGDGSNQGRDGDNGKGPRSGGGKQARRGGSGQNSQTKGRVQGGSGQSGPNEDQ
FT                   VGTKDNGGWEDGVGENERSLDPLLKVVEKEDQKQYFAKWQSQLPSSPSSYYPLPSDDDL
FT                   NKDKEAIFIDYTNTIGRFNLYYQVSFITRAVEMLKMEIIPISTARMDNLYSGRITSQHV
FT                   LADPGWDAAISEPFSSRALQTLHCIPA"
FT   gene            complement(241841..243391)
FT                   /locus_tag="CNH03070"
FT   mRNA            complement(join(241841..242691,242756..243391))
FT                   /locus_tag="CNH03070"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(242494..242691,242756..242926))
FT                   /codon_start=1
FT                   /locus_tag="CNH03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD26"
FT                   /protein_id="AAW45170.2"
FT                   /translation="MLGQCDSRLANCSSVSKIKTPSFSSGLGVGQESSQLPQVPISFIL
FT                   SDLLSLDSWSGMRHANEKSNSLTTFSHLAEQRWQQDAMHRLQKRALRNRLTFIIASSHM
FT                   PFYSVSCHPLCLYCAVLL"
FT   gene            244152..246813
FT                   /locus_tag="CNH03060"
FT   mRNA            join(244152..244548,244609..244677,244734..244951,
FT                   245005..245169,245224..245309,245359..245843,
FT                   245903..245939,245993..246325,246398..246813)
FT                   /locus_tag="CNH03060"
FT                   /product="myo-inositol transporter, putative"
FT   CDS_pept        join(244414..244548,244609..244677,244734..244951,
FT                   245005..245169,245224..245309,245359..245843,
FT                   245903..245939,245993..246325,246398..246642)
FT                   /codon_start=1
FT                   /locus_tag="CNH03060"
FT                   /product="myo-inositol transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45169"
FT                   /db_xref="GOA:Q5KD25"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD25"
FT                   /protein_id="AAW45169.2"
FT                   /translation="MSATHIEDRDNSFLENKAIDHTEEVENVKGSQEPSNLSGFGGHLI
FT                   DENLVRVEGEDKVTWYLCFLVAASAIAGFLFGYDTGVVGVALPLVGTDLGGSALNSSQQ
FT                   EIITAGTTIGAIFGSAILGGWGDRLGRKMAILISDVFFTLGAVIIACSYSVPQIIVGRI
FT                   VLGVGVGGASVIAPLFIAETAPTAVRGRCIGINAFFIPFGQVVADAIGAGVQNLHNGWR
FT                   LLFALGVVPSVLQLLLFHYLPESPRILILRGDTDGARTVFQHIYPTATPEMIDYKFRVA
FT                   QEYVTATTALQSDTTFWERVKKVWKTGSYRRSITCVSVIQAACQLSGFNTLLYYAGTLF
FT                   GLLGLSNPALGGLIPASTNAVFVLIGMSLVDKVGRRGLMLFGVPIMLLGLVWNIVAFYY
FT                   MCKPTGGFLDTSYSYDTTNVSVVIGGIVLFVLGYGLSYSHIAWYQAEYLALEVRSMGCG
FT                   VATTANWIANLVVSVSYLSELETMTPSGTYGFYLGLSVIGFVFVVFCFPEAKELSIDET
FT                   SILFENDWGVKRSIQMRKERRETQKRFHDAELAEAATAHIEARQQKSTSVSPAELSKFM
FT                   AGLKGGKRKPSVSV"
FT   gene            247381..248971
FT                   /locus_tag="CNH03050"
FT   mRNA            join(247381..247716,247783..247946,248032..248150,
FT                   248211..248520,248594..248971)
FT                   /locus_tag="CNH03050"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(247942..247946,248032..248150,248211..248416)
FT                   /codon_start=1
FT                   /locus_tag="CNH03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45168"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD24"
FT                   /protein_id="AAW45168.2"
FT                   /translation="METVWTRFQPTAYAVEEVIKSGILGKPKRFFADFSMGWDIGVSAD
FT                   TSQMVNPALGAGSLLDMSAYPSVWAMLLLHRHPLNPDKDPKAFVTHQTVYPRTGVDINW
FT                   RWLVE"
FT   gene            complement(252199..254199)
FT                   /locus_tag="CNH03030"
FT   mRNA            complement(252199..254199)
FT                   /locus_tag="CNH03030"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(252334..254199)
FT                   /codon_start=1
FT                   /locus_tag="CNH03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45166"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD22"
FT                   /protein_id="AAW45166.1"
FT                   /translation="MLRTSRLIPLKKDDGSIRPIAVGELIYRLCAKALIISHFQPDFLL
FT                   PFQLGVKSIGGVEPIVRLTERVLEGSAGAEFSFLASLDASNAFNRVDRAEMAAAVKTHA
FT                   PTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDPFGPLFFSITLRPTLHALSQSLGPS
FT                   TQALAYLDDIYLFSNDSQVLSKTTQFLADKQHIIKLNEKKCKLISFDEIRQEGFKMLGT
FT                   MVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQHALLLLRFCIQQNLRHLQRSLRSDDLV
FT                   DLWERLDTMLWEEVKRMRMRQREDTVEEETLGRSLTKLPARLGGLGLLSFKDVAPLAYR
FT                   SAAEASDTLLDNLGLLSSPEEPPTPVPQRTRCAELWESQQEAILRNLGDTERKRLTENA
FT                   SRLGRSWLSVIPYLQPLRLSNVEIASGLHDRTLVGSSIPVCRFCGSDSPLGHDELCRAR
FT                   NPWTQRRHNAINRVIYQHLKQIQGATVEIEPHTLSGQRRNDLRVRGSSALAFTDYDLKV
FT                   YSLGDRDARSTVTPCAPNGKLADFCLDRCVNWLDKVGQVVSKNAPKVTGGVFKPIILST
FT                   GGLMSRSTADEWKEWREAMPVGGFEKMEKRIGVELVKARARTLVL"
FT   gene            complement(255675..258686)
FT                   /locus_tag="CNH03020"
FT   mRNA            complement(join(255675..258112,258203..258318,
FT                   258371..258456,258513..258686))
FT                   /locus_tag="CNH03020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(255937..257517)
FT                   /codon_start=1
FT                   /locus_tag="CNH03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45165"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD21"
FT                   /protein_id="AAW45165.1"
FT                   /translation="MAAAVKTHAPTLWRTCKWAYGDSSDLVCGDKILQSSQGVRQGDPF
FT                   GPLFFSITLRPTLNALSQSLGPSTQALAYLDDIYLFSNDSQVLSKTTQFLADKQHIIKL
FT                   NEKKCKLISFDEIRQDGFKMLGTMVGGKEKRAEFLEGRIRKEMAKVGKLKDLPHQHALL
FT                   LLRFCIQQNLRHLQRSLRSDDLVDLWERLDTMLWEEVKRMRMRQREDTAEEEALGRSLT
FT                   KLPARLGGLGLLSFKDVAPLAYRSAAEASDTLLDNLGLLSSPEEPPTPVPQRTRCAELW
FT                   ESQQEAILHNLGDTERKRLTENASRLGRSWLSVIPYLQPLRLSNVEIASGLHDRTLVGS
FT                   SIPVCRFCGSDSPLGHDELCRARNPWTQRRHNAINRVIYQHLKQIQGATVEIEPHTLSG
FT                   QRRNDLRVRGSSALAFTDYDLKVYSLGDRDARSTATPSTPNSKLAEFCLDRCVNWLDKV
FT                   GQVVSKNAPKVTGGVFKPIILSTGGLMSRSTADEWKEWREAMPVGGFEKMEKRIGVELV
FT                   KARARTLVL"
FT   gene            complement(258698..261095)
FT                   /locus_tag="CNH03015"
FT   mRNA            complement(join(258698..259485,259556..259704,
FT                   259767..260111,260180..260290,260350..260698,
FT                   260758..261095))
FT                   /locus_tag="CNH03015"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(259156..259485,259556..259704,
FT                   259767..260111,260180..260290,260350..260698,
FT                   260758..261027))
FT                   /codon_start=1
FT                   /locus_tag="CNH03015"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5S1"
FT                   /protein_id="ALO69507.1"
FT                   /translation="MSSISFNISVVRLQLREACKGREKRDDESQKRKNANNWIVDWKGG
FT                   DLSDASIENRRNRWIKDKCHGTLQQMDFVAGVLEYMTVLERLKNQSGCTPSSFPFYGPL
FT                   FSPPSLEELQFRGKSISANPSSFLVEPVLVVHPLFYPEMVLDKCPKAGCQSTVKRKGWK
FT                   PFRSVYGVDHNIKVVSLQYICAEHGVYSPSADTYWEGCMPWEQGLLPHFLAKTAVTREL
FT                   YDLIAEVRPKSSVNQLVENIHQLHILYSRRLETRFYAAALRERTRMSFFNQSATPFPMM
FT                   LQRAEIKKDDGPPAVRTGVSEDNITELSGNTSTGTSGNDNEIAINPSPSFDTVRACYED
FT                   FVARQRKHESSQYIRTLSGLIAAVDATMKVANKASVYSRTNNGKMQVVNPFAGGLLTGV
FT                   NEDKELVFWEFLPNNSPAEMQGPLLEFAERCHLLGQNFSELGEVVVDRCCDFRRRIHEA
FT                   LPEVSVVQDFYHVKERIMRTLPANSDHRHALSTGLPKRSCLHGQIKKAAQLNIGQLRSS
FT                   "
FT   gene            complement(261727..265032)
FT                   /locus_tag="CNH03013"
FT   mRNA            complement(join(261727..262084,262265..262278,
FT                   262340..262406,262483..263181,263233..263295,
FT                   263345..263364,263416..263550,263604..263706,
FT                   263758..264091,264153..264207,264256..264400,
FT                   264457..264821,264878..265032))
FT                   /locus_tag="CNH03013"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(261851..262084,262265..262278,
FT                   262340..262406,262483..263181,263233..263295,
FT                   263345..263364,263416..263550,263604..263706,
FT                   263758..264091,264153..264207,264256..264400,
FT                   264457..264821,264878..265019))
FT                   /codon_start=1
FT                   /locus_tag="CNH03013"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5W5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5W5"
FT                   /protein_id="ALO69508.1"
FT                   /translation="MLLLYIRIFPNSPSSLIRPFSTSCKKTNMTGIGQPRPSLGPNRSS
FT                   TSTVFQVRSLADTSPSNIKSETRTASFPSETDIDVEAQPSTSLNRWTKRDRSPRSKATD
FT                   LPDIGNGIRHRRVTLSNSSSRRNSDQYRLLNTSTAVGTGDEPGVDVKSKRDQKNYGHLK
FT                   GKTRIRVVDYCSNPDQDCMNQSSDFPGEKLQEWLDSGHGKRQLDENDKPIGVRWIHVDG
FT                   VNWEVVKTLVLHFGLHPLAVEDSLEAPDSPRSKLDFYKDHLYLQLLIHHSQIFEGDELD
FT                   MLADDMAEGTYGKGQGGIHLGKERRFSQRVRGVFEGDHKKPRLPEGVQGAFEPSMISPR
FT                   RTIGIHRTPEKQAHKLTVEELSADYMVPIRRSILSIFMLRDGTLISMDAKPTKEVLSPI
FT                   YTRLEDEQSLLRRSGDVSMLAQAILDTVVDLAIEVSQRFENEILKLEASVLVDPEMETV
FT                   RHLHVLSSQLIRLRRALTPLLHLCYVIRDQDIQRSVAASAVGRGYGGEGNGNGNGHGRE
FT                   QDGLGHSSSIASGTGGAMGAGAGYNPFSPHSGSSQHSQAMPLAEIPHFAQPQPQPFMPS
FT                   HNIAPTAPPTSSISRAASRSDTPVPGVALRAKQSDADAASILSMMNLHQSHRNLAALGA
FT                   PHLGVDVGAASLGFFSPLTKVYIEDVIDHLEIIVGSLEQFVSTCDHLTDYVFNVLSFQT
FT                   NASMERLSIVTVVFLPLTFIASYFGMNFTGFDQIEGPVSYFWKVAVPCTVAFFIVFSFG
FT                   YIKRFGVTTTRRFARWRRARALSVNLRKSAGDRERKGS"
FT   gene            complement(266481..268360)
FT                   /locus_tag="CNH03010"
FT   mRNA            complement(join(266481..266798,266937..267153,
FT                   267268..267390,267487..267802,267855..267947,
FT                   268014..268360))
FT                   /locus_tag="CNH03010"
FT                   /product="branched-chain-amino-acid transaminase, putative"
FT   CDS_pept        complement(join(266615..266798,266937..267153,
FT                   267268..267390,267487..267802,267855..267947,
FT                   268014..268235))
FT                   /codon_start=1
FT                   /locus_tag="CNH03010"
FT                   /product="branched-chain-amino-acid transaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45164"
FT                   /db_xref="GOA:Q5KD20"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD20"
FT                   /protein_id="AAW45164.1"
FT                   /translation="MSQALLASNLELTRLPADFTPAPGKESHGRYMLTVPWSRHTGWGT
FT                   PKIGPRKDLAFDPLAGVLQYAVTCFEGMKCYKSEQGDLRLFRPEMNFDRLKRSGARLGL
FT                   PHDWDNIELLSLFSSLLSLETPIVPSTDGSSLYIRPTLLETSQSFGIKEDALADEALLY
FT                   VVTSLNLGLGLYGSSEREGKGLKLDACKEFIRAWPGGTGSFKLGANYGTVNISKKKGYA
FT                   MSLWLHGKEDYISEAGAMNMWIIKQASDGYLEFTTMSLDNGIVLPGVTRQSIIELVEDH
FT                   ASGKKAFPFAEGDVEMPKKIRIVERDISMGEILEGLKDGSLKGMFGCGTGVVVVSIGGI
FT                   TYRNQDYTIPFNPLVKLLRDTMTGIQRGRIDEGRGWSYKIEGSA"
FT   gene            268700..273258
FT                   /locus_tag="CNH03000"
FT   mRNA            join(268700..268797,268853..269338,269481..270226,
FT                   270282..271460,271526..271741,271815..273258)
FT                   /locus_tag="CNH03000"
FT                   /product="cell wall integrity protein scw1, putative"
FT   CDS_pept        join(269606..270226,270282..271460,271526..271741,
FT                   271815..272666)
FT                   /codon_start=1
FT                   /locus_tag="CNH03000"
FT                   /product="cell wall integrity protein scw1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH03000"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45163"
FT                   /db_xref="GOA:Q5KD19"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD19"
FT                   /protein_id="AAW45163.1"
FT                   /translation="MAAPPESLQSLPSPTPSSSSQAHSHFGSLHLQTPQTSSTPSTNSH
FT                   PSPNPLNERDAQANSASTTTAVQPAAYLPSVSSSPPPNPPPYIPPPQHAMPPDPIHSMP
FT                   SAAGYGQPAMSWANAPPGPNGWRNGGGVAGGSFAGYRGGIPNGRHLPTNPDYPARFGAR
FT                   PGSAHGESRDRRRERRDRDRDDERELEEEVISTIFVVGFPDDMSEREFQNIFTFAPGFE
FT                   AATLKFPSGSRREPTAALLAELTQLAAHQNAQGGEYSEYPLGNINLEEAISSLSLTTAS
FT                   TSQSTTPSAPMSLTPSVSSNPMLAPGPNPAIPPSSARRQTIGFARFKTRSDALTAKDHL
FT                   QGKKIDPLTGSVLKAEMAKKNLHTKKTTSGEEIMGFLLRSGRLGLVPGAGHTTGPVSVS
FT                   GTSGGNGAMGSVRDAWESWPNSSSGPGSDKDARLNVDEKATANMSSQLNTSTNLTPSSA
FT                   SAPTSTSAPGVSTSTSPPLRQTDSKALLALAEEADELEGWSVNGALGMGMTMGPPYEGY
FT                   SSVSAPSQGQAPGQGQGQRRLGSQSGPAGAAYGRHGHGHGPEYGTNATGTTLSGEHMDG
FT                   AHVGGIGLAGGRIMGANPADQNPPINTLYVGNLPAVSPPTHPPGFLEESLRALFSRCPG
FT                   FKRMSYRQKINGPMCFVEFEEVIYASQAIKELYGHNLGGLVKGGIRLSYSKNSLGQRGN
FT                   NHPSQINTNVFGGIAHNVALAGMSMTSPTTQQHPLPNGAVGYGLPGSLGEGSASLGMGD
FT                   LRRESGPGTATANGISTGTSLSPTAQPFNISLPPTSPRSRYFASPPLSTSNPHKLSPTE
FT                   SASVSASASASASTSVSAGSSLNSNTTNGLSTTGLPTPGGAGVGVPIPSSSSRSSTSAR
FT                   STASAFQPFGQPSTSISTSVNTNTSSGFSPVSSPIRTPASFSWLSSSAGTGGGVGYGYE
FT                   FGGSVPLGSLNGAASAWGQSAERRD"
FT   gene            complement(275176..277781)
FT                   /locus_tag="CNH02990"
FT   mRNA            complement(join(275176..275516,275575..275727,
FT                   275789..276017,276068..276225,276274..276654,
FT                   276710..277096,277146..277392,277528..277781))
FT                   /locus_tag="CNH02990"
FT                   /product="sugar transporter, putative"
FT   CDS_pept        complement(join(275344..275516,275575..275727,
FT                   275789..276017,276068..276225,276274..276654,
FT                   276710..277096,277146..277392,277528..277704))
FT                   /codon_start=1
FT                   /locus_tag="CNH02990"
FT                   /product="sugar transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45162"
FT                   /db_xref="GOA:Q5KD18"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD18"
FT                   /protein_id="AAW45162.1"
FT                   /translation="MMSTVDYKPDSIHVEKTSLPPSSSYHENDTKAADASHIEDMGDKS
FT                   HHTPAVNIIQNPLRRFAPEKVVEDAKLFANGHNLAEYSDLFGRAALVAREGKHFDTISV
FT                   LTPEEKTALEYERDHKWHGPRMLWYSIALCAIGAATQGWDQTGSNGANLSFPEEFGIAG
FT                   EGRDEWIVGAVNSIIFLTAGCIGAFIVDPLNHYLGRRGEIFLTACCLTATPIASAFTHS
FT                   WQALFAVRFVMGIGIGAKNATVPIFSAEIAPARVRGALVMFWQLWVVAGIFLGFAANVI
FT                   VKNTGQIAWRLQLASAFIPAFILMLGIWFTPESPRWLMKHGKYDKAFHSFLRLRAHPII
FT                   AARDYYYSHVIYQEELSLAKGSNYFSRLWDCFRVPRIRRANYGASTVMLAQQMCGINII
FT                   SFYSSTIFTDVGYTDTQALYASLGYGAVQVVFTIPTLFMIDTVGRRRLCLITFPLMCIF
FT                   LLAAGLSLLKDSGSRGSQIGPVVLFVYLFTIAYSLGEGPVAFQYSAEVFPTIQREQGMA
FT                   WVVFINNFFAGVLSITFPRMRTVMTSTGAFGFYAGLNLIAWGMIFFFVRETKQLTLEEI
FT                   DQVFSVPTAQFVSYETRVRVPWFFKRYLFFQKHIPTPPPMIGGADDEDDYKNEKGATA"
FT   gene            280674..283252
FT                   /locus_tag="CNH02980"
FT   mRNA            join(280674..280757,280807..280836,281122..281227,
FT                   281272..281353,281413..281518,281569..281950,
FT                   282003..282242,282289..282411,282466..282917,
FT                   282987..283252)
FT                   /locus_tag="CNH02980"
FT                   /product="chromatin binding protein, putative"
FT   CDS_pept        join(280733..280757,280807..280836,281122..281227,
FT                   281272..281353,281413..281518,281569..281950,
FT                   282003..282242,282289..282411,282466..282917,
FT                   282987..283207)
FT                   /codon_start=1
FT                   /locus_tag="CNH02980"
FT                   /product="chromatin binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45161"
FT                   /db_xref="GOA:P0CR74"
FT                   /db_xref="InterPro:IPR000969"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR024954"
FT                   /db_xref="InterPro:IPR035417"
FT                   /db_xref="InterPro:IPR038167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR74"
FT                   /protein_id="AAW45161.1"
FT                   /translation="MSTVTFENIFHGDSADLGKLRFNPVGFGWKAYQSEDNNPTTYNGS
FT                   DIRHATWFRVARHFQLRLGMRNSEKPRISFDGFKRDDLDKIKRTLQEYFNITLETRDTS
FT                   LKGWNWGEAQVKGSDLVFQVQGKTAFDVPLSQVANSNIAGKYEVALEFNPPSNYKFDPK
FT                   DLNKRPPDEMVEMRFYIPGKSMKKAGSDAGSGGEETELDEEGNEVSAADAFHSLIKEKA
FT                   DIGAVVGDSIVVFEDCLILTPRGRFSIEVYADSIRLVGKSTDHRVPFTSIHRIFLLPKL
FT                   DDLHVQLVLGLDPPIRQGATRYPFLVAQWPKDEVVNAELNLTDEELAQYPDLEKTYEAT
FT                   TFQVVSRVLKALTGKKVTPPGSLRNAQGLNGIRANVKAVQGELYFLEKGLIFISKQPIL
FT                   IDFSKTDSISFSRVGGGVASARTFDMRVVSKTGGADHVFSAINKQEVGPISSFLQSKNI
FT                   RLKNEMEEAIVDIDEPFSDDDEEMESPSEDERPSKAKNDKSKTKPVKKAADDDEDESDD
FT                   EDFEDESSDGGSPSESDSDDDSGMASDASDPMMEELRKKTQAKRTKAKETSGSGSEDEK
FT                   PKKKKAKKDDDE"
FT   gene            complement(284215..286230)
FT                   /locus_tag="CNH02970"
FT   mRNA            complement(join(284215..284729,284860..285172,
FT                   285264..286230))
FT                   /locus_tag="CNH02970"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(284366..284729,284860..285172,
FT                   285264..286059))
FT                   /codon_start=1
FT                   /locus_tag="CNH02970"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45160"
FT                   /db_xref="GOA:Q5KD16"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD16"
FT                   /protein_id="AAW45160.1"
FT                   /translation="MSSPIHQYLFSPPPSPPSRGPRSKLDPNHGLTSVKSLLLPSEFIP
FT                   QYSVDGHHRSPPPLKARSSRSPQQERFTLITSVYPSSGHGRHGNGYYAARDLESIPESS
FT                   TISILSPSCQGLDQEQLQLAPPINLVSPSTSHFRSFQSAFTVPKPILRLVFLVCIIFTT
FT                   IAILIFVPSARPPSLFLGDIAKRIALVPEAQYVNVNVDVNALEWEGMGEEREYQPPHKK
FT                   TAWMLKGIRPKKETEVNKEVQAVEKVKEVEKMVQLQAQQHHALPPPKITRPALRPRPIP
FT                   ASHELLALQSYILASQYNVLSESIDPSKPLDANTILGISAAARKFGGEGGLASMNGKEG
FT                   KEKAEGEEEWLKDIESEWDDEVVVWFGGNGRKQLPHDVIDIIASSHSTNRHITYIPLHS
FT                   RPDREIILSILARLGLPAAADSPIVMIGNEPILGDLETLEEMRLSGELEKKLSKIGWKK
FT                   VKEERKKKKLKMAVVKKKEKGMIEEMRELAGR"
FT   gene            complement(286819..288225)
FT                   /locus_tag="CNH02965"
FT   mRNA            complement(join(286819..287869,287976..288225))
FT                   /locus_tag="CNH02965"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(286980..287801)
FT                   /codon_start=1
FT                   /locus_tag="CNH02965"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M648"
FT                   /protein_id="ALO69509.1"
FT                   /translation="MSLASVYDDTASLWSSSATPSPTQIYVQSRSINDSNSGNFSSMSS
FT                   QSTTATRKRRKNKKLPLAKIFNSKSLFSNTTSQALFSTAGQSLINERNNLRALEKQRKD
FT                   LLTSLAGVYGMDYRSIKSSFMSERQATAEANGQGDMRKRWDNKVANRDLIREWADSTEE
FT                   SRNGWGEEVWDGMRIRMKEETEKTSRASLVVRNDVEELESRLKGMRSMMEAGMSTGNIL
FT                   GTVTSGNSACRLSTTEGHLEQPTLSPITSTRRFNSNGSVLDGFSSDTLSGL"
FT   gene            complement(288253..290059)
FT                   /locus_tag="CNH02960"
FT   mRNA            complement(join(288253..288576,288654..288719,
FT                   288784..288840,288904..289159,289231..289426,
FT                   289478..289689,289749..290059))
FT                   /locus_tag="CNH02960"
FT                   /product="L-arabinitol 4-dehydrogenase, putative"
FT   CDS_pept        complement(join(288427..288576,288654..288719,
FT                   288784..288840,288904..289159,289231..289426,
FT                   289478..289689,289749..289990))
FT                   /codon_start=1
FT                   /locus_tag="CNH02960"
FT                   /product="L-arabinitol 4-dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45159"
FT                   /db_xref="GOA:Q5KD15"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD15"
FT                   /protein_id="AAW45159.1"
FT                   /translation="MTIAITSIPASKYRAHYDPTKVLQHPEFQTLAEDAPELSDPDLNI
FT                   ACAYNPSHEIHMIKKPRFEPGPGEVTIHVRATGICGSDVHFWKHGHIGPTMIVTDECGA
FT                   GHESAGEIVAIGEGVTQWQVGDRVAIEAGVPCGLASCEPCRTGRYNACPADVFFSTPPY
FT                   HGTLTRYHNHPAAWCHRLADNMSYEEGSLCEPLTVALAGIDRAGVRLGDPIVICGAGPI
FT                   GLVTLLAAHAAGCTPIVITDLFASRLEFAKKLLPTVKTVLIEKTAKPEEVAKQIKDVAG
FT                   MQLSIALDCTGVESSIRSAIFSVKFGGKVFVIGVGPSEQSYPFGYCSAREIDLQFQYRY
FT                   NNQYPKAIRLISGGLVDLKPLVTHRFTLKEAVKAFHVAADPSQGAIKVQIHD"
FT   gene            290240..292308
FT                   /locus_tag="CNH02950"
FT   mRNA            join(290240..290666,290725..290763,290823..291076,
FT                   291131..291184,291258..291349,291432..291535,
FT                   291598..292308)
FT                   /locus_tag="CNH02950"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(290381..290666,290725..290763,290823..291076,
FT                   291131..291184,291258..291349,291432..291535,
FT                   291598..291614)
FT                   /codon_start=1
FT                   /locus_tag="CNH02950"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45158"
FT                   /db_xref="GOA:Q5KD14"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD14"
FT                   /protein_id="AAW45158.2"
FT                   /translation="MPITLDFTGKLVLVTGGGRGIGLAISKALAEAGADVAISYTSKDA
FT                   TPVAKELSDKYGTKVRAFKCEITKSSEVDALVEEVKKEYGKDVDIGVANAGVSLWKDAH
FT                   ENTDEDFQSIFAVNTFGPYYLSRALVRSWLGLPVPVNSASDPIDVANMKNVDLKKQILF
FT                   VSSISALVAMNPQRQSAYNASKGAVTMLAKSLAGEWSHIGVAINSISPGYVSTDMIANP
FT                   PDATASTWVKEWEKRTPVGRFATADEIGGFVATLLSDKMGGMGFMAGSDIVVDGGYTIF
FT                   "
FT   gene            complement(292485..295266)
FT                   /locus_tag="CNH02940"
FT   mRNA            complement(join(292485..292949,293056..294460,
FT                   294538..295266))
FT                   /locus_tag="CNH02940"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(292618..292949,293056..294460,
FT                   294538..295173))
FT                   /codon_start=1
FT                   /locus_tag="CNH02940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD13"
FT                   /protein_id="AAW45260.1"
FT                   /translation="MLSSPRHFLNTFHTSSHRSTNASQTSFTSYAASHTTQDTHRANSC
FT                   SSSNFRSHSYSRSPHAPASTSAADPDFAPSIYHSIHLRHERGEGSTLQGSVTSHTSKGL
FT                   LFKNPFKKNNDLVSQLERAERVGKDRERQKERVKQREKEKEKEREGEMGESSRRPGLMK
FT                   QGTAMMKRRFSITRNDVKAVVTPTPKAGGNQMYGGADEDEEVMIIVGNQDEIRDFHLPT
FT                   QRPVSPIITGDFLKTPSRVRTSLSPSLGESKTSSRPSPSSFSPQLLPEHTPEDPIDLDI
FT                   FDSFAPFPNYDTNLDADAISAFTADATPKKAVRSTTWQVKARPKSIYVKRLSKRFGKTN
FT                   NTVASPKLSNGEIHPSLAHPLHAKPLFAESSLQAAPTPAHQASRHIPTKEELMNRPLPP
FT                   HTPQGLPSRYRPNGTTIFDIYPDEDLDYHPIPPPGTRQIARIGPNVIPNSTTHLHPHGA
FT                   MADANTNTNLNRARNTHVDTRRRTIAPRSSRVFDIPNALYDLWQYGMDEPEIMDLSFDE
FT                   EELERKRILPMFVHVRSTGKRLVKDTRIQSPGSYTRNQGRKMGKNEVARSNDRIRNDLT
FT                   GSPITTGNNTFMVEISPASLDSGSKSSLNSRVSQLSEVSDGSQMSEGMGGSGASGGSRG
FT                   SRDDSIGLLVHGKVETASKMSLRYATPRAAGRDLKEDMRTDGMASSASVMTSSVSQASQ
FT                   ISGVWDYAALIDDRDHTSPQDEIFTRDQVQTQTQSRTTSAVHTRNEAKAKAQGQRQQGK
FT                   GEEVHPDGDMAREMAFEDAESVPDMVLDRDSVFEHAL"
FT   gene            295433..296339
FT                   /locus_tag="CNH02930"
FT   mRNA            join(295433..295785,295902..296049,296136..296339)
FT                   /locus_tag="CNH02930"
FT                   /product="EF-hand calcium-binding protein, Caltractin-cdc31
FT                   subfamily, putative"
FT   CDS_pept        join(295497..295785,295902..296049,296136..296223)
FT                   /codon_start=1
FT                   /locus_tag="CNH02930"
FT                   /product="EF-hand calcium-binding protein, Caltractin-cdc31
FT                   subfamily, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45157"
FT                   /db_xref="GOA:Q5KD12"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD12"
FT                   /protein_id="AAW45157.1"
FT                   /translation="MSHYTKPKSRRPATLPLPHSHATTSNSRSLTEDQRGEIKEAFELF
FT                   DVDKDGAIDYHELKVAMRALGFDVKKGEVMKLLKEHGGEDGLMDFLAFERIMTEKILAR
FT                   NPEHELRRAFELFDDDRTGKISLKNLRRVARELGETLGEEELQAMIDEFDLDQDGEINL
FT                   EEFLAIMLDGE"
FT   gene            complement(296953..298097)
FT                   /locus_tag="CNH02920"
FT   mRNA            complement(join(296953..297533,297585..297682,
FT                   297744..297925,298000..298097))
FT                   /locus_tag="CNH02920"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(297063..297533,297585..297682,
FT                   297744..297816))
FT                   /codon_start=1
FT                   /locus_tag="CNH02920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45156"
FT                   /db_xref="GOA:Q5KD11"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD11"
FT                   /protein_id="AAW45156.1"
FT                   /translation="MGFGPIHCGSFLLLSAAVLLLVATISAPVIDHISFLDITTGSSKA
FT                   TFGVFGYCSNIIGSDTCSQRQIGYDIADVTGNLTDYTYVNNSLENVTKAFILHPIACGI
FT                   AFLSFLIALCSDRLGFLFAAFIALLAFIVSLVAMIIDFVVFGLVKHEINKNTSADADFA
FT                   AAIWLVLAATIILFFSTFVVCFSCCTNRRRVRDREYQAGPMSEKRWWHRA"
FT   gene            complement(298748..301050)
FT                   /locus_tag="CNH02910"
FT   mRNA            complement(join(298748..299049,299121..299562,
FT                   299638..299751,299816..300166,300219..300290,
FT                   300349..300412,300470..300555,300610..301050))
FT                   /locus_tag="CNH02910"
FT                   /product="malate synthase, putative"
FT   CDS_pept        complement(join(298825..299049,299121..299562,
FT                   299638..299751,299816..300166,300219..300290,
FT                   300349..300412,300470..300555,300610..300872))
FT                   /codon_start=1
FT                   /locus_tag="CNH02910"
FT                   /product="malate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45155"
FT                   /db_xref="GOA:Q5KD10"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD10"
FT                   /protein_id="AAW45155.1"
FT                   /translation="MSLPQGIYLTAPIPKGGEHILSTEALEFLALLHRTFNKRRLELLK
FT                   NREKVQAELDQGKPLSFLPETREIRENLAWNCAPPGPGLEDRRVEITGPTDRKMVINAL
FT                   NSGAKTFMADFEDSNSPTWSNMVLGQVNLYDAIRRQIDFEINGKAYKLSEKPAVLLVRP
FT                   RGWHLPEPRLIIDGTPMSGSLFDFGLYFFHNARELISRGSGPYFYLPKMEHHLEARLWN
FT                   DAFCLATSHLGVQQGVIRATVLIETLPAAFQMEEILYELKEHSAGLNCGRWDYIFSFIK
FT                   KQRAHKNCVFPDRSDVTMTVPFMDAYVRLLIQTCHKRKVAAMGGMSAQIPIKNDPAANE
FT                   RAMSKVRADKLREVTAGHDGTWVAHPALISIALEIFNQHMPGPNQYHIRREDVTVTDKQ
FT                   IADPSVPGKITEQGLRDNVSAALSYCAAWISGNGCVPINHLMEDAATAEIARVQLWQWC
FT                   KYGSKTDSGKDINPSYVQTILSEEASKVSKLPGIDPSHVKIASEYMAQQVKAQWPSDFL
FT                   TSDLLGYLEGVGTKGGAKASL"
FT   gene            301568..303607
FT                   /locus_tag="CNH02900"
FT   mRNA            join(301568..302023,302084..302231,302314..302349,
FT                   302415..303131,303208..303607)
FT                   /locus_tag="CNH02900"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(301694..302023,302084..302231,302314..302349,
FT                   302415..303131,303208..303473)
FT                   /codon_start=1
FT                   /locus_tag="CNH02900"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45154"
FT                   /db_xref="GOA:Q5KD09"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD09"
FT                   /protein_id="AAW45154.1"
FT                   /translation="MGVLSKFKDQFTQSSPSYDFPPPPPSIPLGPNAVFRYRKQRGVNL
FT                   GSWFSLEQWICPHVFKGAKPPGQSDYDVASGKDAKRILEEHWDTWITEDDMKWIASRGF
FT                   NSVRLPIAYYHLCGPLPEVLKGTDFESFRHVFEGAWGRIERAVEMAGAYGLGVLIDLHG
FT                   AAGAQNPDAHAGLSRGKVSFWDTHANQASTSLALRFLASKFASVPHIVGLELLNEPQNN
FT                   RKLQSWYSKTIDEVRKVAPPDFPIYCSDAWDTDHYAGWVGSRGDFVVLDHHLYRCFTDE
FT                   DKCQTGTDHANNLRSGFRGRFAQQCEAAKGSLVVGEWSASLDPRSFPQGMPDGEKDAQR
FT                   RAFVHAQLEIFESHAAGYWFWTYKKGEGWDAGWSATNASQAEILPGWVGSRQFKGTPPS
FT                   HIKDQELQNGHKSHADYWAANGGSPNPDMYAPGFSQGWDDALIFLSTQGSPSEMGFVHQ
FT                   WAIRRQAEFESQGHKLGRAAWEWEHGFKQGVEACARCCLA"
FT   gene            304739..309592
FT                   /locus_tag="CNH02890"
FT   mRNA            join(304739..304938,305024..305111,305190..305331,
FT                   305389..305558,305621..305813,305862..305970,
FT                   306020..306344,306394..307005,307057..307389,
FT                   307450..307541,307607..307789,307843..307952,
FT                   308007..308169,308226..308486,308541..308858,
FT                   308915..309044,309137..309592)
FT                   /locus_tag="CNH02890"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 5,
FT                   putative"
FT   CDS_pept        join(304936..304938,305024..305111,305190..305331,
FT                   305389..305558,305621..305813,305862..305970,
FT                   306020..306344,306394..307005,307057..307389,
FT                   307450..307541,307607..307789,307843..307952,
FT                   308007..308169,308226..308486,308541..308858,
FT                   308915..309044,309137..309246)
FT                   /codon_start=1
FT                   /locus_tag="CNH02890"
FT                   /product="ubiquitin carboxyl-terminal hydrolase 5,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45153"
FT                   /db_xref="GOA:Q5KD08"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR002083"
FT                   /db_xref="InterPro:IPR008974"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR024729"
FT                   /db_xref="InterPro:IPR028889"
FT                   /db_xref="InterPro:IPR029346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD08"
FT                   /protein_id="AAW45153.1"
FT                   /translation="MQQPANDVQDIILDESPAPMEVDDIPNVHDYEAYAAKCMPDLGLE
FT                   IEDFQYQTWRIEHWSQQPKRIVGPEFSCGGHKWRILLFPQGNANGQPNDMVSVYLDYAN
FT                   PKTAPEGWHACAQFCLAISNPWDPTIQTSSHAHHRFVAEECDWGFTRFVDLRKLYTADP
FT                   ANGKNRPTIENDEVEITAFVRVLKDPTGVLWHNFVNYDSKKETGHVGLKNQGATCYMNS
FT                   LLQSLFCTNYFRKAVYQIPTEDDIPSESLALALQRVFYHLQTSNQPVGTTELTKSFGWK
FT                   SLDSFMQHDVQEFSRILQDKLEIKMKGTPAEGAIPKLFKGQMKNYIKCIDVDFESSVIE
FT                   DFYDIQLTIKGLKDLRASFKEYVSVETLDGENKYQAEGHGLQAARKGVIFKSFPPVLHL
FT                   QLRRFEYDVEKDALVKINDRHEFPFEIDLGEFLDESADRAQSHVYKLHGVLVHSGDLHG
FT                   GHYFALIKPEKDGRWYKFDDDRVTPVTDKEVLEDNYGGDMLNGLVPPHQRTQARTLKKF
FT                   TNAYMLVYIRETELDTVLAPFTESDTPPHLKARLDHEREQLEAKKREKDEQHLYLTAKV
FT                   ITDEIFSQHQGFDLASFEDKNIPATDLPTFRVLKNESYPTFKSRIASHFKIPERDFRLW
FT                   VLVNRQNKTTRPDVPIHENDNTQTMENIRNSMAARASDLKLYLDYNPDHARFNELHAEG
FT                   KEPPIMIFLKWFDCSRQTLLGQGKVFVDKYQKVSDLLGIIQERMGWPSSTPIKLYEEIK
FT                   AGMIEGMKLKQSFIQNEIQDGDIICYQVELPEKEIADLEAQSLYSSVPQFYDFLQNRIL
FT                   VHFKPRYEDRAASVPEFDLMLSKKMTYDVMAHRVGEFLKHDPLKLRFTSAHNQNGAPKA
FT                   IVKRSLNQSVADITQTSYYNQHAHICIYYELLDISIIELETKKSLKVVWTGRHNKEEAT
FT                   HSFLLPKTCTFNDVADNMLKLVKLEPNGSGKIRIFDVSPSGRSPREHTGSEMIGNLPES
FT                   AELYAEEIPVEELQAGEGTKIVNVFHYSRDPSRTHGVPCKFVLHEGEPFSETKARLQER
FT                   IGVPEKEFAKYKFSLVTSTVFKQPSIVEENDIIYDHKWAPDDALGLDHIDRRPNKANVE
FT                   KGIVMR"
FT   gene            309706..311180
FT                   /locus_tag="CNH02880"
FT   mRNA            join(309706..310125,310226..310489,310555..310655,
FT                   310713..311180)
FT                   /locus_tag="CNH02880"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(309830..310125,310226..310489,310555..310655,
FT                   310713..311035)
FT                   /codon_start=1
FT                   /locus_tag="CNH02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45152"
FT                   /db_xref="GOA:Q5KD07"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD07"
FT                   /protein_id="AAW45152.2"
FT                   /translation="MPLPYNRPWLMEFADQQWFPPYLRIPVYEMLTYIWTHRIPLLQSK
FT                   APYERAAQVLETIIENANSESGRPGSSPGNDDVRVVDFGSGAGGPLGKIERWINRRRND
FT                   SSKPPIPFYLTDLYPMPQPTLSNSSPSSSSLVYIPESVDALRAPTSVTSRRHLRTFFLS
FT                   FHHFNEEQAREVIVDAMRSAEGICIFELQECNFGSAMMILLLAPLTWIFIPFQRPNLRT
FT                   LIFTYLIPLIPFILVLDGLISVYRTRSPSHILHLANLANLSLALEGEDKVLGDMDWKWE
FT                   HGAERHTWPFGQLVWVVGRRDWSENNGNVTETETEEDSHSEAEHGT"
FT   gene            complement(311328..313100)
FT                   /locus_tag="CNH02870"
FT   mRNA            complement(join(311328..311412,311470..311673,
FT                   311734..311805,311865..312398,312476..312616,
FT                   312679..312739,312793..312808,312864..313100))
FT                   /locus_tag="CNH02870"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(311410..311412,311470..311673,
FT                   311734..311805,311865..312398,312476..312616,
FT                   312679..312739,312793..312808,312864..313041))
FT                   /codon_start=1
FT                   /locus_tag="CNH02870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45151"
FT                   /db_xref="GOA:Q5KD06"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR037457"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD06"
FT                   /protein_id="AAW45151.1"
FT                   /translation="MILLLFCLYPLLVLSVSAHQSRSYNPLSTSQLKRLIQLDPPQFSS
FT                   VTDGHLGKLLIPRPSGSENNTLVQNYISSVFSKLGWHEEKTPFTSATPIGDIDFTNLVY
FT                   TFDPDAPRKLVLAAHFDSKWYPDYPANQFIGATDSAAPCAILLSIAEFLTPFLNSRQSR
FT                   ISSGQPFLRDGFDEEEEAETTIQIIFFDGEEAFHDWTDMDSIYGARYLAEEWSETYLPP
FT                   AHPLTRRRMHPHPTMLDTIDHLVLFDLLGNKHSSIRSFFRETDWLFDRMANGDERLREE
FT                   GLVEVEKGEDGWFRTERGRKGMVGDDHVPFLNRGVSVLHVISVPFPSVWHTIADDTAAL
FT                   SLPAIRRWNRILRVFVCEYLSLFPEDMDMSLDRSIDMDMGSAANEATASTISTPKARSQ
FT                   DEL"
FT   gene            313255..314354
FT                   /locus_tag="CNH02860"
FT   mRNA            join(313255..313647,313702..313784,313837..313875,
FT                   313934..314354)
FT                   /locus_tag="CNH02860"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(313440..313647,313702..313784,313837..313875,
FT                   313934..313972)
FT                   /codon_start=1
FT                   /locus_tag="CNH02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45150"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD05"
FT                   /protein_id="AAW45150.1"
FT                   /translation="MSLIRTALRLSRPSISSTRFLHSSRRVFASEIPPNPFEDPIFKAF
FT                   ADRVKQHQGAVDAMKGLMNVMQQKGFDKNKKPTMMQMIEMASDKDLKAAASVLMSELQK
FT                   AGVDQTEAMEIFKKASSR"
FT   gene            complement(314292..318749)
FT                   /locus_tag="CNH02850"
FT   mRNA            complement(join(314292..315808,315889..316618,
FT                   316676..316888,316969..318749))
FT                   /locus_tag="CNH02850"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(314497..315808,315889..316618,
FT                   316676..316888,316969..318655))
FT                   /codon_start=1
FT                   /locus_tag="CNH02850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45149"
FT                   /db_xref="GOA:Q5KD04"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD04"
FT                   /protein_id="AAW45149.2"
FT                   /translation="MTDAPPSRSRHPLPRPLVLAALSALLPLAHATPVPPLRHRARLRL
FT                   RASLHVEPLSHLFSSLGESFARRNNVSGPVLGIASYSTSAQSYTLPADYVILTPYFNGG
FT                   FIVLAYIIAFIGSLCTLELLIRRTTNSGWRNQALLAAAGFCFGAVSTFAMHFVFNNALG
FT                   LKHPLHPEYPVSYLSYNAGFTILSLVVSCLAMTIAFFIMGTKLGDWKCGSRAKRRHKKI
FT                   KDRGSKSQRERDEYREWKSSHKKGIQAGSKGHRSLLTRAGSHSTWSALDPETETSERSL
FT                   RAKLFGTRRKSGWKDDTRLDGPENLDKDLQEMEFRLGKAAVEEELERKAREALDGRMGR
FT                   RASLPIAQSLNDFSSPPAEFHPDRVRSSLPESASVFTPNFSFPAQSPSLFPRTNTTDIS
FT                   QSTASNPESYSNENPHPFSARHEWRRASLPTNILFTQPPKRPSYSGPSGSGLSRIQSLP
FT                   EGDIDPPPSPTTILRSNASQNSDTSDEAKVSLSPEAQLHGLQQEKSASSEDVREGKRDR
FT                   WAKVNEKKNLWGKLGAFLGFDIVTAAEVIKVFVTGITAGFGVVGMHYIGQASIIGIPYV
FT                   AYKPAYVVGSVIIACGAVVIALYIMFIMLRPKLKHTWWSKILVALILAVAVCAMHFCGT
FT                   LGTIYGWPAARSTTKHSKLSGTNAAITGIVSALAFAACIACTVFFLLHSLHLRREQARR
FT                   RRVVVASVMFDEKDRILVHSTDGMLPMCDIANLTGGVHGNSSGRGSFIQSLSSESTVLG
FT                   MDLSTGHEAFVSALKLSWMWRNPIMSQQNSVHLLDSKSQSQPHSHAAHAQADSMFAPTL
FT                   LDIRRGSMVTNHTSTTLTGSRSMPLSISKFLEKFSTSSGHLAMRLTGQMNGITRLGVLY
FT                   DQILTTGWVKLQNSSDTVSKGQLIFLVRRINSAAEQFDLVSRHYMFADPSAVASALQRT
FT                   LSVPFDHIMPLLDDIRLFCDSTLHCTLHPGKLYAGVAVVQATPFDGLRILLEKDKRGQL
FT                   PMREMCTFGTSPAESGALYGTVEEIGEAVSMLQGFNMLSIISRNISPSTETDTLLSGRV
FT                   SALLSALELAIVPMLDEMLTAEDMEHILPRLTLHPLLIPLTPGGRPQSLSAKRSPYTPP
FT                   YLIVFYANYDVAVNTFTDKWLPFSLFRAQSACVMSQKVQVGTRMERIWGENEPDGSATP
FT                   NAARRPSKVQFEFPTNGAQLASGSTFDTSIFNGYSFPASDDNQTSVPHYSSSSSSSSAH
FT                   INPLANVTRKSSLVRGRFSSSGDELPDLNADSGIASAHGVNGTTGLGIGQAGVGVGKDV
FT                   LIKPVWPGVGTWDQDWLLHLLRASLRAET"
FT   gene            complement(318835..321379)
FT                   /locus_tag="CNH02840"
FT   mRNA            complement(join(318835..319089,319148..319366,
FT                   319466..319636,319702..319848,319956..320045,
FT                   320102..320203,320259..320426,320502..320551,
FT                   320606..320727,320801..321379))
FT                   /locus_tag="CNH02840"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(318901..319089,319148..319366,
FT                   319466..319636,319702..319848,319956..320045,
FT                   320102..320203,320259..320426,320502..320551,
FT                   320606..320727,320801..321258))
FT                   /codon_start=1
FT                   /locus_tag="CNH02840"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45148"
FT                   /db_xref="GOA:Q5KD03"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR037753"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD03"
FT                   /protein_id="AAW45148.1"
FT                   /translation="MSFHPQNEPASPVSEQTRHTDANPVPESLSPSSTLTLSSAATPAP
FT                   VPVSAAAATPFSHAHPAFPALPQLGKLPTTPQEIHQILSLPANQFTAKALPLLAKVADG
FT                   KPFEGASLKAWERRNAGEQLLALYEAGDEVYETADERVKEIGGGLIYVLSARITLGQGN
FT                   AVVWSDKMLNFAIRLCELADPAQLRICHQRVAAFAWGLLRLSQQLSKVKLVIPAITSLI
FT                   QKLNYHQTFSPIFGALLEACLVTRQFDHPSLGLVLDIIFLDVKTTAPTYLDILTYYHHA
FT                   GAVTMAVGDFCKAKEYYLTAVTVPTTTASAIQLACAKRALLCELIVTGKKIVWPKYTPT
FT                   PVTRIIEKYATSYNELAKEFEAHNWANVRRAHTVAEFEKDCNSGLIEQVVNSIHRHMIL
FT                   RLRKTYMRLTVDSLARRLRVGDDMPKAERVVAILDDMIKSGEVSAILTPSATQPQSHSQ
FT                   AIIEFITATESFTSPAALGRLERASAVAALLQEHLAEGSRRLGASKEYLVKQAQYLESN
FT                   SKKNKGDEFDQLMEAEETMEPGAGSGKMMGSSGGGGSKSGSLRGVASNMADIGF"
FT   gene            321514..323658
FT                   /locus_tag="CNH02830"
FT   mRNA            join(321514..321770,321848..321875,321939..322025,
FT                   322126..322187,322255..322451,322522..322587,
FT                   322658..322762,322842..322981,323045..323158,
FT                   323233..323347,323431..323658)
FT                   /locus_tag="CNH02830"
FT                   /product="2-nitropropane dioxygenase, putative"
FT   CDS_pept        join(321572..321770,321848..321875,321939..322025,
FT                   322126..322187,322255..322451,322522..322587,
FT                   322658..322762,322842..322981,323045..323158,
FT                   323233..323347,323431..323547)
FT                   /codon_start=1
FT                   /locus_tag="CNH02830"
FT                   /product="2-nitropropane dioxygenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45147"
FT                   /db_xref="GOA:Q5KD02"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD02"
FT                   /protein_id="AAW45147.1"
FT                   /translation="MPIITVRYFGLNHPSLACRPPLSQHTYIYPASNARITSAFLHNLV
FT                   SNTLTSTQIIMSVISTPITKLFGIKHPILLAGMNVAAGPELAAAVSNAGGLGVIGGLGY
FT                   TPKHLRGVIKDLKASLKSPDLPFGVDLLIPSLGPSARKTNYDYTKGQLNDLIDVIIEEK
FT                   AKLFVCAVGVPPKEAVEKLHAAGIYVMNMVGHPKHVTKALAQGVDIICAQGGEGGGHTG
FT                   RTTFSILIPACVDICKGKKSPLTGQPVHVIAAGGIYDGRGLAASLMYGAQAVWVGTRFV
FT                   ASTEAAAPKKHKELILSADHGDADTTLIYTGRPLRVRQTDYVKSWTNRQDEILQLTKQG
FT                   KIPHDLELQKHPEKSLESRPWLMGDVSALIHDVKPAKEIIDEMVSTAKQCLEHGYTSVS
FT                   GGRGPSKAKL"
FT   gene            324134..325344
FT                   /locus_tag="CNH02825"
FT   mRNA            join(324134..324284,324350..324668,324738..324773,
FT                   324885..324994,325045..325344)
FT                   /locus_tag="CNH02825"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(324210..324284,324350..324668,324738..324773,
FT                   324885..324994,325045..325122)
FT                   /codon_start=1
FT                   /locus_tag="CNH02825"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Z7"
FT                   /db_xref="InterPro:IPR007218"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z7"
FT                   /protein_id="ALO69510.1"
FT                   /translation="MPPKKGSSTTTKSSGKTKKAAGLSQPTLGFQSQRKHSGTISKSKP
FT                   SLQRQTSTISEINVEPEGRSDSDIELLAGSDMKDKTTRMGGNKSTESSALPEQRTEDEE
FT                   PKQLKVKSKEWAQVLKAAKEAMGNLEPIHAHADTHNDIHHILRVFDMTAKYGPCVGISR
FT                   LDRWKRAQKLGLEPPDEIRTILTTQQGREDPSYRENVLNAWL"
FT   gene            325526..329645
FT                   /locus_tag="CNH02820"
FT   mRNA            join(325526..326526,326577..327409,327450..327492,
FT                   327540..327709,327760..327987,328039..328194,
FT                   328251..328275,328336..328539,328588..329290,
FT                   329359..329645)
FT                   /locus_tag="CNH02820"
FT                   /product="nucleus protein, putative"
FT   CDS_pept        join(325599..326526,326577..327409,327450..327492,
FT                   327540..327709,327760..327987,328039..328194,
FT                   328251..328275,328336..328539,328588..329290,
FT                   329359..329437)
FT                   /codon_start=1
FT                   /locus_tag="CNH02820"
FT                   /product="nucleus protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45146"
FT                   /db_xref="GOA:Q5KD01"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD01"
FT                   /protein_id="AAW45146.2"
FT                   /translation="MDPSLLHSSEEVKSTTNTSPGGSNDPSPNTTGQSHTTDSTSPSTV
FT                   PQSQPTSQISNQPPQSSSQFQNQPGQDTSSLDDNESAKRPRLRLAHACDRCRRRKIRCD
FT                   TQHPCTPCQQSNNVCTFETPSRRTVKSKGNSERVSSTGGIKRPHSPGRVFASLATGKGE
FT                   SQSNLEARLAALESMLRDVPPNVHNAFLSTLDARLGSGTGVGLKEGGGGGEGVGVAVEA
FT                   LAGTSLGNLNLPGNLGYNMGGSGLNAQRRLGQNAFSPDWAANGGLSGWLNDAVLGKKKE
FT                   EAGMDELAKRLGGMSFFYEDEIGQAKWQGATSGFPLLHLLAAHNAPKEEDEADSADGDV
FT                   SGEMIASPATDSIPSTSPNTSTILPRRISSSSTPAGRASSVHAKARSSSIGLGAIGRRA
FT                   SSADRRKKERFFPDRTPRPHQTLNPEASWKVITGVIPPDLMDTLVRCYLSTSHLLWPFL
FT                   HVPSFLTDYANPAQWGEPGFTCFIVAVCTLSSRHVDDPRVRANPADPSTAGKQYFELFK
FT                   RLRDLPSADRPTLYSIQAAFLAAIYAFGLGNLSKAFSLQAESITLCLDGGLHRSVDGYD
FT                   HFDAIEKETRKRTFWSIYAWDKQSAALFGRPPIIHLRDCDVTEPLIVDDEDLNPGGIKD
FT                   ESINSKSRMCAFVATIRLHVILEGVIDSATQPSAFPTSPFLARAAATIARRTAQSETLR
FT                   DEEELLEEWKRILPKYWCYDTETANSRDPIRITQAERLHCLEHLVKMIIYRHRFSGFVA
FT                   MPASTAEERARHLDLCRKAMQCALTIIADHVHISQRGMMTYYGVHVIHQLAQAGRTLVA
FT                   VILNCRNADFRPIIAPSVEGLRSCVGLLRRFSGRYLCGLRSADIIDEFCRVCNIPVDSP
FT                   RVPNSAGRPSPAWLRPVRKRVATPPPIADSPGSSGMMNFDPNTLTANSGVHASGVNDNM
FT                   SISAGGLGDIGGSASDLDALFNTAAYFNVPGGEVSAGMAGTSTGSAPNVGNQNANIGPS
FT                   NSFLPTLGGLGEASAPYDRFETLSPNVELGNGSTIFSNYQDSHAGFSLSGDTDHPMGSG
FT                   PGTSVGAGAGHISFDYGLNGHGFGGESLAMKGMDNVSDGLKQGTGGSNLSAATILSLME
FT                   EGSFDYGSIFTDQAP"
FT   gene            330899..331847
FT                   /locus_tag="CNH02815"
FT   mRNA            join(330899..331353,331417..331525,331588..331847)
FT                   /locus_tag="CNH02815"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(331194..331353,331417..331525,331588..331657)
FT                   /codon_start=1
FT                   /locus_tag="CNH02815"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5T4"
FT                   /protein_id="ALO69511.1"
FT                   /translation="MTALSSSLHRDNQQSLPRRASSKSDRRLASGAPNVSTSSSTASQS
FT                   TLGDYNLEGEELPYSETLEKKKRKYSEKLYQWTQEMWNNTKQDMDRRSSVSSSEDSADI
FT                   YKAHNESK"
FT   gene            complement(331993..334686)
FT                   /locus_tag="CNH02810"
FT   mRNA            complement(join(331993..332693,332746..332780,
FT                   332829..332985,333045..333448,333504..333552,
FT                   333617..333706,333759..333891,333939..334149,
FT                   334213..334355,334416..334686))
FT                   /locus_tag="CNH02810"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(332118..332693,332746..332780,
FT                   332829..332985,333045..333448,333504..333552,
FT                   333617..333706,333759..333891,333939..334149,
FT                   334213..334355,334416..334534))
FT                   /codon_start=1
FT                   /locus_tag="CNH02810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45259"
FT                   /db_xref="GOA:Q5KD00"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KD00"
FT                   /protein_id="AAW45259.1"
FT                   /translation="MNRNCSSSTPTSSHSPQQSEHKRRWWDDLTFTKCKKMFLRHLHFV
FT                   GPGLVSSVAYIDPGNWATDLEAGADYGYKLLFVVLLASLAAVVLQLLSVRLGTTTGLSL
FT                   PAQTRLLFLRLKSRYPRYRIPLTIALWTLYALAEIAIIATDLAELLGSAIALHLLFPKL
FT                   PLFAGVLITAVDVLVVLVFFRSSSGRQGMMFFEIIIVSLVLAVFISFMILLKLTSPVWR
FT                   DVFLGLVPSETLVKPGALYLGVGIIGATVMPHALFLGSFLSGVDRLNMIPQPPSMRKPR
FT                   NVTMPSFNPFRRTRSIRSDSEQGEGVSTGISPVLLQAPRPSSGSEAAVLENDGAKDEVH
FT                   LQDSVVELTKEEKLFAIEQKEYERNVRMFDRIKWVDVHLFHSTIDTAISLLSFALTINA
FT                   SILTLAGAVYYYNESPPSEGADLFGAFDLIKSYISHAAAIVFALALLCAGQSASITATL
FT                   AGQVVSEGFINWKTSPFLRRLITRLLGVIPSAVVASAVGTKGLNTMLVASQVLLSIVLP
FT                   TVVFPLVYLCSKHEIMTVQGPEVESIEMERIANSGASVSDPFALAATTPSLSPTTLGDD
FT                   LAALGIESTTVRVEPDQSVDRPSRRSKSYVSPKWVTVLGYVLFVVIVLANVYVIVELCL
FT                   GNG"
FT   gene            complement(334983..339966)
FT                   /locus_tag="CNH02800"
FT   mRNA            complement(join(334983..335134,335188..335717,
FT                   335789..335988,336044..336152,336220..336337,
FT                   336395..336556,336635..337653,337709..337866,
FT                   337916..338040,338094..338855,338908..339026,
FT                   339073..339966))
FT                   /locus_tag="CNH02800"
FT                   /product="protein tyrosine/threonine phosphatase, putative"
FT   CDS_pept        complement(join(335685..335717,335789..335988,
FT                   336044..336152,336220..336337,336395..336556,
FT                   336635..337653,337709..337866,337916..338040,
FT                   338094..338855,338908..339026,339073..339612))
FT                   /codon_start=1
FT                   /locus_tag="CNH02800"
FT                   /product="protein tyrosine/threonine phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45145"
FT                   /db_xref="GOA:Q5KCZ9"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ9"
FT                   /protein_id="AAW45145.1"
FT                   /translation="MSSAILPYPSQPSYPLSRPSTPRPTTTLSAPPTPITPTHLLPVAM
FT                   ERARSTEGVVNGVEQALNQARGIKDNKEPKPGRLKFEWEHIERPKTPESDHGIDDDEEQ
FT                   KMDVDEEQPIQPPYLGLGEPVSTYDEERAQRENAMRQMDIHHEEPPPPIIWGMPKWGRE
FT                   AERQEVAKGVRLLGMEELPQLVKTHSLIDTPSSVMFPWLHGISDDGHKGQEMAQFFGYS
FT                   PPFGPPPYRGLCLLFCPPHPLDKHHLRPPPQRNDTDLTTVPTSAPYKVPDRKDSESEST
FT                   SSESYNSSGATELTSPSLGNSLPSPSLSSFKPLPETDTQSMDSSKDDSNGAEVAMHPCY
FT                   SKRLSPTTVAKGLDEDNHPLPCSSILNAAAEPETQKPSLSSSVSSSSSDVDEAVGQNQN
FT                   PSCILFNALHVHDIFDLSKIGDDTEKRASFRAAKLPDQINLRNLNIQQIKYATVSDIVL
FT                   YSKTGLTQGLLHIAEQIAQAQEDLYNQRLQEIYHVNHTGGDGEGSSEPIRYGVWVVLES
FT                   FNEIEKHYPELVNIDSKGRDKHPHLQTDLFEREAKESREMTKASEVVEGFWVGNDCDVP
FT                   GATLEGAGSFIRFDLCLKASECSEMPSTSALSSAYRKLLDIDRRRREAGEESQSTSAFN
FT                   WTASPATHALRNLLSPSSSSVTTEVPSKRTASPTPSDRQLRAKPSLTTDHEYVALDCAG
FT                   SSRTITGHTRNMVTMTDRVIELVYFLRKLVEGRDNGRKRKILVHCQDGYTESSIIVLAY
FT                   IMSSLSISLPEAFLHLQVNANRSFFLYPADKPLLRKVDARLAADRKAKAIKLLSATSAG
FT                   SASSHTDSDGKQSNPSPRWRPWGMNFGAKREQAPNRTSAIGGKERSKSTADVAREMLAE
FT                   HENGGSAAAQEARLWFDDKRFDGFPSRILPFLYLGNLEHAGNAAMLHSLGITHVVSVGE
FT                   SLMNMDNSVIAYYGHKSENTLAAAVRAGKLSVLDLTDVRDDGNDPLRPVIARACEWIEE
FT                   ARARGGKILVHCRVGVSRSASIVIAYMMQYEHMRLMDAYMVCRARRLNVLIQPNLRFFH
FT                   ELFGWEVELAKREAEAAKARREEAEKQGVRDPEALKLIEGEARKIIYSWPSFCRDLYCL
FT                   NRRFLCN"
FT   gene            341720..343375
FT                   /locus_tag="CNH02790"
FT   mRNA            join(341720..341814,342000..342053,342115..342276,
FT                   342362..342452,342528..342734,342799..342877,
FT                   342951..343052,343106..343375)
FT                   /locus_tag="CNH02790"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(342050..342053,342115..342276,342362..342452,
FT                   342528..342734,342799..342877,342951..343052,
FT                   343106..343189)
FT                   /codon_start=1
FT                   /locus_tag="CNH02790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45144"
FT                   /db_xref="GOA:Q5KCZ8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ8"
FT                   /protein_id="AAW45144.2"
FT                   /translation="MSCCSQIPPVQAEYTPKGSYTTFNDLKTYAVGPEDVKVAVLVVYD
FT                   VFAFSPQILQGADIIASQGYRVVMPDFLVGNYATPEMFKPGNEEMKAEYFSKFPGACGS
FT                   QSEPVAKAINGLKAAGHNKVAVIGYCWGYKTAVLSEAGLAEADAFISVHPTFPAAEDAD
FT                   KINVPLAMLSSSGENISIINAIQKGVESKNPGKNFFKHYPEQVHGFAAARADLSGGAAT
FT                   EAYAEAYQLIIKFLRDQVSA"
FT   gene            complement(343350..344601)
FT                   /locus_tag="CNH02780"
FT   mRNA            complement(join(343350..343565,343626..343782,
FT                   343840..343923,343993..344080,344348..344601))
FT                   /locus_tag="CNH02780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(343689..343782,343840..343923,
FT                   343993..344080,344348..344474))
FT                   /codon_start=1
FT                   /locus_tag="CNH02780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45258"
FT                   /db_xref="InterPro:IPR007727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ7"
FT                   /protein_id="AAW45258.2"
FT                   /translation="MSNSTSSTPTKNTATPSPTITPLHDPSHQAKVIPAKPLGVSNPNI
FT                   VPGMTTNGAAAGLGQKALLAKKFAKANKPTISPTDQLQSPCTAKLSNAKQRHFAKGKPA
FT                   SLSQSFVAIRESSGAAPSPVNRKTDF"
FT   gene            complement(344957..347746)
FT                   /locus_tag="CNH02770"
FT   mRNA            complement(join(344957..347177,347260..347638,
FT                   347694..347746))
FT                   /locus_tag="CNH02770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(345577..347177,347260..347638,
FT                   347694..347717))
FT                   /codon_start=1
FT                   /locus_tag="CNH02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45143"
FT                   /db_xref="GOA:Q5KCZ6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ6"
FT                   /protein_id="AAW45143.1"
FT                   /translation="MHEPPHGTASRQAALHKALSTAYLNHQIAELENRVNAAHIKSPAP
FT                   QAKAKAKGGDSARSPDASARQLQPQPQPPQQPPGDPNDDLGRPDDVEIDVDDEAEDWRV
FT                   VVVDISALMWAKNAVKRLVAKGWEVIIPAEAISTLDLLKKGSNATAVAARQAARYIEHA
FT                   LRFHDVLSSDPSLAIQSGTNYKRGSGMRLQRAKETASVNSIVDELAIPPMDGEEDLPKW
FT                   VEAVFSCVAYFKKIMDAEEKEWDAEDNGYERERGPILYVGNPPVFVELEQGRAEPTPSA
FT                   RDGDAKDGLDYMARAEGHVILQEAARFDLTLQVLRDDDVEVEASGLGGKKQRERRRGRK
FT                   RGGDGGKRRDREAAKKEPEPEREVKILLRRPSPTREASPDSYPSHLPSPTSPIIPGPEI
FT                   KSRDHPRAPPLLVRPPPLPSGRPPPPVPPPQSKGLHHHHRPPPPPPLAPESGVDMGLRM
FT                   GMHTRPHPNPEMRPSLPLHPSMAHHLENGIPRDGGGGGHHHYPHPHLGHHRPPPPPALF
FT                   DELSDGSRGAHGHGRRGGHGGHGGHGGHGFGRGRGGHHGHGGGGGGGGGGGGGGGGGGG
FT                   KGHGRRLKNRDNEFVLLQRPHSFVRPPPPGRPGQSQTPGSELFPSINTAPAGAAGANAG
FT                   AGASSGNGKGNGKSSMPRIDDDPPVVLLQRPK"
FT   gene            347876..348607
FT                   /locus_tag="CNH02760"
FT   mRNA            join(347876..347981,348029..348607)
FT                   /locus_tag="CNH02760"
FT                   /product="50s ribosomal protein l19, putative"
FT   CDS_pept        join(347912..347981,348029..348546)
FT                   /codon_start=1
FT                   /locus_tag="CNH02760"
FT                   /product="50s ribosomal protein l19, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45142"
FT                   /db_xref="GOA:Q5KCZ5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ5"
FT                   /protein_id="AAW45142.1"
FT                   /translation="MPSPLRPLARALRHFSSAPARASSYPFNPSAIARPSTTPLPPPPA
FT                   LLHPKNGWSLITHLNNAAAQSPWAHLFARRSKDRLPAGSVLTVITYSDPARKSISPFSG
FT                   VLMGTKRRGVDTCFRLRNIVNKAGVEMTFKLNSPMIKEIKVVKRAEKAKGQLKDLKRAK
FT                   VNYLRERPAVMAAIARALKTAKQNEAAAGESS"
FT   gene            complement(348583..351911)
FT                   /locus_tag="CNH02750"
FT   mRNA            complement(join(348583..348981,349048..349185,
FT                   349244..349529,349592..349821,349896..350624,
FT                   350685..350881,350946..351423,351498..351911))
FT                   /locus_tag="CNH02750"
FT                   /product="protein phosphatase PP2A0 B subunit gamma
FT                   isoform, putative"
FT   CDS_pept        complement(join(348946..348981,349048..349185,
FT                   349244..349529,349592..349821,349896..350624,
FT                   350685..350881,350946..351423,351498..351521))
FT                   /codon_start=1
FT                   /locus_tag="CNH02750"
FT                   /product="protein phosphatase PP2A0 B subunit gamma
FT                   isoform, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45141"
FT                   /db_xref="GOA:Q5KCZ4"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ4"
FT                   /protein_id="AAW45141.1"
FT                   /translation="MKGLKKAMNLSRTKSSEKSKSPNPPAHKQSTASSGPSSPSVNSPS
FT                   RQASDAPGLQGGAPITPRRSPINDKTSPAPPLVVISGAPQPPPINTEMPSDPIPHSPHG
FT                   RYGSPERTLGADGQPTPPKVGPMNRLRGPKDTIPAVGKTPRKQRSSRFYVTEKVEIEKL
FT                   PNFADVRPEQRNELFVQKLQQCRVVFDFNDASSDLEGKQIKSQTLHEMLEYITSQRGVI
FT                   TESIYPEVVSMFATNLFRSIPPQVNPTGDAFDPEEDEPVLELAWPHLQIVYEFFLRFVE
FT                   SPDFNTNIGKRYIDQSFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLNLRAFIRRSIS
FT                   HVFFQFVYETERHNGIAELLEILGSIINGFALPLKEEHKTFLTRALIPLHKAKSLALYH
FT                   PQLAYCVVQFLEKDPALTEEVVLGLLRYWPKVNSPKEVMFLNEVEEILDVIEHNEFIKI
FT                   MQPLFVQLARCINSAHFQVAERALYYWNNEYIVNLMGEHISIILPIVFPALYQNSKTHW
FT                   NRTIHGMVYNALKLFMEINQEVFEECQNNYRAQRKAESDRAIERYDEWLQLREQAIQNW
FT                   ESAHPSSPLPERLQEPPPPRPEPYEDEPMMDVSVDMTANGFDPSESFTLDRSIAEETVP
FT                   VADPGVDRAPPLSPTSPTQLLGQQGQAPSSPTPSGGGTAPHLRRKSVLPIDAGVMRDLQ
FT                   NHRSLENDANP"
FT   gene            352112..353070
FT                   /locus_tag="CNH02740"
FT   mRNA            join(352112..352157,352250..352375,352506..353070)
FT                   /locus_tag="CNH02740"
FT                   /product="ubiquinol-cytochrome c reductase complex 7.3 kda
FT                   protein, putative"
FT   CDS_pept        join(352140..352157,352250..352375,352506..352562)
FT                   /codon_start=1
FT                   /locus_tag="CNH02740"
FT                   /product="ubiquinol-cytochrome c reductase complex 7.3 kda
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45140"
FT                   /db_xref="GOA:Q5KCZ3"
FT                   /db_xref="InterPro:IPR008027"
FT                   /db_xref="InterPro:IPR036656"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ3"
FT                   /protein_id="AAW45140.1"
FT                   /translation="MPGFQDVIYNTFFRRNSVFVATTFIAAFSFSMGFDLATTAFWDSH
FT                   NRGKQWKDIRHKYIEAAGDDE"
FT   gene            353090..354310
FT                   /locus_tag="CNH02735"
FT   mRNA            join(353090..353387,353459..353573,353640..353836,
FT                   353889..354310)
FT                   /locus_tag="CNH02735"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(353173..353387,353459..353573,353640..353836,
FT                   353889..354165)
FT                   /codon_start=1
FT                   /locus_tag="CNH02735"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5T5"
FT                   /db_xref="InterPro:IPR000479"
FT                   /db_xref="InterPro:IPR009011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5T5"
FT                   /protein_id="ALO69512.1"
FT                   /translation="MKDKPCTLTLEDGTRYDLTQLASAKADYVTNVGDITYVFNVCRRV
FT                   VSEVYRIEEPENVGAFMRDGYADFSLGEVNTTLTLSPMTDDPMIIMTDGSICPGNPGQT
FT                   ASTAIRFVCSQSDFNADKPIFITSLPPQDPCQFYFEWNTHLACRPGRKSPTRPTFPKGE
FT                   LDTHHYYFAFAVFLVIVLLTWFGGLTLYNRLYLKRRGLSQFPLPTFDYQSISIPSRNSN
FT                   EQPGPNWDPSRRRSNRSGGYGHVRAEGHDGEERFAARYSLEEERD"
FT   gene            354587..356586
FT                   /locus_tag="CNH02730"
FT   mRNA            join(354587..354785,354865..354941,355020..355087,
FT                   355143..355263,355322..355454,355509..355921,
FT                   355989..356158,356226..356586)
FT                   /locus_tag="CNH02730"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT   CDS_pept        join(354652..354785,354865..354941,355020..355087,
FT                   355143..355263,355322..355454,355509..355921,
FT                   355989..356158,356226..356468)
FT                   /codon_start=1
FT                   /locus_tag="CNH02730"
FT                   /product="NADH-ubiquinone oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45139"
FT                   /db_xref="GOA:Q5KCZ2"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ2"
FT                   /protein_id="AAW45139.1"
FT                   /translation="MLRNLRPLLRTVPAPSRSVIRPLSTTSKAFATAQSSPVRAHSVEE
FT                   LHALTAEEILKEGGVRKEAEMRHFTVNFGPQHPAAHGVLRLILELNGEEILRADPHIGL
FT                   LHRGTEKLIEYKNYTQALPYFDRLDYVSMMTNELSYSIAVERLLNIEVPERAKWIRTLF
FT                   GEITRVLNHLMAVLTHAMDVGALTPFLWGFEEREKLMEFYERVSGARMHAAYVRPGGVA
FT                   FDLPHGLLDDIFKWATQFSSRVDEVEEVVTGNRIWKQRTIGIGPVTAQQALDYSFSGVM
FT                   LRGSGIPWDIRKVAPYDAYDKVEFDVPVGKNGDCYDRYLCRVQEFRESLRIIGQCLNKI
FT                   PDGAYKVDDHKIVPPPRASMKESMESLIHHFKIFSEGYSVPPGETYAAIEAPKGEMGVY
FT                   LVSDGTNRPYKCKIRAPGFAHLAGADFMMRHHFLPDAVAIIGTMDLVFGEVDR"
FT   gene            357300..359018
FT                   /locus_tag="CNH02720"
FT   mRNA            join(357300..357454,357521..357619,357676..357767,
FT                   357824..358080,358142..358430,358483..359018)
FT                   /locus_tag="CNH02720"
FT                   /product="expressed protein"
FT   CDS_pept        join(357365..357454,357521..357619,357676..357767,
FT                   357824..358080,358142..358430,358483..358924)
FT                   /codon_start=1
FT                   /locus_tag="CNH02720"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45138"
FT                   /db_xref="GOA:Q5KCZ1"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR037470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCZ1"
FT                   /protein_id="AAW45138.1"
FT                   /translation="MSTSRPRIDSLRSSSTIDHSVWGARAPSPSFSTTTTGSKVNLPEN
FT                   HALITRKDLRQSITCFEELMAAAKAYRNALLAMSSATAAFATAMEACSRVKGCRSSNSA
FT                   LAGAGGLQYLISNHEQLLADTVYRQFEIPLLDALDNYKMITADRLAAYDKALHEQSQKI
FT                   RKTEAENLKIGRRRKRDLQQFRQALGELQKQVDELDSIKAGYHEEVLEGEEEVWETVLG
FT                   RVTFVIRSQLDFYEKIAGKASDPILEPMVMSIPDPFDAYGPPKEEGQIFSVLAPLSLLD
FT                   SSAPQSPTPNLPRVLSPPPMSATTSGRPSSPSDVDGTPTRLSPAPREPGPNSESVFGQH
FT                   DTWLEDASGSSGTSGVSDMGNGTARSRRELSIIDEGDITVNGKDNDQGESNGDGDGGGG
FT                   AGVKAVKNSLGGKINGLPTKNNE"
FT   gene            complement(359085..362189)
FT                   /locus_tag="CNH02710"
FT   mRNA            complement(join(359085..359281,359367..359671,
FT                   359761..359902,360041..360295,360377..360673,
FT                   360747..361177,361243..361580,361640..361731,
FT                   361786..361831,361892..362189))
FT                   /locus_tag="CNH02710"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(359129..359281,359367..359671,
FT                   359761..359902,360041..360295,360377..360673,
FT                   360747..361177,361243..361580,361640..361731,
FT                   361786..361831,361892..362154))
FT                   /codon_start=1
FT                   /locus_tag="CNH02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45137"
FT                   /db_xref="GOA:P0CM88"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR021718"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM88"
FT                   /protein_id="AAW45137.1"
FT                   /translation="MIPRRHHFKPAPQPTVQVLQPPDEDAPSLTITMLGAGQEVGRSCC
FT                   VIEHRGKKIVCDAGLHPAQPGIGALPFIDELDWSTVDAMLITHFHVDHAAALPYIMEKT
FT                   NFKDGNGKVYMTHATKAIYGLTMMDTVRLNDQNPDTSGRLYDEADVQSSWQSTIAVDYH
FT                   QDIVIAGGLRFTPYHAGHVLGASMFLIEIAGLKILYTGDYSREEDRHLVMAEIPPVKPD
FT                   VMICESTFGVHTLPDRKEKEEQFTTLVANIVRRGGRCLMPIPSFGNGQELALLLDEYWN
FT                   DHPELQNIPVYFASSLFQRGMRVYKTYVHTMNANIRSRFARRDNPFDFRFVKWLKDPQK
FT                   LRENKGPCVIMSSPQFMSFGLSRDLLEEWAPDSKNGVIVTGYSIEGTMARTLLSEPDHI
FT                   ESLKGGNVPRRLTVKEISFGAHVDYAQNSKFIQEIGAQHVVLVHGEASQMGRLRAALRD
FT                   TYAAKGQEINIHTPKNCEPLTLTFRQERMVKAIGSLAATRPEHGTSVKGLLVSKDFSYT
FT                   LLSPADLHDFTGLSTSTIIQKQGVAISVDWAVVRWYLEGMYGEVEEGVEEEGKAAFIIM
FT                   NGVQVVQISPTAVELRWKSSSSNDMIADSALALLLGIDGSPATAKLTASPNKHACNHSN
FT                   SHSHTDLYPHTYPGDKSAKDVASNPEFERLRMFLEAHFGHVEGPNLRPPLPPGADGDGN
FT                   DDKDKDGDDWLTMDVKLDNQTARIDLISMRVESESAELQKRVETVLEMALTTVKSLSQT
FT                   FLGGGLDVDMVKVEPNESDS"
FT   gene            362341..365577
FT                   /locus_tag="CNH02700"
FT   mRNA            join(362341..362446,362513..362603,362659..362746,
FT                   362798..362978,363083..363227,363331..363389,
FT                   363451..363543,363604..363692,363761..364556,
FT                   364615..365577)
FT                   /locus_tag="CNH02700"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(362350..362446,362513..362603,362659..362746,
FT                   362798..362978,363083..363227,363331..363389,
FT                   363451..363543,363604..363692,363761..364556,
FT                   364615..365366)
FT                   /codon_start=1
FT                   /locus_tag="CNH02700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45136"
FT                   /db_xref="GOA:Q5KCY9"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY9"
FT                   /protein_id="AAW45136.1"
FT                   /translation="MSTTIQQGDTDTGAGNHLPAWLLAMSGIFTAVATAISMMSIVLQL
FT                   KNYRKPTLQRAVVRIMVMVPLYAISSLIALFSLEAAFFIDAIRDLYEAFVIYTFLQLLI
FT                   TYLGGERSLLIILHGRPPIPHPFPVNIFLQPMDVSDPWVLLNLKRGVLQYVQVKPLLVL
FT                   ATVALKATGTYQEGRFAADSGYTYVSIAYNTSICLSLYCLAMFWVAVNKDLKPFRPVPK
FT                   FLCVKGILFFSFWQSIGISLLVAMGAIRKVGPYTDPEHMSLALVDSLICFEMPIFAIAH
FT                   QYAFQASDYIDHNLVYAARLPFIYAFRDAFGFKDVWQDTIDTFKGRGVSYQAYEPAEGG
FT                   LHYGVGRQKRIRAGLRYAKGGKMKYWMPKPGDEARMKGQSGLITSMKRRVDERLAEREG
FT                   YAPLLPQQAARVVHLDPGRYTTYTGGERMFDSDSSDDSDAPSLTFHSADEMEDAMYDRA
FT                   RRIGYAGFPNVDVSKEEARRKRREEEEGILKGRWTRSGLRVRDGTGLGGGEGQGEGRMR
FT                   AGSAAKGKSNGKNKDKGKGKGQSRKVYGTWADHPPSVQRFNSSSSSTRNGNGNGHPADF
FT                   DEADDEGVVRQEEEGRAIKKKRQRQSPPVWVTRTGATTGVGSSSSPFSIGDDDDDDDED
FT                   GEGVKNRETQGDRSMSFNHPDNSSHNSDSDSEHSVKPSTTKKLPADAVDLVKEDYEAVE
FT                   AARERERRRGEPQTNAPAHVYRKTIIDEIPETDTNAGAMKRRRGIGGRIEEIQEVYAHD
FT                   PHVMTKDEIQTGVKEVVDHVETSLTVEPPKHAMSLDLEDNPWS"
FT   gene            complement(365478..368097)
FT                   /locus_tag="CNH02690"
FT   mRNA            complement(join(365478..366037,366113..366522,
FT                   366592..367049,367104..367655,367711..367926,
FT                   367988..368097))
FT                   /locus_tag="CNH02690"
FT                   /product="ATP-dependent RNA helicase, putative"
FT   CDS_pept        complement(join(365573..366037,366113..366522,
FT                   366592..367049,367104..367655,367711..367926,
FT                   367988..368064))
FT                   /codon_start=1
FT                   /locus_tag="CNH02690"
FT                   /product="ATP-dependent RNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45135"
FT                   /db_xref="GOA:P0CR08"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR025313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR08"
FT                   /protein_id="AAW45135.2"
FT                   /translation="MDAPVPAAPAFGGSWAKLNPPLSPWILDVINSMGFKNMTPVQAGT
FT                   IPRAVKNQDCVVEAVTGSGKTLAFTIPVLERLSRREEPYKKGEIAAIVVAPTRELATQI
FT                   HAVFHHFLSSLIPPESEEETGDVEAHAPPFASSSRSPSPQTPDKPLFPLPMLVTSGTPT
FT                   PYETFQSTHPSILIGTPGRLAAFLLNPRGLAIVRVSELDVLVLDEADRLLSSPDHRRDV
FT                   ERIMRHLPKQRRTHLFSATMTDAVEEMIGLGLRNPVRIVVNLKDKRKDGEEPKERRTPM
FT                   ALQNTYLVCRHAEKTLQLIRLLLCESTKHERSKFIVYFSTCAAVDYFYRILSRLPSLSK
FT                   FHLTSFHGELPPKIRETALSTFTSHPSSHLSPAVLLCTDVAARGVDFLDIDVVIQYDAP
FT                   TDPKTFSHRAGRTARAGRRGKAVVLLGKGREEDYVDFLNIRKIPLTKQPYINAYLEEVD
FT                   TPQALDPEATTLLHSIRQIILTDRELSDKAAKSFVSAFRAYSKHEASFIFRTLDFDFNS
FT                   QAISFGLLRLPAMPEIKDWKKKKEAERQRLEKIKSEGGEVEEKEIIEWEDAGVNWDTFA
FT                   YASRQREAARLATLAQRADNQSSNDAARAEARAKRKIKAEMREAWSEQKERKVRKEERK
FT                   EKKDAKKKYEWELEQANGEGDRQSDLANIAKAQAERKKRREREEESWDEEIGKEYKSLK
FT                   REIKEEKSVKESSKGGAGGGGIGGGMFDDLE"
FT   gene            368278..370299
FT                   /locus_tag="CNH02680"
FT   mRNA            join(368278..368542,368600..368984,369057..369186,
FT                   369283..370299)
FT                   /locus_tag="CNH02680"
FT                   /product="h-sco1, putative"
FT   CDS_pept        join(368342..368542,368600..368984,369057..369186,
FT                   369283..369427)
FT                   /codon_start=1
FT                   /locus_tag="CNH02680"
FT                   /product="h-sco1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45134"
FT                   /db_xref="GOA:Q5KCY7"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017276"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY7"
FT                   /protein_id="AAW45134.1"
FT                   /translation="MNTLRATLSRPSTSFRTAVLPRFSALPPAPRLAAQAVFARRFASE
FT                   TPPSQSGLDQQQQKARDQSTVGPFTWKAASLFLLTGVGLYMYFESEKAKVQDRRRQENA
FT                   SKSVGRPSIGGPFTLTTHKGETFTEQDLRGKWSLIYFGFTHCPDICPEELDKMGEAVEM
FT                   VDKATGKADVTPIFITVDPARDTLPQVNKYIQEFHPRMIGLLGDYEAVKKTCKMYRVYF
FT                   STPPNATAADDYLVDHSIFFYLMDPLGQFVDAFGKATSAEQVAEKVLDSMRKWEAAGGN
FT                   AAAGL"
FT   gene            complement(369506..371384)
FT                   /locus_tag="CNH02670"
FT   mRNA            complement(join(369506..370380,370436..370646,
FT                   370709..370923,370977..371384))
FT                   /locus_tag="CNH02670"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(369571..370380,370436..370646,
FT                   370709..370923,370977..371303))
FT                   /codon_start=1
FT                   /locus_tag="CNH02670"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45133"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY6"
FT                   /protein_id="AAW45133.2"
FT                   /translation="MSTSKSPSLDLCLATLHELLHPAPILSLLLSALNLSAHFQLFARQ
FT                   LSSDAGLIAAFHEKHYHIVHESSIDEEEEISKGYLLDSSEGEKVKHIRYRKEEIFDASI
FT                   RLRKHHIATSLAMVKRNPRQVKVLIDLYFPDIDPEDHSYRKNEHLFLSCMKRSQARKMV
FT                   EERKTVIKWYKDAIEVFDAHEPPLPYRTFFYGETSSFAHGKVLSQALLEECQEVVQEAR
FT                   DFEALLAGDGSWQGEKWASSKRKGRDVRRYTMTATVTDSKSTNRSPPAVKPPRQPRISL
FT                   PANLDVNLNSPPSTDNDKRTISPPSDSESVRARTLPRLSFSSSSIRKTSSAQLRDGHQA
FT                   DAERTPSRAPVHTNAQKAVSLIGKTGATSPPPSRTTYPEKSSESSRRQPCHPEVTDKRV
FT                   TLPASAPLSPSSPRTKAKEPVKLNKETESEWAAKERRVEEARLRRSLGGAKLGDGNGEG
FT                   MGIDVTPAIPTQKPATPASPQAKTTLAKKKRPRQSFPLSGPEFSRGTGSGTGSANKRPK
FT                   VIE"
FT   gene            complement(371391..373198)
FT                   /locus_tag="CNH02660"
FT   mRNA            complement(join(371391..372319,372374..372691,
FT                   372765..373198))
FT                   /locus_tag="CNH02660"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(371813..372319,372374..372691,
FT                   372765..373127))
FT                   /codon_start=1
FT                   /locus_tag="CNH02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45132"
FT                   /db_xref="GOA:Q5KCY5"
FT                   /db_xref="InterPro:IPR035426"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY5"
FT                   /protein_id="AAW45132.2"
FT                   /translation="MPRPGQQAARRKRARVSTTPAPSTNQEEPGSPNPRARCLPVADLP
FT                   ADFDGVPEDGAQYLAMVMRNNEELPWSTRMEGWTPAVENETEVRPDSGQPAGTRHMALP
FT                   QGSWEVLFPLHFQNYRKNLAESWPPSPPLPYPQEYPPLPEANRRSEWYMFINGYSMEQY
FT                   SKPLQRGTKGKERAFELTEEEAMNEGASDNQNAQGANGESSAELKGKRGKHREPLVSVV
FT                   QGLNSNEAVRILSHFAHWLTESITQLPPPFPTSPELLPTQPDGPMNPPSPASSSTARPP
FT                   NPFPPHYAQWILALLMIVDSHLSGGQISTLRDLARAAMRVAGWRWIRGVVARDVSEGWK
FT                   LGGQGWRLVTASTENEGDEEENVDEMLARCWVVVHAVVAGWAQRDLLDDLENLFK"
FT   gene            373317..374905
FT                   /locus_tag="CNH02650"
FT   mRNA            join(373317..373465,373518..373595,373654..374429,
FT                   374482..374640,374700..374905)
FT                   /locus_tag="CNH02650"
FT                   /product="chorismate synthase, putative"
FT   CDS_pept        join(373376..373465,373518..373595,373654..374429,
FT                   374482..374640,374700..374862)
FT                   /codon_start=1
FT                   /locus_tag="CNH02650"
FT                   /product="chorismate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45131"
FT                   /db_xref="GOA:Q5KCY4"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY4"
FT                   /protein_id="AAW45131.1"
FT                   /translation="MSSFGTLYRVHTYGESHCKSVGCIVDGVPPGLQLTEADIQTQLSR
FT                   RRPGQSDITTARSEFDTVHVQSGTEHGVTLGTPIGLLVHNKDQRPHDYAETDLYPRPSH
FT                   ADYTYLAKYGVKASSGGGRASARETIGRVAAGAIAEKYLKEAFGVEIVAFVASVGKTAL
FT                   PFADEEDEVLGKAYMDLVQTVTREEVDKEITRCPHKETSKKMEETIRAAKAKDDSLGGS
FT                   ITCVIRRCPLGLGEPCFDKLEAVLAHAMLSIPSTKSFEIGSGLRGSTFPGSLHNDPFVE
FT                   GVDEKTGGRRLRTVTNWSGGVQGGISNGEDIYFRIGFKPPATIAQEQSTARYDGSEGVL
FT                   AAKGRHDPCVVPRAVPIVETMAALVIMDMVLQQNARLTAASLLPDLTHLPPTMVLPGKS
FT                   TVQKIREGQSVGEVQSQKVGEE"
FT   gene            375211..380031
FT                   /locus_tag="CNH02640"
FT   mRNA            join(375211..375768,375836..375977,376046..376787,
FT                   376845..376996,377048..377147,377203..377464,
FT                   377521..378082,378150..378212,378270..378452,
FT                   378523..378695,378749..378822,378896..380031)
FT                   /locus_tag="CNH02640"
FT                   /product="specific transcriptional repressor, putative"
FT   CDS_pept        join(375380..375768,375836..375977,376046..376787,
FT                   376845..376996,377048..377147,377203..377464,
FT                   377521..378082,378150..378212,378270..378452,
FT                   378523..378695,378749..378822,378896..379866)
FT                   /codon_start=1
FT                   /locus_tag="CNH02640"
FT                   /product="specific transcriptional repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45261"
FT                   /db_xref="GOA:Q5KCY3"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR034732"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY3"
FT                   /protein_id="AAW45261.2"
FT                   /translation="MSTSETQIPALPSSGGRPSHPSSSSSAASISNTSIPSVVEQQNGI
FT                   PIPPTNIPEEAVSGTVTASTSDTPQASRNSQVPTEENTKSIDLQEPTVPEKNASVEEPS
FT                   GVESSEVGGEDQEIKEGPKFIQPDHFSPLTNNPNGSRPARGIPNIGDGWLSPEDDPHAL
FT                   RGIPVFKPSMEEFLDFEGYARKTTAWGQYSGIVKVIPPAEWIESVPPITKSSLASVRVT
FT                   DPIQQNLIGSSGLFRIANVVRNKRRPLTVEEWFKKCKDKKFSGPGPKDVGSTTNRDSKE
FT                   AEERRQRVRDDMRKEKEKRREKRLAAEANRARKATGIEDIKEEEEVNGQAPSVLDRKDE
FT                   ASTEFVNNPQECQPASLEPDSRTKGIMVEKSINSWYESFDPKEDWLPENTRREDYSLEA
FT                   CVALERRFWKNMGLGEPSWYGADMEGSLFMDEKTPWNVAHLPNLLNRWDLRHLPGVNAP
FT                   YLYFGMWGASFAWHVEDMDLFSINYIHFGAPKFWYAIPQQQAERFERILQGYFPEDARN
FT                   CDQFLRHKSFAVSPYRLASDGMRVNMLVHNQGEFVITYPRGYHAGFNMGFNCAESVNFA
FT                   LDSWVELGRRAKACNCVNHSVRIDVDEMLAKDAVRFQGEEELLSAIAEERNKKRQHRRP
FT                   SAGDNHTPRKRAKPDSQTPSGGLVSSHTPIVIEATDQSKPVKVPGKRTPKAVIDISSNQ
FT                   QRAKANSIKDPNSFPCLFCPGFARDDLLPVFDPSDSVKARWKPRHGEVMAHHSCALAIP
FT                   GVGIEDREVPGGLGTFVVGVENVESARWKLKCLLCKDKKLQKTGAKIQCTKGKCPRAFH
FT                   VSCARESDVANLKIWEVETPMLPREGEPPLPEGAEVPTMIDIKVELLCPQHNPEVKEKL
FT                   EQRKAETFRDKVMSIPSGSKIKIKVRTGASLEYTLVEARETTQQVYVHDAQGVGGIFPW
FT                   SSIDLRPAQGPLLENEYARTHLFANNRRHDQTNGAPSQDDPSEAQRHLTSQEFKQPAQS
FT                   AHSRPLRMDEILNPSPKKSKKLNPGAGLPQRESMPEPASYNSYPPHGSVHRSANHLHFH
FT                   PASHPESHPQHPRSQFPTPIPPLQVSHRMSYDLGLHRQTHQSVPQQVFYPQPPSQEHQP
FT                   LHSIPHPPISRRPHHPIPPSDTSQRVANHQAPHDSYYPRPASVPMLHRYHHQPLQPSYP
FT                   SRYQTPPQTHYPSHPYPRHEPHIQPPAPSAHPMNNQATDASHFHGQMYEPYRRHSAPHP
FT                   VYPTHFMSSVNSVTAEQTRVWDRKASAPNGAVHPSIPDGYRQGYY"
FT   gene            380499..383315
FT                   /pseudo
FT                   /locus_tag="CNH02630"
FT   gene            383572..385403
FT                   /locus_tag="CNH02620"
FT   mRNA            join(383572..383693,383763..385403)
FT                   /locus_tag="CNH02620"
FT                   /product="dihydrofolate synthase, putative"
FT   CDS_pept        383766..385376
FT                   /codon_start=1
FT                   /locus_tag="CNH02620"
FT                   /product="dihydrofolate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45262"
FT                   /db_xref="GOA:Q5KCY2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY2"
FT                   /protein_id="AAW45262.1"
FT                   /translation="METMPGPSKKMETMSDPSETENPPHIEAADQEIYTSSSSTSAADS
FT                   SATGLGEIDLGLLRMQILISAFPPLLVPAIHLAGTNGKGSVSALLESCFLSAGFRVARY
FT                   NSPHLLEPRDALRIDGLPPTEGQWEEAVRIVKEIDKERKVGATVFEITTAAAYWLIYNT
FT                   TTWCKGGVDVMIIECGMGGARDATNVIRADTVLASALTSVGLDHTAFLGETVEEITKEK
FT                   ASIAVQDAVFVIGPQQYEGVVDMARMTAEERGAKVLEALRTERVSKEIDGQVMSLRPFE
FT                   APRPVEVRTWLPSIPTATASSSSRRTRSSDRNRNSNSSSITTQLSLPGNHQLDNLSVAL
FT                   TILHGIRHDTRAKQILPLLEKLTDAAIQQGVASCQWEGRCSWVHYVENDRGKRHNFLVD
FT                   GAHNSDSAKVLREYIDSLLIKEKTDQKPRFRFIVSLSASPGKSIDSVLSPLLRHGDEIE
FT                   VVEFTTPVQNMPWIKAVPREEVAQTAGQLLGEEAVSIGGIGEDGVRDALRNAKSSGRLA
FT                   VVCGSLYLVADAYRLLRGG"
FT   gene            385537..388528
FT                   /locus_tag="CNH02610"
FT   mRNA            join(385537..386024,386091..386252,386305..386384,
FT                   386459..387163,387238..387321,387410..388528)
FT                   /locus_tag="CNH02610"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(385586..386024,386091..386252,386305..386384,
FT                   386459..387163,387238..387321,387410..388060)
FT                   /codon_start=1
FT                   /locus_tag="CNH02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45130"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY1"
FT                   /protein_id="AAW45130.1"
FT                   /translation="MPQAKSLDALPPELLSRTALHLVAASPRRHPSALLPLFLTCRAVY
FT                   HAISLPNNPQLYKDLYFATFDYSAVLRRCQWMETHIFKDGYNILNLLSDPRLWALDYTT
FT                   RWEMSRRMRQIAKLGRVEIPGVCDRRQFMQDMWTVWFLVTENDGRNLPFLLEQCNLRAA
FT                   LATYYRDTLLKESLQPGYPTEDGEKALVAWTCIFAGIDTVGEDTPEEVDEKIFMLRPYV
FT                   FACAKYDVSFAPWHLKKLPVCDPGCSSHGADPTVRYRAMTYKRFGYSWRRCPPQFVLGA
FT                   YVLFLRLLERHPNRIGLRSGSSSFSYSPFEVGLPGVFSTNKVPLSIENDKEWQRNTMCQ
FT                   DSHTNEGLLPLTYRGSIQGFWRGKFLFYDFEFYREILSGNLRGVYTGMFAEQAVEAELR
FT                   ETLVKVKKEDVGGDGPLLTAGFKDMGSLEEETKFLEQGYGHEIVHEDDEDEEGWTKEIL
FT                   ISGRGRTAWGWAQIRGRVRAWDGLVILCLSYSPQREPGTRWLWRGYILTGGYLVGRWRD
FT                   TFTPETLRGYEGAFGLIRAGDIYYPEHFPKRMDDSAGVNQFDQGVFRQMPITGESLPSA
FT                   GLGTGSSVPSISGSTLTSECNQNQSQSQSQSHNQSLQDQSQIQRVPAGHSHPHHHPHQP
FT                   LQPVMRKDLHVVPQEPLQTAPSTLSQSQSQPRSQLQTQPQPQTQTQTETPSQSRPQTLS
FT                   PEHDPGTKSGRQ"
FT   gene            388879..390430
FT                   /locus_tag="CNH02600"
FT   mRNA            join(388879..389276,389373..390430)
FT                   /locus_tag="CNH02600"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(389021..389276,389373..390382)
FT                   /codon_start=1
FT                   /locus_tag="CNH02600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45129"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCY0"
FT                   /protein_id="AAW45129.1"
FT                   /translation="MAAQAASAAQSDDGFLDQLIASMPKSTVPPESGVGPAAPKKEVTV
FT                   EDFEKLLDSTPLFMRETPKDGDDNPVLEALRSLVFEGEGDEIATNFKNHGNELHAQKSY
FT                   GEAIKAYSEGIDAHPSSATLLVTLYNNRAACHLILKNYRSALKDTSAVIALYTAGKIPQ
FT                   PDKALVKALFRAAQSLVQLSRWKEGGDVVERGKELAEQVKEDTKVWDTLEKEVVKGKKR
FT                   DDDRVERIRRDNMTKLALRKAVEDRGLIVVDTPSPPDNPHPLHFDEQSIPTINEEVGWT
FT                   PPPPHTPIVFPVFLLYPPYGQSDFITHFHEDAAFEDQLSAMFPVSPSAPQIPWAEWDEK
FT                   HEYYVPNLAVYVETKERRLLKVGKELTLREVLGKARREAKGDVKKDGVVLRDGLLSFVV
FT                   LVKGAQEKAWIEEFKRQRDEKQ"
FT   gene            complement(390408..393260)
FT                   /locus_tag="CNH02590"
FT   mRNA            complement(join(390408..390709,390782..390854,
FT                   390917..390942,391056..391181,391289..391298,
FT                   391385..391498,391607..391669,391734..391768,
FT                   391835..392534,392610..392985,393055..393077,
FT                   393143..393260))
FT                   /locus_tag="CNH02590"
FT                   /product="cleft lip and palate associated transmembrane
FT                   protein, putative"
FT   CDS_pept        complement(join(390556..390709,390782..390854,
FT                   390917..390942,391056..391181,391289..391298,
FT                   391385..391498,391607..391669,391734..391768,
FT                   391835..392534,392610..392985,393055..393077,
FT                   393143..393242))
FT                   /codon_start=1
FT                   /locus_tag="CNH02590"
FT                   /product="cleft lip and palate associated transmembrane
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45128"
FT                   /db_xref="GOA:Q5KCX9"
FT                   /db_xref="InterPro:IPR008429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX9"
FT                   /protein_id="AAW45128.1"
FT                   /translation="MPPPQQAPQEGEQQQSKITGIVRSVAMFFAVQMALKYGMSYLGIG
FT                   QQNVPAKQPTAGDTASAPNVPRAQSAAVAPALPAWELGTPLSMVLYTSTSPTGQDIDPL
FT                   HPVVQWDGLTYGNWNDEREADLVLDVPESVLHNGSWWLDIVLVKDGGLPLNKQPGTVYS
FT                   QRKLLTRYYPKKRIRKEKKLIGGTEEDAEKIEEESTEVLPQQIVSHWSNNLTLSIISNG
FT                   GPISLQQLAPPTAPSYTFVDGPTEGTKVYYPPIFANDFWLMKESLSPINESTKTLPLHI
FT                   SYHALSNMKHQIYASMTMSFEQAAAQGGGGVEFDEIKRTLLETNPWLLITTAIVTLLHT
FT                   VFEFLAFSSDVSHWRKKDRDLVGVSLNTILTNCFVQLVILLYLHDSSEETSFMILFGQG
FT                   IGLLIEAWKITKVTNVRIRPAPNSFIGYSLQFENKRQLTEDEKKTQEYDALAFRIVSYF
FT                   AIPLLGAYTVYSLLYETHRGWYSFIISTLAQAIYMFGFVQLIPQLIINYKLKSVAHMPM
FT                   KAMMYKTLSTVVDDFFAFCIRMPWLHRLACFRDDVVFLVLLYQRWIYRIDYSRVNEYGQ
FT                   VNEGMVEDVGTADGAKEETKKTK"
FT   gene            393404..396953
FT                   /locus_tag="CNH02580"
FT   mRNA            join(393404..393494,393567..393694,393755..396953)
FT                   /locus_tag="CNH02580"
FT                   /product="phosphoethanolamine N-methyltransferase,
FT                   putative"
FT   CDS_pept        393758..396871
FT                   /codon_start=1
FT                   /locus_tag="CNH02580"
FT                   /product="phosphoethanolamine N-methyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45127"
FT                   /db_xref="GOA:Q5KCX8"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR037675"
FT                   /db_xref="InterPro:IPR039524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX8"
FT                   /protein_id="AAW45127.1"
FT                   /translation="MSEVSPQSQYGGEPDKPTTKSSSWLRNLSRSNLAALILFYVASLH
FT                   VIGLYVFTQGFLLSRLAIPHVSPAYNVSNPSPISATHSKAVIIVIDALRTDFISPYHPQ
FT                   PPSPHHHGVLSLPAELTQSRPEHSLIFNSFSDPPTSTMQRIKGITTGSLPTFIDIGSNF
FT                   ASAAIEEDSLVSQLVAANKRVGFMGDDTWMNLFPSSFHPNMSHPYDSFNVEDLHTVDNS
FT                   VITHLFPYLHPSNQSQWDVLIGHFLGVDHVGHRVGPHRDTMTEKLTQMNEVLEKVVDLI
FT                   DEETLLVVLGDHGMDDKGNHGGDSEMETSSALWLYSKGPMLTNPAVVQDKDTSAIFKSL
FT                   PTYIFPKSTMPLRQINQIDIVPTLALLLGVPIPYNNLGSVIPECFTNNLETLEVAQRVT
FT                   ADGIWRYVEAYGDKEVKENLNSAWRHAQSQYQKDNLSASIIAHRAFSLDALVHLRSLWA
FT                   QFSMPLIVIGSLILGLCALTLIALYVGVRNNGVNWDVYARLALETATMGSTVLASIAGT
FT                   VAGVYTARPIVAIKVFIVAAALISEVILILPLFVKSSLSLALPLPTSFSINRHIGPFIL
FT                   IVHALSFASNSFIMWEDRVVLYLISTIPIIYIIRALSAPTADMRLKIIFLSLAFTILSR
FT                   LAGTITICREEQQPYCSVTFFSGVTATAPTWALIAIVPLALQIPRAIGITLSRSKSLAG
FT                   PAPFILGILWRAVLVANSVYWVLEFFESFDGLNPARIPLVNFLKLWLARCSAGASLGAI
FT                   PYVWLTSPLCISVERTTDQATGEEEVTVFGFANAFGSTYILYTLAPFALIHLVSQPMAQ
FT                   FTLTAFLIGLLVYLELVDTRRDAIILTTSFASLGNNKNNNNASSPAGLASFDPADTAQT
FT                   IVRPSFTDVVPIALSGFLTFFATGHQAVISSIQWKSAFVGFSTASYLFSPVLVVLNTWG
FT                   GFFLSAIAVPLLAIWNIAPRPRESIPTLAHALQVTLAFLVYHTVVAFASAITAAWLRRH
FT                   LMVWKVFAPRFMMAGVTLLVVDVGLALGLFGVRVTGWKVKKTFGCESI"
FT   gene            complement(396954..401178)
FT                   /locus_tag="CNH02570"
FT   mRNA            complement(join(396954..398320,398377..398522,
FT                   398578..398649,398706..400564,400639..401178))
FT                   /locus_tag="CNH02570"
FT                   /product="ABC transporter, putative"
FT   CDS_pept        complement(join(397201..398320,398377..398522,
FT                   398578..398649,398706..400564,400639..401092))
FT                   /codon_start=1
FT                   /locus_tag="CNH02570"
FT                   /product="ABC transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45126"
FT                   /db_xref="GOA:Q5KCX7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX7"
FT                   /protein_id="AAW45126.1"
FT                   /translation="MLLPALAIIHYTHPILLSLPLPFLLTPSSPQSRPPPGLVPITVQR
FT                   ISPRRTFILTLLALLAFTSFLDVIILVANALSARTRYGDDLPLYLTGAQLGGEIAYSLG
FT                   GLVAWGVALIACSWRNRFSSGLAVFASLGIIGEIVNLIWLVKREVHTGNSEKLFAILSL
FT                   IPSSSRLLILPLLFLATLSPRVSYEPASERSGLLDADSATNGRLLEPGTASAYGTFATG
FT                   TTTPANPPQAEEQTEQQRQEERAKQKKIKLTKALGSRRQPKKVLSWSEGWPKFKKLIPT
FT                   LWPSTDKKLQVYVIITAILILIQRFLNPLSPITLGWLVQALSSWQHRSDVWKALGAYLA
FT                   VRMVNSYDFISIAQQYFWIPVVQYTDREMQMVCFNHLLDLSLSYHTRRNTGEVMRIIDR
FT                   GSAINELFRTILFSVVPTLSDTVIGFSVFIWLFGPWITFGILAVMIPYCVFSILATRYS
FT                   QKFRREYVDTDVRQRGIVSDVLTNWESVKYFTSEHREVARFEEAVNEVMKVDYQWRMGL
FT                   QVIYAVQSLLLVTAFAVGAIFLSVKIMHGQATAATFVVYITYFGQFTQPLNQLSSLYKT
FT                   ISSDIIDAEKLLSLLGETTEIKDDPDAKEMVVTDGVIEFDNVTFSYDGTKDAIKNVSFK
FT                   LEKGQSLALVGQTGSGKSTILRLLYRFYDITSGHIYIDGQDISKVTQESLRKAIGIVPQ
FT                   DSVLWNDTIGANIAYGKPDASDEEIIEAAKAGRIHDKVMTFEDQYDTIVGERGVRLSGG
FT                   EKQRVSLARMFLKSPLILVLDEATSALDTETEREIQKSLSKLAEGRTSLSIAHRLSTII
FT                   NSDKIMVMKEGQILEIGGYKELIDKNGAFARMWKRQIYTEAELLEGDAIDKFASALPTA
FT                   DDFKAFRKEEYGEEKPQNGGGDNSEQTVAATSNSNGELKDQDDQQEGTKSTGEPVDKRG
FT                   YKVDSPTPADQPGAQSFAEIVKSEPHEGKDMPSTYAEAAAEPSQPEETNDKDRQPVSSE
FT                   VGESVTESVPSIPEPSAPSIGDHNAPATPKTVPFPSVYDSRRASYPAAQGTPVHRLSTF
FT                   STLSASPSVSSISRASPSSVKSDAVSGDSSKQDTPGASTNKEDKRRKRLSSIKGFVRRI
FT                   SDQGGLTRSPSGLKSPKPERGKGLNIDEGLVPDNGAAGDEVIDERTALLQGQDPVRAAE
FT                   TLPAPAGGQASEQVGLAEQALAPPTSLPASIKSHGGGNSRKEKKKKKNRR"
FT   gene            complement(401330..403292)
FT                   /locus_tag="CNH02560"
FT   mRNA            complement(join(401330..401644,401701..401777,
FT                   401830..402035,402087..402404,402461..402815,
FT                   402878..402891,402945..403292))
FT                   /locus_tag="CNH02560"
FT                   /product="syntaxin, putative"
FT   CDS_pept        complement(join(401583..401644,401701..401777,
FT                   401830..402035,402087..402404,402461..402815,
FT                   402878..402891,402945..402971))
FT                   /codon_start=1
FT                   /locus_tag="CNH02560"
FT                   /product="syntaxin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45125"
FT                   /db_xref="GOA:Q5KCX6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX6"
FT                   /protein_id="AAW45125.1"
FT                   /translation="MARDRLGNVNRQYGEQPTPGPTYPPPGNGVVAPTRTANPYAQQTS
FT                   VAAAAPGGYGAQGGYGASAGNPYAQTGQAGSPYATGGQYGQQEQYAMGGANGGAGGDFW
FT                   TELSNTNSLLGQLQEQIQAVRTAHQTSLTSTDPQAAAYAAQLNDQARVQREECKNEIKT
FT                   LYKLAKGDRAQRTQAEGVKSRFQGLLQEHQVIEKEFRKKVKDRVERQYKIVNPNATEEE
FT                   IKEVTESDNPQVFSQALLNSNRYGAARGAYREVQERHAEIQKIEKTLTELAQMFQEMAM
FT                   LVEQQDETIVNVETQAHGVDTDIKAGLVQTDKAVESARRARRKKWICFWIVVLIIVILA
FT                   VILGAYFGTKGK"
FT   gene            403544..404855
FT                   /locus_tag="CNH02550"
FT   mRNA            join(403544..403697,403751..403766,403824..403872,
FT                   403927..404133,404189..404486,404570..404855)
FT                   /locus_tag="CNH02550"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(403602..403697,403751..403766,403824..403872,
FT                   403927..404133,404189..404486,404570..404785)
FT                   /codon_start=1
FT                   /locus_tag="CNH02550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45124"
FT                   /db_xref="GOA:Q5KCX5"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX5"
FT                   /protein_id="AAW45124.1"
FT                   /translation="MGGSPQITPLALIKRVWERIAPLQLAERSWDNVGPIIEAPYPNPS
FT                   HRQVLLTIDLTPSVCAEALKHPSLSLIVSYHPPIFRGLKSLTLSDPLQASLLKLSAKGI
FT                   SVFAPHTSLDATPNGINTWLIKPFIPISISHDPIIPSDPLESFEGAGMGRIAKLSEPLD
FT                   IRQAIKMVKDHLSLDFVQLAEPQPDVRKPIKSVAVCAGSGGSVFKGVEADLLITGEMSH
FT                   HEILAYVASGTTVILTNHTNTERPYLSHVLQPWLQEELNKETKDHSNEYGANGGKWEVL
FT                   VSKADADPLKVV"
FT   gene            complement(404430..411410)
FT                   /locus_tag="CNH02540"
FT   mRNA            complement(join(404430..404829,404893..405186,
FT                   405264..405390,405445..405569,405650..405733,
FT                   405793..406201,406254..406381,406426..406645,
FT                   406700..406858,406924..407036,407089..408112,
FT                   408161..408566,408621..408801,408855..409358,
FT                   409420..409632,409686..410046,410100..410380,
FT                   410431..410640,410695..410844,410903..411036,
FT                   411095..411410))
FT                   /locus_tag="CNH02540"
FT                   /product="cellular morphogenesis-related protein, putative"
FT   CDS_pept        complement(join(404956..405186,405264..405390,
FT                   405445..405569,405650..405733,405793..406201,
FT                   406254..406381,406426..406645,406700..406858,
FT                   406924..407036,407089..408112,408161..408566,
FT                   408621..408801,408855..409358,409420..409632,
FT                   409686..410046,410100..410380,410431..410640,
FT                   410695..410844,410903..411036,411095..411299))
FT                   /codon_start=1
FT                   /locus_tag="CNH02540"
FT                   /product="cellular morphogenesis-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45123"
FT                   /db_xref="GOA:Q5KCX4"
FT                   /db_xref="InterPro:IPR007249"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR040314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX4"
FT                   /protein_id="AAW45123.2"
FT                   /translation="MAHSSPPLNTQPSESRALKRPASQSRLTQLLVPGRSRSDSTTSQT
FT                   SVNIEDSGSSGRATPEGRTRAGKAAAASLLANDPKYKRFKQQVDKALQSFENVNEWADF
FT                   ISFLSRLLKTLQSPSPPYHEIPRKLIVSKRLAQCLNPALPSGVHQRALDVYSYIFSIIG
FT                   TDGLQRDLAIWSSGLFPFFQYAATSVRPLLINIYDHYYLPLGENLRPATKAFVLALLPG
FT                   MEEEAGDFFDKILFLLDRLSGAISPSFFLQNIFLILITSPISRLAALNYLARRMTKPLD
FT                   HPDAAIETGLLIRGLSAALDDENVLVRRNALDLLLRVLKLESKVLKEAELSDKQLLIDS
FT                   ATSVVLQKELSLSRRVYTWLLGTSESPNDQVDYFKAHGLDLLSSTLLLKMEKSMVEEDG
FT                   GRDDDPQKPFKIFLSLLDKWEIGGVLSEKVAIPALRIMMDASSSGLTEASNMASALYEA
FT                   MEPSIIWKELYHSVEERILRGNKGDVALVSWLLDNVPQKDEEIAALHLPLLLDRILELI
FT                   QCDNIAADQLPEAIRLAVSLVQHIPATVFSKSSSTFHRPPTEEPPLFQGLYEQKQQPRD
FT                   IEIRLHAHLLPHIVQSAFSISIAALKGSDPTILLHAINIISVLIDYEVPALGEIDGPTW
FT                   LSALVDSLPRVKAFVVVEALVMVALKASRSDLMKSGISVTSDKTMSAILDSLFRYLQPS
FT                   ASLYHSRAVELLWDYNQLAEIHTLETVIARRMTKSSSINSALEAFGIFWRLTDDSMLPG
FT                   EIFHVPVCTVLESLKSTDPDVQRQAETWLRLNLRSYFRVLDPLLSRLLDPSIKYDSSQG
FT                   TYDGLVDLNLIRHQIESVTALFQFGGQGLCKACQVEELNGSLHSTFISRAEKAFPGVKG
FT                   YMELICLLLIRFVEAETSPQMGKKASPLILRVQSAALSLLQMIVSRGEVSQPFISSLKT
FT                   TLANKLLSAVQARRLTLQSKMLHLLHSAINASSSHREPSSRVPSQTHRRGASSVTEKPL
FT                   SIDVSTSDFEHQLVITVMQGVATPSNIPVLQHWIDFVLMTVPLLVNRPNLLHTLAECFS
FT                   QETRELVQRIQEGHEKKSLLRDRKDIIIMPDEVLNVTDAEVIMTLNVLERVLTILSNPA
FT                   SGKVDDSVSGQGESGSRILGLVSTVFTVEAPSNELKPESPRYLDDAVHALLVTWSATLP
FT                   SSEAADERARVEDVSHQTYVNIRGRTRKVLEKVFRANPLAVISSCVHVWSLRSEQVSDE
FT                   AIFDCVDTLTPSAQRVVELICDMASGKSGKAVSDYKADPSCLAFLEAYISRLEAPIAVQ
FT                   VWSTLFGFARELVSAATTVFTRSQLFSLLQCLTELSLTISKTTALEDRRLRRDLHDTYA
FT                   RALDLVVNNSLKIAEAGIWDRPDIAKSVDADKEDDVDVEKGLVKIYDYLATAVIPNLRL
FT                   LLVESDRVNSACSGIIVAIVNPAFRRQRVDAPILRLILEISRIPSTAKTWRPLVSDFFS
FT                   DHRLFKSKPSVETDYWKQLILALFTSDKERFPDLLSRITSTSSANINIFTNREQEMAGK
FT                   CGNLRRLSLILLAAERNHYLGLLPAIQERLVEMLRSGNVSARVHSEVYLCLRVLMCRIS
FT                   PQHLTNFWPVILAELLRIFERTLDEPPEDESEELLLVLAACKFLDLLLVIQSEDFQIHQ
FT                   WMFVTDTTDAAYPPEDYAPDAMMDKLAELLSELGSKGGDTELSLSEPSLVLTSPLNRLP
FT                   NSLRRPRLSEVTSIVSLQQLQMFFARASMDTFESVYAEAAVDWNGIEEGLLGEIFDA"
FT   gene            411490..413523
FT                   /locus_tag="CNH02530"
FT   mRNA            join(411490..412266,412325..412476,412537..412565,
FT                   412642..412831,412889..413002,413067..413080,
FT                   413120..413195,413251..413523)
FT                   /locus_tag="CNH02530"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(411505..412266,412325..412476,412537..412565,
FT                   412642..412831,412889..413002,413067..413080,
FT                   413120..413195,413251..413479)
FT                   /codon_start=1
FT                   /locus_tag="CNH02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45122"
FT                   /db_xref="GOA:Q5KCX3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032854"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX3"
FT                   /protein_id="AAW45122.2"
FT                   /translation="MSSKADASIKFNADTSNEEELDTETKLVLLASLVHPLTLPPQALE
FT                   VLASVDGDVAKAAERLLLPNPETSRKRKAGSSLQGWLGRPSDNKKAVKAKRKQEAESTD
FT                   RHLTVSAAGGSKISGTSTITIDEDKQRDDTISETAPPKSVTNAFEILGRAPSSPVKQKV
FT                   GPQPAIHLSSQASIDSHSLPLTLINQFLSPSLASALYLIMMEESNSWGANRFYIAGKAA
FT                   KSPHTTGFYRKEGGGYGGGKYFYAGMEQGPAKVYPAFLARAAEIVEKAVNENLRKRPRY
FT                   GLEWGGEWKANVCGANRYDGSRSSVGWHADQLTYLGPYTTIASLSLGTSRAFRLRETPP
FT                   SDPAFVINDKPPCTYEITLAHNTLCLMNAGCQERYKHTVPPQKAIDLFRPGYDIAENPI
FT                   PKDAQLAFTSRINITFRFYREDFHPVPNAGPFGPREGTPICRCGVPTVLRADQKAKARS
FT                   RLSSTSFKSRPRASSNTNIIEDDMVFFWQCQSATQTGVGKGCGFFRILDMKKEGRGPCI
FT                   GDRV"
FT   gene            complement(414227..416491)
FT                   /locus_tag="CNH02520"
FT   mRNA            complement(join(414227..414526,414594..414740,
FT                   414806..414855,414904..414914,414962..415150,
FT                   415206..415476,415531..415536,415592..415712,
FT                   415783..415894,415957..416002,416050..416061,
FT                   416110..416168,416220..416491))
FT                   /locus_tag="CNH02520"
FT                   /product="cysteine synthase, putative"
FT   CDS_pept        complement(join(414418..414526,414594..414740,
FT                   414806..414855,414904..414914,414962..415150,
FT                   415206..415476,415531..415536,415592..415712,
FT                   415783..415894,415957..416002,416050..416061,
FT                   416110..416168,416220..416463))
FT                   /codon_start=1
FT                   /locus_tag="CNH02520"
FT                   /product="cysteine synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45121"
FT                   /db_xref="GOA:Q5KCX2"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX2"
FT                   /protein_id="AAW45121.1"
FT                   /translation="MGVSDYFIAFSAKFWERLRFPSKFTRDLVWGIILGITVSLSSTSA
FT                   ALILQEWRRKRAVQRIPPRPIELRSDEIVPGVTGLIGNTPLIRINSLSDALGVEILGKA
FT                   EFLNPGGSVKDRVALQIIEDAEAQGLLYPNTGSVLFEGTVGSTGISLATVGKAKGYESC
FT                   IIMPDDVAIEKVQILEKLGARVERVRPASIVDQKQFVNLARKRALEFGKSELTNIPGHG
FT                   EEIAVSTAAEPSEINHHHLFPSAFEHKPRGFFADQFENDSNFMAHYKGTGPEILRQTSG
FT                   HLDGFVSGAGTGGTIAGTGCFLKKALPDLKIVLSDPEGSGLFNKVRFNVMFDPKESEGK
FT                   KRRHQVDTVVEGIGINRITYNFSLGLPVIDDAYRVSDEEAVAMSRYLVQHDGLFLGSSS
FT                   ACNLIACIRLAKTMSRGSRIATILCDSGSRHQSKFWSDDYLRANNIAIDPSIVDRLLES
FT                   "
FT   gene            416615..417495
FT                   /locus_tag="CNH02515"
FT   mRNA            join(416615..416688,416750..417049,417104..417320,
FT                   417375..417495)
FT                   /locus_tag="CNH02515"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(416657..416688,416750..417049,417104..417320,
FT                   417375..417428)
FT                   /codon_start=1
FT                   /locus_tag="CNH02515"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M670"
FT                   /db_xref="InterPro:IPR007233"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M670"
FT                   /protein_id="ALO69513.1"
FT                   /translation="MTIFSLYIFDRHCDCVYYQDWHRTSPVRPPPPASFKPGVHRLPPA
FT                   PQPTDTYRRSIFDEKRSSGQASTVDIKSDGLGSGRALKGLPFDEEAKLVYGVLISLRSM
FT                   VKRLSGRDDEPFTSYTTPQYKLHLFETPTGYKFVLLSDPTSDSLRFILRQLYMGPFLEY
FT                   VVRNPLVKLDSREEGIDNDQFRDAVDRHMRALSMFGS"
FT   gene            complement(417454..421404)
FT                   /locus_tag="CNH02510"
FT   mRNA            complement(join(417454..417782,417850..417997,
FT                   418060..418229,418284..418403,418462..418512,
FT                   418566..419117,419171..419305,419366..419667,
FT                   419716..420198,420259..421159,421252..421404))
FT                   /locus_tag="CNH02510"
FT                   /product="chromosome organization and biogenesis-related
FT                   protein, putative"
FT   CDS_pept        complement(join(417609..417782,417850..417997,
FT                   418060..418229,418284..418403,418462..418512,
FT                   418566..419117,419171..419305,419366..419667,
FT                   419716..420198,420259..421159,421252..421281))
FT                   /codon_start=1
FT                   /locus_tag="CNH02510"
FT                   /product="chromosome organization and biogenesis-related
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45120"
FT                   /db_xref="GOA:Q5KCX1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX1"
FT                   /protein_id="AAW45120.2"
FT                   /translation="MSLHEGNRRRDALEALKHRKSTQSRPPVSRSPSVEYIQDSDVLVP
FT                   PSSSPAPTPQQSKYFASKLTQKNGALDSMKDTLDKRTNARKDEKYPSLNGSPSDVLRAI
FT                   HRHSPQPLRRPKPRYVDPDEEESPVKPTPATPSMISSVRQPSLVHAAQSARDDQEEKMI
FT                   QRLASQFPNVERSTISSLLRKYPGNPDRAINQIHYANQMKAEQESYTSARSTTSKRSSP
FT                   LPVPVSPAASNSKSKKKNENSTIYANRKRHRRSNDSEEEFSGSESEDDFSDGDDGRKRR
FT                   KGEDDEPDAEGAALKAFNEDSVETLTGTIACRPEQAAIIIKHRPYEDVDDVRAKLTKAR
FT                   GVSFKLFEQYTEIMEGFVQIDACLNRCEAIASDVAKTLAVWKGASHAQDGSVVGTPRSD
FT                   GLNDVKVDVAKVSELLKNETDVKKRKILKQYIQTQPSTLSEGTVLKDYQLLGVNWLNLL
FT                   YSKRIGCILADEMGLGKTIQVIAFIAALKERGIIGPHLIFVPASTLENWTREFRRFAPD
FT                   IDVQTYYGSQAERAGLRSDLKAQFRRGELEVVLASYTQMTSADDLSFFRKKIDFETCVY
FT                   DEGHRLKSCTTKAYTDLLSIKPKWRLLLTGTPLQNNLQELLSLLMFIHKDTFTDAEPYL
FT                   RAIFKSQGSASLLSHTRTTRARTMLTPFVLRRRKAQVLSLPPKIEIVEHCEMTKVQSKL
FT                   YSETMQKSKKILSELTEEALEEVAGEDGSVATGKKPEADKKSVKGKKASGVTTSGSNIL
FT                   MDLRKAASHPLLFRRLYTDAKIRQIAKACLNTPSYCDCNLDYVIEDLEYMSDYEISNFC
FT                   TSSVEEELHKYALDPEVFLEGGKVMAMVKHIERCKAEGKRMLLFSQFVMILDILEGALN
FT                   HLGIRYTRLDGQTKTDERQGLVDEFNDDTDITVFLLSTKAGGVGINLTAASVVVIYDQD
FT                   FNPHNDRQAADRAYRIGQERKVEVIKLITKNSIDEDMLEIGLTKLQLDDMVGGEEITLD
FT                   GTDGAGADDKTAKETRKSLLTQLRTKFVESES"
FT   gene            complement(421817..422845)
FT                   /locus_tag="CNH02505"
FT   mRNA            complement(join(421817..421942,422017..422745,
FT                   422808..422845))
FT                   /locus_tag="CNH02505"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(422057..422314)
FT                   /codon_start=1
FT                   /locus_tag="CNH02505"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Z3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z3"
FT                   /protein_id="ALO69514.1"
FT                   /translation="MAPCVCLTTLLFCSPRRYSLANLSAAPSLSINTTVCLPVGLSSIV
FT                   PRALPPFPHRDMSVFDVLLPVAAPTYCICLDILCLLRDFL"
FT   gene            complement(422960..424555)
FT                   /locus_tag="CNH02500"
FT   mRNA            complement(join(422960..423591,423650..423724,
FT                   423786..423882,423939..424082,424140..424166,
FT                   424246..424555))
FT                   /locus_tag="CNH02500"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(423218..423591,423650..423724,
FT                   423786..423882,423939..424082,424140..424166,
FT                   424246..424362))
FT                   /codon_start=1
FT                   /locus_tag="CNH02500"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45119"
FT                   /db_xref="GOA:Q5KCX0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCX0"
FT                   /protein_id="AAW45119.2"
FT                   /translation="MPSCRVTNNTAHPLNISLKQVTALHFENGVQPGQTIKFRPGKVWF
FT                   TFEALVDDGSKKSRYSVLKSAATIAVISVAVGAVAATAGTALLPEAVALETAAAASVAG
FT                   GAIAKGVTAAKTALIANSGTIARISSVALPKAIEKLSAESGGLTALQREVVSIIASPTL
FT                   SSDVRHKSASLLRSLHKSYTGDKAARQEASSANNPDAGQPSATLTPISDDEAEKLERDV
FT                   ESGEVDDRVENTAVRTGEVLRVHGIYMKQHREFEIRVGEEGKLALYDVDQKKFIM"
FT   gene            424830..427776
FT                   /locus_tag="CNH02490"
FT   mRNA            join(424830..425270,425323..425983,426033..426517,
FT                   426578..426747,426802..427606,427663..427776)
FT                   /locus_tag="CNH02490"
FT                   /product="cytoplasm protein, putative"
FT   mRNA            join(424830..425270,425323..425983,426033..426517,
FT                   426578..426747,426802..427551,427607..427776)
FT                   /locus_tag="CNH02490"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(424836..425270,425323..425983,426033..426517,
FT                   426578..426747,426802..427551,427607..427661)
FT                   /codon_start=1
FT                   /locus_tag="CNH02490"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45118"
FT                   /db_xref="GOA:Q5KCW9"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW9"
FT                   /protein_id="AAW45118.1"
FT                   /translation="MPLPPKVSPVTGNPVPPHYIHSSTLHFQDVNGRSLVLRGVNLSGS
FT                   AKHPNNQPSHIREGFWETAEAGKGDFINKPLNLDDGSADLHLARLKAWGYNLLRYVFTW
FT                   ESLEHAGPKEYDYAYMDYIIAVLRKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTLYAC
FT                   GIDPYHLTPTAAAYLHCEWPSAESPKPQDFPAMIWGTNYTHLANQTIWTFFFAGKTYAP
FT                   KCIIDGKNIQDFLQDHFIDAVGELAKRIAEEGGDLLDECVIGWDSVNEPGEGLIGYKDL
FT                   AVIPAEQQLKKGPSPTPIEGMRLGMGEVQDVQVWNFGPMGPYRGSRQTIDPKGVKLWLS
FT                   EEDDVKRGSGKWGWTRGKEWALGTCIWAHHGVWDIATSTLLRPDYFSTLPTNPSHQVDF
FT                   VDDFWALHWLAYSSRIRLHHPESIHFIQAPVLRQPPKLPESFLKGRACSSPHFYDGLTL
FT                   MTKHWNWFNADAIGVIRKKYWSIVQAVRIGEGPIRKMIQGELAVLKQDTVDILGKYPTL
FT                   IGEIGIPYDMDDKKAYGYVDGGRGEGDYSSQQKAMDCSMNACDGPNCLNYAIWNYVPDN
FT                   VHEWGDNWNGEDLSLWSLDDKEQESYHDSPRSDTPNFSTNSSSLTNSSATLTVPMSGAA
FT                   KLRLSPSVIDAGDFSPALILDGSRAVAAFCRPYPVVTVGIPERIDFDITSTKFKYAVRV
FT                   RADDIVNEQVYTEIYLPFVHYAASLDPSRPAGHNPNSGQTALTSTDGDDSNLSSRQTSK
FT                   VDLIEDERAIKSSDPSSISIRSVPYSSSTQLSLDVAIVASHGRVEIQGQTLRWWYPVPG
FT                   TGEEVYTIEVQRNGGALRRDLGCVKASQYNGQTLINLSL"
FT   CDS_pept        join(424836..425270,425323..425983,426033..426517,
FT                   426578..426747,426802..427606)
FT                   /codon_start=1
FT                   /locus_tag="CNH02490"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45117"
FT                   /db_xref="GOA:Q5KCW8"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW8"
FT                   /protein_id="AAW45117.1"
FT                   /translation="MPLPPKVSPVTGNPVPPHYIHSSTLHFQDVNGRSLVLRGVNLSGS
FT                   AKHPNNQPSHIREGFWETAEAGKGDFINKPLNLDDGSADLHLARLKAWGYNLLRYVFTW
FT                   ESLEHAGPKEYDYAYMDYIIAVLRKCKEWGFRVFMDPHQDVWSRFTGGSGAPLWTLYAC
FT                   GIDPYHLTPTAAAYLHCEWPSAESPKPQDFPAMIWGTNYTHLANQTIWTFFFAGKTYAP
FT                   KCIIDGKNIQDFLQDHFIDAVGELAKRIAEEGGDLLDECVIGWDSVNEPGEGLIGYKDL
FT                   AVIPAEQQLKKGPSPTPIEGMRLGMGEVQDVQVWNFGPMGPYRGSRQTIDPKGVKLWLS
FT                   EEDDVKRGSGKWGWTRGKEWALGTCIWAHHGVWDIATSTLLRPDYFSTLPTNPSHQVDF
FT                   VDDFWALHWLAYSSRIRLHHPESIHFIQAPVLRQPPKLPESFLKGRACSSPHFYDGLTL
FT                   MTKHWNWFNADAIGVIRKKYWSIVQAVRIGEGPIRKMIQGELAVLKQDTVDILGKYPTL
FT                   IGEIGIPYDMDDKKAYGYVDGGRGEGDYSSQQKAMDCSMNACDGPNCLNYAIWNYVPDN
FT                   VHEWGDNWNGEDLSLWSLDDKEQESYHDSPRSDTPNFSTNSSSLTNSSATLTVPMSGAA
FT                   KLRLSPSVIDAGDFSPALILDGSRAVAAFCRPYPVVTVGIPERIDFDITSTKFKYAVRV
FT                   RADDIVNEQVYTEIYLPFVHYAASLDPSRPAGHNPNSGQTALTSTDGDDSNLSSRQTSK
FT                   VDLIEDERAIKSSDPSSISIRSVPYSSSTQLSLDVAIVASHGRVEIQGQTLRWWYPVPG
FT                   TGEEVYTIEVQRNGGALRRDLGYVQQGNFLDVCPECVIA"
FT   gene            complement(427813..430577)
FT                   /locus_tag="CNH02480"
FT   mRNA            complement(join(427813..428026,428100..428172,
FT                   428245..428297,428359..428430,428502..428734,
FT                   428811..429379,429437..429579,429634..430319,
FT                   430367..430423,430482..430577))
FT                   /locus_tag="CNH02480"
FT                   /product="mitochondrial DNA repair and recombination
FT                   protein PIF1 precursor, putative"
FT   CDS_pept        complement(join(427918..428026,428100..428172,
FT                   428245..428297,428359..428430,428502..428734,
FT                   428811..429379,429437..429579,429634..430319,
FT                   430367..430423,430482..430562))
FT                   /codon_start=1
FT                   /locus_tag="CNH02480"
FT                   /product="mitochondrial DNA repair and recombination
FT                   protein PIF1 precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45116"
FT                   /db_xref="GOA:Q5KCW7"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW7"
FT                   /protein_id="AAW45116.1"
FT                   /translation="MPKPGFYAVRFGRRPGVYITWAECQQQVHMFPGAVFKKFGTYDEA
FT                   SLWASLRPQTPPPPETSETDRKDGLKESDKGKRISDSADPSAQHGPRSSSKASPSHPLH
FT                   LPYQQDCKRERSEDTDDTESPGRKAKAGKHDRNEDKNGYDGFTAMDDYISVLPPDDEAG
FT                   QSSSTQVDGNITTAELPAVGGEPELSSQQSEILAKIMNGENFFFTGSAGTGKSVLLRAI
FT                   IKAFKEKEGEREQREATRSFRSWQGYRGAQKAEKEEVVKWSLAVTASTGMAGVNIGGTT
FT                   IHSWAGIGLGVDNAEKLANKVRANALSRKRWRTTAALVIDEISMIDAPLLDKLDHIGRI
FT                   VRNDDRPFGGIQLILTGDFFQLPPVTKGQIPQFAFEAKCWPKLFSHKNIKTLTRVFRQR
FT                   DDRFINMLEAMRRGTITPDDTVLLQSLNRPIEYPDNIEPVALYPQKRDVEFVNSARLDA
FT                   LPGAVTLYDCHDEPGFTAGGFPISRTEATIKLNKNTIWPQHLSLKEGAQVMLVTNMGDG
FT                   VLVNGSTGTVVDFLTIPDAIKRGIHLPEAAIKGQTSMDLEFPVVAFAQSKFARKKVPER
FT                   VIIPSMSVDMLNALGQPEATRYQIPLILAWALTIHKSQGQTLERVKIDLAKIFVEGQTY
FT                   VAISRAVSLDSLEVLNFRPHSVKAHSKVIDWARPYEEEQAAEEEWNNLEDNIGILY"
FT   gene            430680..433651
FT                   /locus_tag="CNH02470"
FT   mRNA            join(430680..431209,431262..431372,431425..431783,
FT                   431877..432088,432154..432210,432286..432469,
FT                   432562..432726,432811..433021,433107..433317,
FT                   433386..433651)
FT                   /locus_tag="CNH02470"
FT                   /product="DEAD box family helicase, putative"
FT   CDS_pept        join(430701..431209,431262..431372,431425..431783,
FT                   431877..432088,432154..432210,432286..432469,
FT                   432562..432726,432811..433021,433107..433317,
FT                   433386..433502)
FT                   /codon_start=1
FT                   /locus_tag="CNH02470"
FT                   /product="DEAD box family helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45115"
FT                   /db_xref="GOA:Q5KCW6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW6"
FT                   /protein_id="AAW45115.2"
FT                   /translation="MPTSRCAARLFSLTKVLCPHTASLTRPPIHPARPYATILASSQNL
FT                   HQPPSDHAGPNNTTRNQNITLRSYQEAAISACLDALQSGSRRLGVSSPTGSGKTTIFLS
FT                   LIPRVPFYASRGNDSHPRDGKGQTLIIVNSVELAEQTQKSAERLLGDEWTIEIEQSKRV
FT                   ASGLADVTIATYQTLNNPDRLSKFDPSKFKLVIVDEAHHSAAPSYLRLLHYFNEDVKIP
FT                   KSPQAPSPHLHGFKVPIIGFSATFSRADQHSLHSAFEEIVFHRDMKDMLSEKHLAPAKL
FT                   TIVKADLELDEVETSSGDFKNAALARKVNTTEINELIVRTYLHRASERRSTLVFCVDLE
FT                   HVSALTQTFRSAGIDARSVSSKSKPEMRKATIAAFGKGEFPVLINCEVLTEGTDIPQID
FT                   CILLARPTQSRNLLVQMVGRGLRLSPESGKTDCHIIDLVDSVANANGLIVTPTLLGLSL
FT                   DEMDVEDHGRESTEKAKPQDELETVPPIAPDYDITYLDQDDPFHVDVFAQPVIQKVSKN
FT                   AWVSCGNGKYALELIGSGTIIATRNDPQLYSISYRPNLPHELTPLGKGRSPYGSVRVVG
FT                   HAPDLERALQAGDKFAENKLGRGRCLALSRYAPWRQRLASENAVKHLLKRLGEDNDSLL
FT                   NGQGKERVISLWGKKVSVGSLTAGEVSSWLCAMKNGAKSIRIARDKSEEKARAKAEAKA
FT                   EKERQQQLRNLPLPPST"
FT   gene            complement(433353..434431)
FT                   /locus_tag="CNH02465"
FT   mRNA            complement(join(433353..433557,433623..433900,
FT                   433971..434157,434212..434431))
FT                   /locus_tag="CNH02465"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(433655..433900,433971..434157,
FT                   434212..434375))
FT                   /codon_start=1
FT                   /locus_tag="CNH02465"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5T9"
FT                   /db_xref="InterPro:IPR018796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5T9"
FT                   /protein_id="ALO69515.1"
FT                   /translation="MTMLPTARPRVAHILPYIQHFTASTSTSSTASDPPRRRRSNRNDT
FT                   PATGVDLVAPPDPLSNIRPILYASKPPTRPSANSPYSASEFPSSSGDAKLDNMELEWRL
FT                   RRERVDLTNHRFWAANNIAFNAQLDHRLSLLPPASDPPSPEDIRRKEDCLTQFYADWQM
FT                   ANQERQIRWVKEWWREIWEGLRIQARLYVMRALRR"
FT   gene            434516..436542
FT                   /locus_tag="CNH02460"
FT   mRNA            join(434516..434669,434722..434886,434947..435035,
FT                   435096..435153,435206..436035,436123..436542)
FT                   /locus_tag="CNH02460"
FT                   /product="bud site selection-related protein, putative"
FT   CDS_pept        join(434571..434669,434722..434886,434947..435035,
FT                   435096..435153,435206..436035,436123..436468)
FT                   /codon_start=1
FT                   /locus_tag="CNH02460"
FT                   /product="bud site selection-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45114"
FT                   /db_xref="GOA:Q5KCW5"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="InterPro:IPR037393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW5"
FT                   /protein_id="AAW45114.1"
FT                   /translation="MSALDNSTAPSLQTKKRKRTGKEREERKKAAIQAKQEAEAVEKAN
FT                   GEVEGGTIVQDSVQETVAPQEAASVEHEAGLSSVDVEKVAKRIPQALKSLHPVFKQAKT
FT                   FETRRLIKKIKFLRNKDVKDETADLESQLKIIHDIQLQPLAKSHLLVKLRKHPLFKQTP
FT                   LPSEISSLLSPPSATTASFAGTSATPALINKAENRLCSAKIVAERMKNVVSWTVCEGGA
FT                   KLVIEKKPATISAGKGGSKKAAESTDEEDDEQEEGEEANVGDISRSMVNGSDSEEDSDD
FT                   ERVLQDRAADAAGWESGSVSGFDSEGGEVDIASESESESDNSDAIAVPSAKRAKTAVPP
FT                   LPPKSKPLKSEKADKPPKSAKDLTSSIFLPSLSVGFTRGDDDDSDPDLDDDPNGVAGKQ
FT                   PVVRKNRRGQRARQAIWEKKYGKNAKHVVKAHEEEKLQAQKTREKAEAKGRTRDSGWGA
FT                   KSGKAVGPAVAAGPAQTAAVSHTQKVYSEPKQSQTEQKKSLHPSWEAAKLRKQKMGVVQ
FT                   TEIKAQKIVFD"
FT   gene            complement(436507..438590)
FT                   /locus_tag="CNH02450"
FT   mRNA            complement(join(436507..436964,437017..437117,
FT                   437171..437850,437904..438268,438330..438437,
FT                   438495..438590))
FT                   /locus_tag="CNH02450"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase,
FT                   putative"
FT   CDS_pept        complement(join(436632..436964,437017..437117,
FT                   437171..437850,437904..438268,438330..438437,
FT                   438495..438548))
FT                   /codon_start=1
FT                   /locus_tag="CNH02450"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45113"
FT                   /db_xref="GOA:Q5KCW4"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW4"
FT                   /protein_id="AAW45113.1"
FT                   /translation="MTSQLATFKVPVIDNEPMRNYPPNSAERAGLQAAVDKMLAASPVE
FT                   IPCIINGEEVKTGDIQAQPMPHDHSKNICTYHAATPEVVQKAIDGALATRQTWEEMPWA
FT                   DKAAVFLKTADLISGKYRYELMAATMLGQGKNAWQAEIDAAAELCDFLRFSVKYVEELY
FT                   QQQPPRNSTGVWNRVEYRPLEGFILAVTPFNFTAIGGNLVGAPVIVGNVCIWKPSPMAT
FT                   YSNYIVHKIFLEAGLPPSVIQFVPGNPPEVVKQCIDHKEFAGLHFTGSTHIFRKLWKDI
FT                   AQNLDIYRGYPRIVGETGGKNFHLYHPSADIKSGVVQAIRAAFEYSGQKCSALSRCYVP
FT                   ASLWKNGFKDTLIAETEKIKTGPCTAWENFAGPVIGKPAFDKISGIIEQAKKEGDEVIA
FT                   GGSYDDSKGYFIKPTVIVTKDPKSLTMTTEIFGPVLTVYVYEDAEFDNMPALIDSTTEY
FT                   ALTGSVFAKERSVLASASHKLRNSAGNFYINDKSTGAVVGQQPFGGARASGTNDKSGSM
FT                   AIFSRFVSMRSIKENFVAPEDYLYPSNFL"
FT   gene            complement(438867..442064)
FT                   /locus_tag="CNH02440"
FT   mRNA            complement(join(438867..439265,439332..439424,
FT                   439489..439636,439687..439766,439820..440205,
FT                   440255..440501,440560..440713,440762..441122,
FT                   441173..441277,441331..441900,441951..442064))
FT                   /locus_tag="CNH02440"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(439007..439265,439332..439424,
FT                   439489..439636,439687..439766,439820..440205,
FT                   440255..440501,440560..440713,440762..441122,
FT                   441173..441277,441331..441900,441951..441992))
FT                   /codon_start=1
FT                   /locus_tag="CNH02440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45112"
FT                   /db_xref="GOA:P0CQ06"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR036213"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ06"
FT                   /protein_id="AAW45112.2"
FT                   /translation="MPFCSYQEGLKVASDLGNKAIQTEASLSSLSPVASPIPTLQKAFP
FT                   IYISAAEAYGHLLSSKLVPQSDIETVKRKWRLVLERAEKVKSRIEQLGGHVAKAEIGDR
FT                   GEEIAVLRRASLINGVAVELWRPPGDTFDAGEPYREAVQPELAAAQLDMDPEWRDIQAD
FT                   CWLHQAPNEGDWVMRQGPVSDCSVVAAMGVGIKHAGQFGTAFGWENLYPQDAHGRPRRS
FT                   KNGKHILKLLLNGAWRSVVLDSLLPFSKRDKTPLFTTCHPAPHILPTSVGSPWAPLALK
FT                   GYFKVHGGYSLRGSNPSSDIYEFMGWIPERIGLKEGFQREKEWKRMKEAWHKGNVMVSL
FT                   GTGSKVSEGLVKLHAYGVIRLREEGHERILDIFDPGATSFTMSWDQVCAEFEALHLNWK
FT                   PSVMPNTATRHWSWPKPPDLPSDADPGMMNTRYRLHVNASSPSSSLSEVWILLSQHITS
FT                   RDRPLDDIALHVFEGLGPNNSRNLGAIYSEGLERTNPYTNSNHLLVRYQLRRPTSDLTL
FT                   IPSRDRGIDQTGFTLNAFAPASISLSLERISRTLPFTQRISGNLTDRSAGGHPGWPTHM
FT                   TNPQYKVVVRPGEGKSEISGRIILHGEKDVPWNVKLIWGRGQLVYELSEDLIVADTGSY
FT                   SYGIAYCDIPELQPDTYTLIVSAFEPGQTGLFSLSLEATAPVSIIPIAAEGAGMYNRVV
FT                   NGFWTERTAGGRPSGGTYESNPRVEMVLSKPATIQSRLYLPTRSPVPINLTIFKRAQGG
FT                   ALGEQLVTTGPYSDSICGVSTGKMKLDSGVYLLVPSSYEKSKGGWVLKIWSDVALSAEI
FT                   VG"
FT   gene            442257..445109
FT                   /locus_tag="CNH02430"
FT   mRNA            join(442257..442296,442365..442469,442523..442940,
FT                   442991..443178,443229..443274,443328..443540,
FT                   443597..444201,444255..444366,444422..445109)
FT                   /locus_tag="CNH02430"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(442332..442469,442523..442940,442991..443178,
FT                   443229..443274,443328..443540,443597..444201,
FT                   444255..444366,444422..445109)
FT                   /locus_tag="CNH02430"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(442365..442469,442523..442940,442991..443178,
FT                   443229..443274,443328..443540,443597..444201,
FT                   444255..444366,444422..445056)
FT                   /codon_start=1
FT                   /locus_tag="CNH02430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45111"
FT                   /db_xref="GOA:Q5KCW2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW2"
FT                   /protein_id="AAW45111.2"
FT                   /translation="MLLKSAIRCRTPSRLAYGFSVSRHLSNVATAKKLWGDSLVFSEEV
FT                   EAALHARSPIVALESTIITHGMPHPVNLETAQSVESIIRASSAVPATIAIINGKIHVGL
FT                   SSRQLEGIADVSTGLGKGSVKVSRRDLAPTLALRRTGGTTVAGTMYIANSVGIHVFVTG
FT                   GIGGVHRGAENSMDISADLIELGRTPMAVVCAGAKSILDIPRTLEVLETQGVCVATYGG
FT                   NSEFPAFYHPSSGCESPWSVPDIKSAANLVYASLNLPTPLSALLAVPIPSEHADAGLTV
FT                   QKAVEQAARESVEQGIDKRGKEVTPWLLKRVGELTRGTALGLNIKLYENNARIGSQVAV
FT                   QVSKLFREQKDASSALYIPVSSSESFPKPELKNESPKLALPNTSTQSSLPSPSTLVFGS
FT                   AAVDLTSTSTHSLAPRTTTPGEVFVSPGGVGRNIAEAAQNLLPPNSVQLVSAYGSVSGS
FT                   SESDTTEPDAFGKLLLFELAGANMRADGLVGKEGRNTAVCSLTLEKDGDLVAGVADMGI
FT                   VETLTEEFVARKIDEEKPEMVVFDLNLLEGVVKAILTACQTLNVPTFCDPTSTPKLPRL
FT                   IPALNILLPSSPSFPRPLTHLTPNLLELDLLHSLLSSSASDDTSSITWEFINSLGLDGD
FT                   WRAKVERFTNVNGREWINVNGVVQKMVSCLPYVASFWVKAGQRGLLHLRMTSVPPQPSP
FT                   DTLVHPLAGQHHGKYLAFTHYTPPVIKPEEIISTTGAGDTLAGGLVAGLVGGKGEPEEI
FT                   WVRRALDRVGRSLRNRRAVG"
FT   CDS_pept        join(442365..442469,442523..442940,442991..443178,
FT                   443229..443274,443328..443540,443597..444201,
FT                   444255..444366,444422..445056)
FT                   /codon_start=1
FT                   /locus_tag="CNH02430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5KCW2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW2"
FT                   /protein_id="ALO69516.1"
FT                   /translation="MLLKSAIRCRTPSRLAYGFSVSRHLSNVATAKKLWGDSLVFSEEV
FT                   EAALHARSPIVALESTIITHGMPHPVNLETAQSVESIIRASSAVPATIAIINGKIHVGL
FT                   SSRQLEGIADVSTGLGKGSVKVSRRDLAPTLALRRTGGTTVAGTMYIANSVGIHVFVTG
FT                   GIGGVHRGAENSMDISADLIELGRTPMAVVCAGAKSILDIPRTLEVLETQGVCVATYGG
FT                   NSEFPAFYHPSSGCESPWSVPDIKSAANLVYASLNLPTPLSALLAVPIPSEHADAGLTV
FT                   QKAVEQAARESVEQGIDKRGKEVTPWLLKRVGELTRGTALGLNIKLYENNARIGSQVAV
FT                   QVSKLFREQKDASSALYIPVSSSESFPKPELKNESPKLALPNTSTQSSLPSPSTLVFGS
FT                   AAVDLTSTSTHSLAPRTTTPGEVFVSPGGVGRNIAEAAQNLLPPNSVQLVSAYGSVSGS
FT                   SESDTTEPDAFGKLLLFELAGANMRADGLVGKEGRNTAVCSLTLEKDGDLVAGVADMGI
FT                   VETLTEEFVARKIDEEKPEMVVFDLNLLEGVVKAILTACQTLNVPTFCDPTSTPKLPRL
FT                   IPALNILLPSSPSFPRPLTHLTPNLLELDLLHSLLSSSASDDTSSITWEFINSLGLDGD
FT                   WRAKVERFTNVNGREWINVNGVVQKMVSCLPYVASFWVKAGQRGLLHLRMTSVPPQPSP
FT                   DTLVHPLAGQHHGKYLAFTHYTPPVIKPEEIISTTGAGDTLAGGLVAGLVGGKGEPEEI
FT                   WVRRALDRVGRSLRNRRAVG"
FT   gene            complement(445059..446527)
FT                   /locus_tag="CNH02420"
FT   mRNA            complement(join(445059..445198,445259..445418,
FT                   445466..445799,445854..446054,446118..446237,
FT                   446303..446527))
FT                   /locus_tag="CNH02420"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(445166..445198,445259..445418,
FT                   445466..445799,445854..446054,446118..446237,
FT                   446303..446468))
FT                   /codon_start=1
FT                   /locus_tag="CNH02420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45110"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW1"
FT                   /protein_id="AAW45110.1"
FT                   /translation="MPQPPFELHKYLGKALPHLREQYPPGTGGTGPRAQWDGLLTGVQV
FT                   IEDFGDQVANFWKTIPDKPVQPHPSFKYPKIAQVHSKLPNPLKTPRDLQTCLSVLPLAA
FT                   CSAALTALDADPADLKTTGPQALDKAGYESDGGEELEVVNQREMKTKGWKFRFSKSPMG
FT                   SGEFLLMREDSDDVKLVVRTINSSAFTTADWEEYVVSGPYRYETRSKASWYWSRAWGAS
FT                   KRLGCQYYVLTDWQRWTFGYFNQDRTHGWTSPVLHFNEQNPSIGHSLFFWARSAIGKEN
FT                   GYKPQEKDVSGLPEIFPINPSRRISHSGKSTPRGEIRQPKKANESDIEESDAEGDA"
FT   gene            447313..449632
FT                   /locus_tag="CNH02410"
FT   mRNA            join(447313..447954,448010..448334,448393..448897,
FT                   448955..449632)
FT                   /locus_tag="CNH02410"
FT                   /product="expressed protein"
FT   CDS_pept        join(447766..447954,448010..448334,448393..448897,
FT                   448955..449375)
FT                   /codon_start=1
FT                   /locus_tag="CNH02410"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45109"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCW0"
FT                   /protein_id="AAW45109.1"
FT                   /translation="MSVVPKCDETGCTDNAIKVNSRCRFCKLSFCWSHFENETSHPCLT
FT                   ASHPETNRDGFEFEKEPEVSEILRYLDVHAIKHEVESIFPGHICNYVGKPQIWQELPRL
FT                   CGNYNYHIVLGFADGQRWAMRIRLKQKKYLPPQALTASLESEIATARALEDAGCAVPRT
FT                   WERPKDSQLSKSLAYFYQEFVPQGDCTIYTLWTEPFNQQTKIFIRNYAKFMIGLEKVHF
FT                   NQMGSLTLTEDGDVTVGPFIEKRTTIDNPPYFLGPFRTAKEAYLAIIDVRLQQTLNRSR
FT                   YKPSRELLHYLVLLEVRSLVSNCAELDKGPWYVRHNEDDTNCIRVTSGGAITGIIDWKW
FT                   ATLTSKGGAFAAPFCFPDDKYSEGLNALGVRELALIEAYRDLGRPELADLVRTGRKYHR
FT                   LFDVLFRECVTLTTLNALRRAFLGLPDGKQGLPQTLKEWIQVAKQNYSTDEHLETMLAR
FT                   SEEFVKNSNQSAMYSEHWGLK"
FT   gene            449804..450770
FT                   /locus_tag="CNH02400"
FT   mRNA            join(449804..450228,450301..450409,450472..450770)
FT                   /locus_tag="CNH02400"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(449955..450228,450301..450409,450472..450679)
FT                   /codon_start=1
FT                   /locus_tag="CNH02400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45108"
FT                   /db_xref="GOA:Q5KCV9"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV9"
FT                   /protein_id="AAW45108.1"
FT                   /translation="MTTHHPRALPIVLITGTPGTGKTLHSQLLVSELSEADSPIPMKHL
FT                   NIGDIVKEHGFHEGWDEEWKCWIVDEERLLDWMEEVVNPRDGPAETGFVIDHHDPSLFP
FT                   ERWIDLAVVLTCDNGILHDRLTARNYPANKISENITAEIMMTCLNETRESYAEEIVVQL
FT                   QSEGKDDGEVEENVRRIAQWAENWRQNQQEEES"
FT   gene            complement(450753..451612)
FT                   /locus_tag="CNH02390"
FT   mRNA            complement(join(450753..450853,450910..450959,
FT                   451085..451234,451324..451395,451454..451506,
FT                   451556..451612))
FT                   /locus_tag="CNH02390"
FT                   /product="nuclear transport factor 2 (ntf-2), putative"
FT   CDS_pept        complement(join(450841..450853,450910..450959,
FT                   451085..451234,451324..451395,451454..451506,
FT                   451556..451592))
FT                   /codon_start=1
FT                   /locus_tag="CNH02390"
FT                   /product="nuclear transport factor 2 (ntf-2), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45107"
FT                   /db_xref="GOA:Q5KCV8"
FT                   /db_xref="InterPro:IPR002075"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV8"
FT                   /protein_id="AAW45107.1"
FT                   /translation="MSDPTSIAQQFTQFYYQQFDSDRNGLASLYRDTSMMTWESTQVQG
FT                   SAAITEKLVSLPFQKVQHKVVTIDAQPSSPQVASLIVLVTGQLLVDDGQNPLQFTQVFH
FT                   LIPEGGSYFVFNDVFRLNYG"
FT   gene            451978..453705
FT                   /locus_tag="CNH02380"
FT   mRNA            join(451978..452259,452331..452367,452426..452513,
FT                   452579..453705)
FT                   /locus_tag="CNH02380"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(452115..452259,452331..452367,452426..452513,
FT                   452579..453559)
FT                   /codon_start=1
FT                   /locus_tag="CNH02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45106"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV7"
FT                   /protein_id="AAW45106.1"
FT                   /translation="MFAAAALASLLSTIAANAVPCVQFDSSWNLYAFGGDQDVKIGDNS
FT                   TWSSPSTTPLSTSGRPPWTGNNTQCILSQTNNAMYVIGGDSDDLSSIYVYDFADDSWST
FT                   QSTSRTPSDLGNSRSSTVLDHDTNVFFTLTTDSGLYQLDLSSITNSASSDSLRWEAVSD
FT                   PSFSVDGYTATLAQAANHVFFFGVPGTAAGSANLFVVHYAYFQPEAQAFSGTAFPDTVG
FT                   QAISIPNVDNNVPYSMVFIPDDFSDTYIVTHWTDLSNYSVTSDAPFGLDLINSTQTLPA
FT                   PTSQDSTAAYAASPYAIVQVDAAGGIYYMSNPVQSDYTVSSSASWEKLGYSLTGLNDSA
FT                   SNNSSSSSTASSTSTATGEAAGSASGSASRTSSTDGASASASSTSSSSSGAEKMTASGD
FT                   ILGISMGALALVASILL"
FT   gene            453875..457425
FT                   /locus_tag="CNH02375"
FT   mRNA            join(453875..454171,454228..454438,454492..454601,
FT                   454671..454715,454771..454971,455032..455523,
FT                   455581..455938,455990..456168,456219..456333,
FT                   456383..456389,456438..456561,456609..456721,
FT                   456805..456935,457009..457425)
FT                   /locus_tag="CNH02375"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(454083..454171,454228..454438,454492..454601,
FT                   454671..454715,454771..454971,455032..455523,
FT                   455581..455938,455990..456168,456219..456333,
FT                   456383..456389,456438..456561,456609..456721,
FT                   456805..456935,457009..457116)
FT                   /codon_start=1
FT                   /locus_tag="CNH02375"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5U7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5U7"
FT                   /protein_id="ALO69517.1"
FT                   /translation="MPFCTHSTLPIAGTIISPANLAHQSSLRPSMDMSDSNNHAPISID
FT                   NQTGIDDEDTDRFKIKSSTFCKVMRIVAGLAPPVPKSLVKGKDRAPTRRPPVWAESRQE
FT                   LCEALPYYRSFQSGLYMYKKVAYGYLLEAFPAPRDVWADNGRVIISHGGGQCICAKLPD
FT                   GTQGPPILQTDQSPLNARIETLLQAAERRTPLVLIAGEGYRQLPWKLDCAYVVLGWYWI
FT                   SYTWVEAEPVGKGVLPPRDRDYFHRYKIRFDWVKNQGEPWWDCESDLSLNLGTSPKNTP
FT                   TTTVPQTPGCANVHEEGPSGLGAAARLIIPVEPLRHVNSGFILNAPDHLSPNNDIMRRD
FT                   CSSGFEDKLMYYSAEGCGKWPRGDEEMTSCLPTVTDQDEEPSIHLYDTFVCPNCHQKTP
FT                   MIYKEGQICVKPSCPAFFLLRTAYGLFPIPPGFSLTLNPSFLLLRPTPKSLENLPYDLV
FT                   PPTLDESISEGAECKANLGGRALWKGWVCTDCERANCRYKWEVWECRNCGNLFAPLSRN
FT                   ESMPLSGLSFHFPPFMGDAMTMHTGRIMMLSSMKNIAIAYDLPDAGTVYHVISHDRIVA
FT                   DKLFHDYQIEAARGFCFQRRALKANTVKGALLAQHFAVNSGAPYKYNVDTLSVPFDQSP
FT                   SCVMAALNLISSGTSDVLKADTEFNEILSVIYREGQKMGWHDDGEPGLGPVVASLCLGS
FT                   PADISFRPKVVNRANGTSNAEVALSFTLSHGDIMIMQGRDIQKKYHHRAMPYGLRIAAT
FT                   ARMISDS"
FT   gene            457571..461160
FT                   /locus_tag="CNH02370"
FT   mRNA            join(457571..457853,457918..458162,458215..458920,
FT                   458970..459190,459245..460558,460609..461160)
FT                   /locus_tag="CNH02370"
FT                   /product="calcium-transporting ATPase, putative"
FT   CDS_pept        join(457733..457853,457918..458162,458215..458920,
FT                   458970..459190,459245..460558,460609..461022)
FT                   /codon_start=1
FT                   /locus_tag="CNH02370"
FT                   /product="calcium-transporting ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45105"
FT                   /db_xref="GOA:Q5KCV6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV6"
FT                   /protein_id="AAW45105.1"
FT                   /translation="MLSNAWTFTPQDALGYFGTNPDTGLTEEQVKRNREAYGENSLPES
FT                   APNSLFKLILAQFQDQLVLILLGSAVVSFILAIFEDSAEPGGSWMTAFVEPLVILLILV
FT                   ANAAVGVIQETNAEKAIDALKEYSPDEALVLRNGRLSRVSASSLVPGDIISVHVGDRIP
FT                   ADCRILSFSSSSFRVDQAMLTGESMSVGKTDAAIKDDSAVKQDMTNMLFSGTIVVNGAA
FT                   KALVVLTGSRTAIGAIHSSISKGDEEEEKTPLKRKLDDFGDQLAKVISVICILVWLVNI
FT                   RHFNDPSHHGWLKGAIYYLKIAVALAVAAIPEGLAAVITACLALGTKKMAKRGAIVRNL
FT                   PSVETLGCTNVICSDKTGTLTTNQMSVSRFVTCDDAGFTEYQVGGTTFAPIGAVTRSDG
FT                   QPLDKSTLITPIIRKLSEICAICNDAKVAYHPESETYSNVGEPTEAALKVLVEKLGSDN
FT                   DLFNSGLATLDPLARATAVNDYYDSNVKRLLTFEFSRDRKSMSVLSQSSNGTSLLVKGA
FT                   PESVLERCSNVLLPNGVKAFTPELRKKLEEKQLEYGHKGLRTLALAYVDESDGDVSHYK
FT                   TDRSEDYVKFERDMTFVGLIGMLDPPRPEVRDAIAKCKTAGIRTIVITGDNKNTAETIC
FT                   REIGVFGHDEDLTGKSYTGRELDALSHEEKIAAVQRASLFSRTEPTHKSQLVDLLQGLG
FT                   LVVAMTGDGVNDAPALKKADIGIAMGTGTDVAKLAADMVLANDNFATIEKAVEEGRAIY
FT                   NNTKQFIRYLISSNIGEVVSIFLTVLLGMPEALIPVQLLWVNLITDGLPATALGFNPPD
FT                   HQIMKTPPRSGKEPLVGGWLFFRYMVIGTYVGCATVFGYAWWFMFYTGGPQISFYELTH
FT                   FHQCSSVFSNLDCSMFTGLPAQRATTVSLSILVVIEMFNACNSLSENESLFVLPLWSNP
FT                   YLVASIILSMALHFMILYVPFFREMFRITALNKEEWIAVIVISFPVIVIDEVLKFISMR
FT                   MVKSEKSGKAQLKEKAE"
FT   gene            463969..466226
FT                   /locus_tag="CNH02360"
FT   mRNA            join(463969..464590,464642..464731,464788..466226)
FT                   /locus_tag="CNH02360"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(464294..464590,464642..464731,464788..465894)
FT                   /codon_start=1
FT                   /locus_tag="CNH02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45104"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV5"
FT                   /protein_id="AAW45104.1"
FT                   /translation="MLSSTPSSSQQESIRTPLAQSASLPPSFAMPGQSERPDSEEVKLR
FT                   RSPDTTPSSPSVSASVSATASSPQSLPDTRGISMKEDGEEKDVDKLLKKVELEKKMHQL
FT                   QQRLELASVKASNGWTDLSVKEIETKLPSTPFRSRKAHLSVNTRSPKGNNQVSASPAIP
FT                   YEPPSPSRPWQLIDVLWQPLPPPSHGMYPTSPTSPMKRARTDDHPEAPRPNGGSHAYPV
FT                   ALSSPGGSRTAGLGHRRASSSLSGQTLDKRMMAAGPSSPLRYGFEHKERKKRSQSQSTH
FT                   YRDRVPTEQTTSQDVDAAKALTFMLGGGSEDGGSMSRRSSSSLLPAAETSSLPLPDSFA
FT                   NSAPLSPTMSSRRLSQQTTPRPTVARTPNSHARSNLLRNSGVSNDDKRPEEDQDAAELM
FT                   MFLAHSPSPLKSARKSVPAESADLPDKPSFGAAARVLFAEEDKVKPPLHSILGSSLPSS
FT                   SHGKSHSRTSSYSHSNLALAPPITPDSKDADNSRVENEI"
FT   gene            466799..472753
FT                   /locus_tag="CNH02350"
FT   mRNA            join(466799..467128,467236..468149,468202..471065,
FT                   471124..471192,471249..471446,471506..471568,
FT                   471634..471693,471756..472016,472068..472328,
FT                   472405..472753)
FT                   /locus_tag="CNH02350"
FT                   /product="protein-histidine kinase, putative"
FT   CDS_pept        join(467075..467128,467236..468149,468202..471065,
FT                   471124..471192,471249..471446,471506..471568,
FT                   471634..471693,471756..472016,472068..472328,
FT                   472405..472505)
FT                   /codon_start=1
FT                   /locus_tag="CNH02350"
FT                   /product="protein-histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45103"
FT                   /db_xref="GOA:Q5KCV4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV4"
FT                   /protein_id="AAW45103.1"
FT                   /translation="MILGTDIDLSSIPTAFLEAYPFPAVVIVIDSSLRPRPPLHSRDTD
FT                   VTVRQTDGQISPLASPPVQQFASAPVAWGNQRWNELTQGKTIAECVDVISQNKLQTWVE
FT                   GDIGEKSESFTLDMKLPEGVTLHLAKTILPLSPPSASQSFCILTSQYINKPESFTPSIS
FT                   SSDVLFSPLPRFSQTFSRSSSFSSNPRRSIDVPASLPGHRGSATSTSSNLRSSVDLTSP
FT                   NSEYSPPSREQSTYFTHRFAVREERPSVRRRRSPPNSFKRSKPPESHAQDCWDLVENFD
FT                   WSKTALGPREQWMDALDPVLAITFESRTADCAWLGPDLELVYNKAYQELIDHPSAFGKP
FT                   ARQVWATNWDYLEPLVKRCLSGTPVYKDNDPLFWRRYGNGRLLEHYHTWRYVPITGKDG
FT                   SVLGIFNQSIEVTDSVLLERRMGTTRELLEHMSFIRTTEDFFSSIADVFSQNPTDIPFA
FT                   LCYRVRQVDTDGTFVHLDVSLQSSVGVPEGHPSAPDQIPISFFNGNPYPSNVERSFSPA
FT                   FSIVSIHSSSSHRVCHVSEDTTQWPIAKALQRRQCVIIEECSQLIEGYPIRRWDELPFS
FT                   AIVVPICSEGSPEIPDAVVILGLNVRRCFDHEYDSWIHSIRSQLSSALVTVKAREAEQK
FT                   MVEENARMEKAKVAWFRGAAHDLRSPLTLVAGPLADVLDSDLSPNQRTSLTVAQRNLDR
FT                   LVRLVNALMDFSRVEAGRMEGRFVPTNLSQFITQLAALFKPAVERLGLEYVLDVQPREE
FT                   LVFVDPVLFETVVSNLIGNALKYTETGCITVRVKYTDYAEVSVIDTGVGIPKNELALVT
FT                   EWFHRASTAIHSGTQGTGLGLALAKELLKLHKGELLVESQTANESGGPHGSIFTARVPL
FT                   DFKPSPSAHIIPSVESPKTFGKYSQVVANEAMRWVGDSDDFSEACDMSSGTGGSSASNG
FT                   SGNTTAFGPKFADAFLFDRNDVVLIVEDNADMREYIRQLFTPYCTVVEACNGEQAYSMA
FT                   TQNPPNLILSDVLMSKLSGTELLQKIRSHPDTRIVPMVLISAIAGDESRVEALLNGADD
FT                   YLAKPFKPKELIARVHLHMQVGKKRAKLEALYAQRETELTALSDYCPIGIFRGDKYGHI
FT                   VYANAAWRAQSGLLVGDPNDWASYVHPESKAQLLEEWNQWLRGDLKEFRAAWRWSNGIP
FT                   VRSILVRLDHVKEGFSGLIGCVVDVSHEERRLIEAEERRKEAEESKHQQELLIDLTSHE
FT                   IRTPVSAILQCSDLVKENLVALKDQLRGAGPKGFVPTPELLADLEQDVEALESIYQCGL
FT                   VQERIAGDVLSSTSSSAVRKITIQYDVSFVPPADDSCAVPSSGVPDILPAKENTPLWLF
FT                   VSVTDSGPGMTEQELSVLFQRFAQGNKMIHTKYGGSGLGLFICRKITELLGGRIEVLSQ
FT                   LGHGSVFRFFIKTRAVAPPSAIAALVESSPLKPISATSPSSSLAMSRSSSRSTNVTTPI
FT                   EGSGTEHVLIVEDNLINQTVLKRQLIKAGLSCNVASNGLEALNIIRETHRQHRRGGPNR
FT                   KRLFDVVLMDLEMPVMDGITAVQEIRGSEAAGTLGRNMVIALTGNARQGQIDHALASGF
FT                   DDVVIKPYILVDLLKKIKFMKVRRLELETAKAQEE"
FT   gene            473040..474017
FT                   /locus_tag="CNH02340"
FT   mRNA            join(473040..473124,473162..473492,473547..473699,
FT                   473762..474017)
FT                   /locus_tag="CNH02340"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(473075..473124,473162..473492,473547..473699,
FT                   473762..473947)
FT                   /codon_start=1
FT                   /locus_tag="CNH02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45102"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV3"
FT                   /protein_id="AAW45102.2"
FT                   /translation="MASPAPQGDQRDLPPPWIRQFDPSYQTYFYVNPTTNPPTTSWTHP
FT                   GLAEGQVHPEQAQAIHEAGQTGGDNQGEAAKFLNSGSVADPATGSYNQPGEIQGAGGQT
FT                   PEAGERGLGSMVSGLMGKTNNNNQYGYNQQQYPQQYPQQQQQQSGGSKFGFGTGMVAGG
FT                   AALLAGKLISNVVGGRHNSSGGGMFGGGGGYSHNMGPPPFMGGGHHGGHGGHHGGGGMF
FT                   GGGGGGPGGFGGGPGRW"
FT   gene            474065..476128
FT                   /locus_tag="CNH02335"
FT   mRNA            join(474065..474920,475030..475133,475201..475530,
FT                   475597..476128)
FT                   /locus_tag="CNH02335"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(474184..474920,475030..475133,475201..475530,
FT                   475597..476060)
FT                   /codon_start=1
FT                   /locus_tag="CNH02335"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M624"
FT                   /protein_id="ALO69518.1"
FT                   /translation="MTESAGHSSPPMSPGTQPAAQPPVTLKLKHSMADRANYSSSEEEE
FT                   EGEEEQLAEDRLSTSPPPKRKKLSSTPTNSSAASKGKQSIKLTLGPQHAHLQQPSSSSS
FT                   ASAGSAANQGKKSYDWLQPSAAGASHSGPPERERERERSALSPGDLPSALSPGDLPIPS
FT                   VSVASAASGSSTKSLGMSPAEEAIGGLLDESVDDNTSTNDNGDPSTLKKENQSAPKAKR
FT                   SHHKKKASDAPPGPGRNWKKGMKKAAPGAPGVKLENEGTPASTPAFSAISRETSPDPLG
FT                   LPSPRLAPDTQSMTITPAPVPLPSASCPPSPPFIPADPTTLGFPVFSHPIVPPKIHLGT
FT                   FPKVTSFFAPINGGDSGPFPRKEKVRSWTFQEKGIVGVGGGVMKYKSWARGPTSELERA
FT                   LQEEKDAQTPQRQPKAAKGTNATSTPAPQTGADPTASASASSTPAPPNAANAADITTVN
FT                   DDRPNVSRADSFDMSMNASPGPPGDDESENGSEIAGPTSTPPAGGKKKMGSAPAKKKGK
FT                   TPKSKLAQEIVIREDNEGAPVEQAIAE"
FT   gene            complement(476182..481695)
FT                   /locus_tag="CNH02330"
FT   mRNA            complement(join(476182..476770,476849..479798,
FT                   479862..480144,480195..481126,481184..481277,
FT                   481326..481618,481655..481695))
FT                   /locus_tag="CNH02330"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(476252..476770,476849..479798,
FT                   479862..480144,480195..481126,481184..481277,
FT                   481326..481618,481655..481686))
FT                   /codon_start=1
FT                   /locus_tag="CNH02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45101"
FT                   /db_xref="GOA:Q5KCV2"
FT                   /db_xref="InterPro:IPR002913"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV2"
FT                   /protein_id="AAW45101.2"
FT                   /translation="MTLDSLDDGTKLEAAYTHALHSALAFFKALHSSTPSPAWKPVALP
FT                   QPAQKHARHTAGLAKLAAADVAVHRRSAKHGDVYRATVDVDCGSDISVDTFRGCLATPE
FT                   TRPLWDRMVEEAVTLDLLDAHTRVTKTNYRLGWPSSPRDTVTISKTLVDSHTIIDISTS
FT                   LPRSRHEPSYLRPSPPYVRAHVSLLAWCIQLPSSSSADNIPDGKARISCFWSWNPKGTW
FT                   AVGGGVPQHLPSLIVGLVDYIRDKSDRVPVLLGYGPDISIGSVSYDTSRVTLGVHYAIV
FT                   NNGAENAETESLRRQVEFGLSSTQSWDIQITVKTQSGKDTPSTFWTSFVGQAPTVDPNA
FT                   RAPKRLILRFAHSPLEPGEELVRVNMSIEQTTGSTAGVRINGIPITIERMQPTDETGQG
FT                   PKRPLLEDTASMTGVSLRTISTTVDKQEERNDEREEVVQKGISSLVKRNYIYFTSLLQE
FT                   PEPKWKPVLDSRGVAIHQLDSIDKTLVVYRAEAVFVGVGIWDLFAVIATPGARPVWDKT
FT                   HEEASLVEDVNELTDIWHMQSKAAWPVSARDSVMLRTTYKSPSSVHLFGFSIDDTTLFP
FT                   CIPPSTDPTVIRTQIDLQGWSIESLSPNTTQVTLLEQSDPRGWSGKGSIPQVMLGTLAG
FT                   IGEFAIKHGGPPVCTRLGGAKSLASRYDVESETFRFEYQPAKARRSASSSIATSFPSSP
FT                   PLLMNLKGGGGGESGSDESSLRSVSTEGSKETVECEIRCDADQWSSSFAIVIDPPQQSI
FT                   SALKRHRLSPNGGGLWLTIEHDPALLKSNGKVVITVRRGAPTSSSKTYVTVNGSKIKVD
FT                   VEDLPEAKVQLLKKQKRARPTRAPLDQPPGLTVRKKSSMDMTTASATFSSQISSAVSPG
FT                   LGSASSTFTKVAMPFSKWYNFATETTRSALVPIPTASPLPQVGLSPVEAAVNALRQLTR
FT                   MHADRDGESTTPEGWLPVSDRDGLKIEKKVVPHVSETFPVFRAGRIIEGFTAEEVSSAA
FT                   SSLKANERFEKPVVLEEYGHGIKTAHVVAHTTFPFRGRSLLVASIVARMADPPPASPSI
FT                   HGPQTPLSTIFHARTSNFDASITNLDPSKYNPTSLPPGNIILEGWIFETIDPYSHEQYA
FT                   IPSTRCMYIASVDYSCSMPLSVNNMLNSSLPRSLLAIEGLLKNEGPPSRARDPDMAVLA
FT                   PEEKDRVVGKKIIWGLRTVDEARLGVQEINDDSEYSLTVTIHPSAAATPSFSRSETLSP
FT                   TLKHNDSRTSVNSRSTVIDLGEEIRKGKKDLVVMEVEVGSRAVTNRCIIELTAVSLPVA
FT                   LHSSLSLGSPAGTLIDSTPAVLEGARDAASIGTLPLTLPSLTTDLPFKPTIISLAPSVL
FT                   QTASLDPSSPARHLLRVTLPTSGYDTPINDPLTGPGTPLPRPRWLLDLINDGAVVQLKL
FT                   KTSSETESLQTGAGAGTEGEGKDKNDLERASYIYQGEEIAVQDEKRGKHQGLRDATRQN
FT                   LPQIVSLPLATGNEIDGGGGMKGVRGLNKPLGVRQEFLKEGVKVASVEEKKEEGGDGAE
FT                   GGKTVEIQPVLSPVPRPALVEQPRYTYNFWRYSRLPRFSTSTPSTAPGSPVKPQSSPPL
FT                   ASAVATQPDGAPVLQTGSSGNGPLSAVKVAETAQARELTGILRPVTSLPGLIIACIVCF
FT                   LVGSFLRSLLSDADYVIYQPSSLSGTLPDIQGAGPWRELRRLAEWKIGWDRDLVIAIAR
FT                   RRG"
FT   gene            481947..483605
FT                   /locus_tag="CNH02320"
FT   mRNA            join(481947..482073,482117..482336,482523..482547,
FT                   482685..482743,482900..483298,483365..483371,
FT                   483434..483605)
FT                   /locus_tag="CNH02320"
FT                   /product="protein secretion-related protein, putative"
FT   CDS_pept        join(481954..482073,482117..482336,482523..482547,
FT                   482685..482743,482900..483298,483365..483371,
FT                   483434..483467)
FT                   /codon_start=1
FT                   /locus_tag="CNH02320"
FT                   /product="protein secretion-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45100"
FT                   /db_xref="GOA:Q5KCV1"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR040250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV1"
FT                   /protein_id="AAW45100.1"
FT                   /translation="MARLPPLAVLFAALGALAHGDHSFDLSDQADNALSYAERHMHTEH
FT                   HIDSFDLESFFKLHDLDMNGYWDELEIQAVYGLHHHSLKDKMRKGAQVDARAQNIVSKV
FT                   LEALDKNQDDHYDEESEYCTIPRPRLKQTSHIPIQKVHHAEIEDEEDARERRFEGLPPT
FT                   ADLTKDHVAADPLDHHEHAPGQGPLDENENPQSRGDGDGDENDFKPGDEVDPPPVRVPK
FT                   RVDPGAAPQRIVKAGHLEELGGLKQAALEQPGWVGGARPKSAEERLRAGVPYKYKMRKG
FT                   FRYDEF"
FT   gene            complement(483614..485965)
FT                   /locus_tag="CNH02310"
FT   mRNA            complement(join(483614..483836,483904..484038,
FT                   484174..485078,485145..485238,485315..485401,
FT                   485466..485535,485618..485965))
FT                   /locus_tag="CNH02310"
FT                   /product="expressed protein"
FT   mRNA            complement(join(483614..483836,483904..485078,
FT                   485145..485238,485315..485401,485466..485535,
FT                   485618..485965))
FT                   /locus_tag="CNH02310"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(483777..483836,483904..484038,
FT                   484174..485078,485145..485238,485315..485401,
FT                   485466..485535,485618..485778))
FT                   /codon_start=1
FT                   /locus_tag="CNH02310"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45098"
FT                   /db_xref="GOA:Q5KCV0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCV0"
FT                   /protein_id="AAW45098.1"
FT                   /translation="MPRYPLINAIGSIVISAITLTSALYLLVLLHRQGKGKLRVRLLVG
FT                   MVVSDLLLGVVILPPDAMYLAGRKLVTGSAGCNAQGFILIAILFTQHLWTLAIVISTFL
FT                   LLRHPLSRVTFLLERYSWVITPVIWGVSILHAGLWYHYIGYTNTGNLCYYGTRSARVGL
FT                   DRDICQFIPRAFVFLVTIILYSRLFTFLRRPDTIQLSFHSTPKTSIIDVRSAQPARLPI
FT                   AKLSKKLGITLSAACPQSPKKEVNPEAPWEAMEFIQVGNVDLLAPDATVTCVNDCAAAR
FT                   PPPASHFRALALESGSSSTNTLSAIAPPCKTEDASGTVQLSYDGSALISSSPKIGSSGV
FT                   DVGVGVEASQTSMTIASAGCTTGFPALVESEKKVVGVKEEGEEPPEEQRQTLKEFFAEH
FT                   QMSAAELGAVGKNGGGCQQRSATSYFNRQASLLMLYFPFAYMAVFSVSLVRLVYDMAYS
FT                   GSSNPVLGIISHWMVLSAGVIDGLVYGIAEFMVKRKVRRKMPEHL"
FT   CDS_pept        complement(join(483777..483836,483904..485078,
FT                   485145..485238,485315..485401,485466..485535,
FT                   485618..485778))
FT                   /codon_start=1
FT                   /locus_tag="CNH02310"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45099"
FT                   /db_xref="GOA:Q5KCU9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU9"
FT                   /protein_id="AAW45099.1"
FT                   /translation="MPRYPLINAIGSIVISAITLTSALYLLVLLHRQGKGKLRVRLLVG
FT                   MVVSDLLLGVVILPPDAMYLAGRKLVTGSAGCNAQGFILIAILFTQHLWTLAIVISTFL
FT                   LLRHPLSRVTFLLERYSWVITPVIWGVSILHAGLWYHYIGYTNTGNLCYYGTRSARVGL
FT                   DRDICQFIPRAFVFLVTIILYSRLFTFLRRPDTIQLSFHSTPKTSIIDVRSAQPARLPI
FT                   AKLSKKLGITLSAACPQSPKKEVNPEAPWEAMEFIQVGNVDLLAPDATVTCVNDCAAAR
FT                   PPPASHFRALALESGSSSTNTLSAIAPPCKTEDASGTVQLSYDGSALISSSPKIGSSGV
FT                   DVGVGVEASQTSMTIASAGCTTGFPALVESEKKVVGVKEEGEEPPEEQRQTLKEFFAEH
FT                   QMSAAELGAVGKNGGGCQQRSATSYFNRQASLLMLYFPFAVSFFFGFLDFWIFFFFRVP
FT                   LRIPGGVTRKVLMEGPDADICGGFPQYMAVFSVSLVRLVYDMAYSGSSNPVLGIISHWM
FT                   VLSAGVIDGLVYGIAEFMVKRKVRRKMPEHL"
FT   gene            complement(487674..489002)
FT                   /locus_tag="CNH02300"
FT   mRNA            complement(join(487674..487884,487925..487984,
FT                   488048..488366,488416..488580,488623..488707,
FT                   488759..488770,488830..489002))
FT                   /locus_tag="CNH02300"
FT                   /product="arf-related protein (arp), putative"
FT   CDS_pept        complement(join(487869..487884,487925..487984,
FT                   488048..488366,488416..488580,488623..488707,
FT                   488759..488770,488830..488910))
FT                   /codon_start=1
FT                   /locus_tag="CNH02300"
FT                   /product="arf-related protein (arp), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45096"
FT                   /db_xref="GOA:Q5KCU7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU7"
FT                   /protein_id="AAW45096.2"
FT                   /translation="MYHLVKGLHDYLTRKDEYSVVIIGLDNAGKTTLLERIKTMYNPTP
FT                   GMAPDKIGPTIGQNIGKISLPSTTLLFYDLGGQRDIRTIWEKYYDECHAVVFVLDATDQ
FT                   ARLSETWEVFDEVLNSPRLLNLPLLLLANKQDSPSCLSVAEIRESFDAWQRARTNRNQD
FT                   GNKDDLKEPGKGKAPLKEADEPRETDASRTEGQGWDDGGAKEERMASLDVMGVSALEGT
FT                   GVSDAINWLYIRVQNARKIEPRE"
FT   gene            489112..490361
FT                   /locus_tag="CNH02290"
FT   mRNA            join(489112..489221,489276..489315,489373..489402,
FT                   489455..489473,489528..489760,489813..489991,
FT                   490046..490109,490164..490361)
FT                   /locus_tag="CNH02290"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(489159..489221,489276..489315,489373..489402,
FT                   489455..489473,489528..489760,489813..489991,
FT                   490046..490109,490164..490270)
FT                   /codon_start=1
FT                   /locus_tag="CNH02290"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45095"
FT                   /db_xref="GOA:P0CM14"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="InterPro:IPR027514"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM14"
FT                   /protein_id="AAW45095.1"
FT                   /translation="MAKTYTPEEAEALVHSHDPEHPANLICDLCREFYKLGWVTGTGGG
FT                   ISIRKDDVVYLAPSGVQKERIKPEHIFVLPFAQSSVPKPGSKRDFIRIPSKKGLNESQC
FT                   TPLFWNAFTMREAGACIHTHSQHAVLLTLLLPRDAPSFRISHQEMIKGVRLGGVGKTLK
FT                   FFETLEVPIIDNTAFEEDLTEGMAAAMARYPDAPAILVRRHGVYVWGNTWEQAKTQAEC
FT                   LDYLFEIACKMIQNKIPLEGDT"
FT   gene            491584..493561
FT                   /locus_tag="CNH02280"
FT   mRNA            join(491584..491649,491711..491756,491808..491895,
FT                   491941..492197,492245..492594,492649..493264,
FT                   493320..493561)
FT                   /locus_tag="CNH02280"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(491685..491756,491808..491895,491941..492197,
FT                   492245..492594,492649..493264,493320..493561)
FT                   /locus_tag="CNH02280"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(491747..491756,491808..491895,491941..492197,
FT                   492245..492594,492649..493264,493320..493351)
FT                   /codon_start=1
FT                   /locus_tag="CNH02280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45093"
FT                   /db_xref="GOA:Q5KCU5"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU5"
FT                   /protein_id="AAW45093.1"
FT                   /translation="MSDSGTLSLLAGIVFLVLWTVVWSICLLGWRTARIRYAHPNIPSR
FT                   LSKLPVSSAPGVTIIRPLCGLDQNLYNTLESVMKLEYPKFEVIFAVQNEKDEALPVVNM
FT                   VMEKYPEVEAKVIIDSRKVGVNPKVNNLMTPFQEAKYDMLWILDSTCSVLPGTLGRSVE
FT                   AFFSNTSSTASPYDPESSPLLSISDDVRKPPVAGEVGLVHQVPIAVCYQKTWGSLIEQA
FT                   YLNTTHAKMYLAINATSIDSCVVGKSCMYSRDNISHLTTPSPSLRSLPDPPSGLAGFGP
FT                   FLAEDNMIGLSLWHELKLKHSMTSDVVLDFIGSLSVREYVNRRIRWIRVRKKMTLAATL
FT                   LEPLTESIISGLYGAWAISRLLGGNILPLFLLHMAAWISVDLSTKRALETNIKGIGPPE
FT                   NKVTFLMAWAARECLALPIWILAMTSSEVVWRGQKYKIIDSGEAIRLDDRN"
FT   CDS_pept        join(491747..491756,491808..491895,491941..492197,
FT                   492245..492594,492649..493264,493320..493351)
FT                   /codon_start=1
FT                   /locus_tag="CNH02280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5KCU5"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU5"
FT                   /protein_id="ALO69519.1"
FT                   /translation="MSDSGTLSLLAGIVFLVLWTVVWSICLLGWRTARIRYAHPNIPSR
FT                   LSKLPVSSAPGVTIIRPLCGLDQNLYNTLESVMKLEYPKFEVIFAVQNEKDEALPVVNM
FT                   VMEKYPEVEAKVIIDSRKVGVNPKVNNLMTPFQEAKYDMLWILDSTCSVLPGTLGRSVE
FT                   AFFSNTSSTASPYDPESSPLLSISDDVRKPPVAGEVGLVHQVPIAVCYQKTWGSLIEQA
FT                   YLNTTHAKMYLAINATSIDSCVVGKSCMYSRDNISHLTTPSPSLRSLPDPPSGLAGFGP
FT                   FLAEDNMIGLSLWHELKLKHSMTSDVVLDFIGSLSVREYVNRRIRWIRVRKKMTLAATL
FT                   LEPLTESIISGLYGAWAISRLLGGNILPLFLLHMAAWISVDLSTKRALETNIKGIGPPE
FT                   NKVTFLMAWAARECLALPIWILAMTSSEVVWRGQKYKIIDSGEAIRLDDRN"
FT   gene            493698..495070
FT                   /locus_tag="CNH02275"
FT   mRNA            join(493698..494087,494143..495070)
FT                   /locus_tag="CNH02275"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(493808..494087,494143..494891)
FT                   /codon_start=1
FT                   /locus_tag="CNH02275"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5U8"
FT                   /protein_id="ALO69520.1"
FT                   /translation="MASAHLRPCQQQGPRLAISIPPQLRLTKSQPHLQLNDRSTLSIEN
FT                   DPMSPSTCSRFVGLGEDEGIWQERCMILVRERYRRHRDIEKLKKRIDGLEYQQQHFIRM
FT                   CAKDDIPALKELRTELQTILEEIKVGKVESEAVLRQAAKPPTFSPLKDRREDRPVNRLI
FT                   RPFSTMFPSTKYQADYLADQLIPPRRTRSMNPGFAQWPPPIAEANEKRIDSWRRRTAEP
FT                   SNVPGLSSSHGDTQTIFPSFHQPERQLEPRRNEAPLGNQEPAATPLHAASPSRPSSNYI
FT                   ALGHSGSQRVVHIEDVNVFDEDDESEDFPIWSLRRKRHEARGSKLLSKISFPWRRSSYF
FT                   ER"
FT   gene            495501..500736
FT                   /locus_tag="CNH02270"
FT   mRNA            join(495501..495740,495918..496398,496440..497355,
FT                   497406..499787,499846..500443,500498..500736)
FT                   /locus_tag="CNH02270"
FT                   /product="chitin synthase 4, putative"
FT   CDS_pept        join(496041..496398,496440..497355,497406..499787,
FT                   499846..500443,500498..500515)
FT                   /codon_start=1
FT                   /locus_tag="CNH02270"
FT                   /product="chitin synthase 4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45092"
FT                   /db_xref="GOA:Q5KCU4"
FT                   /db_xref="InterPro:IPR004835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU4"
FT                   /protein_id="AAW45092.1"
FT                   /translation="MSRPHLQQNVSFQDTKPPSRRAARDDIPPRPPAKSDPSKASLTTT
FT                   TTVQSVAGYNNQLDFDDNAYVDAGSSNPQGFSDYNGVRRKKSMVRPERERIDPNHRLWH
FT                   YREHAAEDQVDIQPSSTGNQPYNQYNSQRPGANLRRGKSLLARETDDVDDSSGLNIFKR
FT                   GATIRRKASRATPRQAPTGAQSNRVSAGQKEDEECCCLGNFAPGPKDCWMVYCYLLTIC
FT                   IPGFVIAKVFGKKTPDAQRAWREKMGIVSIVAYLMAAVGFITFGFTQTVCGDTQLRLPG
FT                   GSANTGSLVINGYDYDFSTWSHPAAGDTFNGSTSPLYMDQYMAGGMDASFLFQNVNQHC
FT                   LGVITPANGTGIDHDGEQMGWYFPCNLHDQNGTSAANLTGYTDRTNCHVSSYARSNFSA
FT                   VVPTAEIYYTWERVKDESRNLAVYKSAVIDMNLLQWLDDTQVTFPSFFNTIMNRNDTYA
FT                   GKDITALIERADLSQYARCLTDIIQVGFVDTITIGCIMSDLVLYVSLVFILGAVFIKFG
FT                   MAVVFGWFLSWRMGNFKGESYQERMKRAAEIESWTDDIYRPAPGYLRPNATGTARTGVK
FT                   KNFLPTTSRFSRAEPMLVSSSRPSTSYGMVGETRRQGSSIYGNKLGPPLHTTPPGSPLL
FT                   RNSRSSTSLPFRDDSRHSISDRSVNNNMPCPFPLGNVVPQPAPDFEPFGYPLIHSICLV
FT                   TAYSESIEGLRTTLDSLATTDYPNSHKLILVICDGMVRGSGSKQYTPEIVLGMMKELVT
FT                   PAEEVEAHSYVAIADGHKRHNMAKVYAGFYAYDSETVEASKQQRVPMVLVSKVGNPLEV
FT                   NDAKPGNRGKRDSQIVLMSFLQKVMFDERMTTLEYEFFNAVWRCTGIPPDRYETVLCVD
FT                   ADTKVFPDSLTRMNACMVNDHEIMGLCGETKIANKSETWVTMIQVFEYYISHHNTKAFE
FT                   SVFGGVTCLPGCFSMYRIKAPKGDRGFWVPILANPDICEHYSENVVDTLHKKNLLLLGE
FT                   DRYLSTLMLKTFPKRKMVFCPQAVCKTIVPDTFRVLLSQRRRWINSTVHNLCELILVRD
FT                   LCGTFCFSMQFVVFMDLVGTLVLPAAISFTMYIIIISIIPESVTGTPRPVISLILLAFI
FT                   LGLPGVLIVITSRKVAYVGWMLIYLLSLPVWNLILPAYSYWHMDDFTWGETRKIAGEVK
FT                   EEAHGGKEGTFDSSHIVMKKWAEFERERRWRTGTASRDSQYFDVVQRANSPRSGIPSNR
FT                   YSVVSTSETFNSGLGTAESNHLFRQSQSFASMSQVAPSPETNYGNVSQLALPPARGASI
FT                   GREQSPSSTESGASNNYGGHGSSEDPSGSSHADPYYQPFTNEVYQDEAEQPILPSEYHP
FT                   TTSPEPVYQTAPARVRQPSQRGVSLVDTGPVRSAQAAPHDAVRRVSRHQRRSSSKNQLV
FT                   SPISSGGHTGNLPPGAAPPQY"
FT   gene            501001..502223
FT                   /locus_tag="CNH02265"
FT   mRNA            join(501001..501112,501221..501453,501514..501615,
FT                   501674..502223)
FT                   /locus_tag="CNH02265"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(501100..501112,501221..501453,501514..501615,
FT                   501674..502084)
FT                   /codon_start=1
FT                   /locus_tag="CNH02265"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5V3"
FT                   /protein_id="ALO69521.1"
FT                   /translation="MSFQGPLHMFHMAHDGSSARPYTLSASVHHSTLAPASVDDTLSKK
FT                   EDVEGRRISNGTDEEKTDIVIKKKISRADSKKSIESSFTPQAQNSSVSLVTMNGNMNTP
FT                   MEIENLPSLVQSTDASTESSVVLKTPPKSARASYGLVEHITIAFSAWQSNGCNHRFDNN
FT                   QTGQFSEPGSQIFGICQQDSHHEETKMLNGLSEETLKIMARAGKRDLGAGVVQETWIEH
FT                   IMAKTKLGKGVVGITGKPRFFIGDVDGYAV"
FT   gene            complement(502194..505651)
FT                   /locus_tag="CNH02260"
FT   mRNA            complement(join(502194..502350,502441..502905,
FT                   503059..503250,503318..503467,503539..503582,
FT                   503631..504192,504239..504623,504680..504822,
FT                   504883..505023,505076..505651))
FT                   /locus_tag="CNH02260"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(502312..502350,502441..502905,
FT                   503059..503250,503318..503467,503539..503582,
FT                   503631..504192,504239..504623,504680..504822,
FT                   504883..505023,505076..505558))
FT                   /codon_start=1
FT                   /locus_tag="CNH02260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45256"
FT                   /db_xref="GOA:Q5KCU3"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU3"
FT                   /protein_id="AAW45256.2"
FT                   /translation="MYRPRPRSRSPDRTQRAYSPSRPLSPPPTRYDRYPPRRHDDYPPH
FT                   PAPDSRRYGDYPPEMPDYPKNQSMGYGEPFYRRRHEEPYPGNRYMDEPGYAPPRRERNE
FT                   REYDDWGSDGRSYEPRGRDWERGYDRGMAIDREEFPSRRDADPAHEQWERGRDPELARY
FT                   DAPYSAGPASDLGNQSNHGRKGKNPSEPSMDVIFLGLDPELTEDDFLGYLRTEHKAAIS
FT                   GVKIVRDKFTGASKCFGFAQFQSLDGASDFINNNYPTVLMPALYAHSDPRKVKIDFSTP
FT                   QQNPHSGHGSYQSAPMYVRPGHDGMRDIGSPGGGKRVLLLRGLDSMTTPDEVIRRIGQE
FT                   IARMVGKQGRESEAESSIVRVVLIVDKSARSSWGYGFVELATSELASALLPFLLSPQHQ
FT                   PTGFLIHDVPVATSFSNPSSFVPVSAGPLGGEFIIRPSRFGGFGSETIDKPEGQWCAYW
FT                   HEKGGAMESVPRGAPAIGEDGNVELTPAHRAFLGSLAGVPQSQATSSQGPQSVQTTGMT
FT                   SASVEGVMQPIKIGIGKGKKKEEAAIIPITQKRSLLDDGEEDDKVGKDTVLLSRTKGAR
FT                   IVPPTSSSRKIASNINKWNTKQSELAIPDPVSESAPPKGISDANSAIGTRRPVNAESGS
FT                   NPAQPIVMPAPSPSVLPTATQAEEFDYTDVSTLATTGKVACLLCQRQFKSEDILRKHIA
FT                   QSDLHKNNLQDTAICQAGQRRKDAISSSTTTPEPSASIYRDRAAERREAFNQPAVPSRA
FT                   EREALAASTAAYQGKRKPPPVKSKQPSSPEPSKQTEENNVGNQLLAKMGWKTGEGLGLA
FT                   GEGRAEPIKVQQFESRAGLGASKGVEAGRWSGPGGWQQRAKDMTKERYNSESGQK"
FT   gene            505809..507536
FT                   /locus_tag="CNH02250"
FT   mRNA            join(505809..505908,505958..505968,506020..506052,
FT                   506108..506218,506280..507536)
FT                   /locus_tag="CNH02250"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(505884..505908,505958..505968,506020..506052,
FT                   506108..506218,506280..506369)
FT                   /codon_start=1
FT                   /locus_tag="CNH02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45091"
FT                   /db_xref="GOA:Q5KCU2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU2"
FT                   /protein_id="AAW45091.2"
FT                   /translation="MAGGHGHFEPVKLDPAIERWSQMRENVYQHFRFTPQKTRQVFTYA
FT                   LLLPALVAGISWTYNNKFDWAGKQKGSSLLANTPAKPLPKSDEE"
FT   gene            complement(506366..509369)
FT                   /locus_tag="CNH02240"
FT   mRNA            complement(join(506366..506753,506811..506952,
FT                   507006..507433,507486..507625,507678..507728,
FT                   507781..507897,507947..508103,508154..508481,
FT                   508532..509130,509187..509369))
FT                   /locus_tag="CNH02240"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(506487..506753,506811..506952,
FT                   507006..507433,507486..507625,507678..507728,
FT                   507781..507897,507947..508103,508154..508481,
FT                   508532..509130,509187..509318))
FT                   /codon_start=1
FT                   /locus_tag="CNH02240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45090"
FT                   /db_xref="GOA:Q5KCU1"
FT                   /db_xref="InterPro:IPR008010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU1"
FT                   /protein_id="AAW45090.2"
FT                   /translation="MKEGNAFNSAEAGPSRPLYNPHRAWSADEVDTAIQTSYGDVEGKN
FT                   GLAKGSLPTPHSHSTSRVSPSATLLRKPHLAIDLPLHMSASEIFIPPVPSSHEQSSGDK
FT                   PSTYSSLPPSPTSEFLSTPKRKTLDRDELEEILDQLGNTSTRSDVDYEVDEGDATDVEE
FT                   WWPARSRRPTIGEEDRPDQGYRSTSGPMSPNSPVSATAAECDSPEGDEGKESSKEISGI
FT                   WELLKDEMGAEDWEGWIADGKWERIANFLAVPLAVEKTTLFGALLCLDGFLYNFTVLPI
FT                   RSSFALARILSNFFRNRPWRPVPIAHLNSILRMLLLVIPTGVLLASTDASKMYHTVRGQ
FT                   DTIKLYVIFNALEIGDRLCCAFGQDVLDTLFARETLSPSVRKRGKGRKRQQARPVFFFA
FT                   LSLGYVLTHSLIFFYMLVSLNVAINSYDYTLLSLLISNQFVEIKGSVFKKFEKENLFQI
FT                   MCADIVERFQLSLMLAVIAIRNMIEMSGSEIAFLPKSFMKGKSLVDSILSPVLFVIMSE
FT                   MVVDWVKHAFISKFNHVRASVYERFTDVLAKDVLLAGSITSSPSRRHRDGKSRNHRILL
FT                   DQSPLVARRLGFASIPLACLVLRISWQAIGMLTMSHSHAEESEFGNGGEEGLWGTVWWG
FT                   LKVASWIGVGICSWGCLMFLKIILGLSLLGFSAMRQEGMDEREAEDSVNDYGRSAVGES
FT                   KEETEYNRQTREYLSKAADDLPDYPSLSSSISQGGVSLPDTKVSHKHSGAQQGNGESDK
FT                   DLDKGIPKTDGGKKGKKWKLEEVERWTMVKRIW"
FT   gene            509555..510325
FT                   /locus_tag="CNH02230"
FT   mRNA            join(509555..509653,509740..509833,509907..509984,
FT                   510051..510325)
FT                   /locus_tag="CNH02230"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(509626..509653,509740..509833,509907..509984,
FT                   510051..510147)
FT                   /codon_start=1
FT                   /locus_tag="CNH02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45089"
FT                   /db_xref="InterPro:IPR007727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCU0"
FT                   /protein_id="AAW45089.2"
FT                   /translation="MSAPLKQSNAQNTVPPPAPQPSFLQKKGLLGAAGRGGVKPGSIVS
FT                   PSDVLSPISAKLNSSKQRHFQKGKPVHLASQLSQLASQASPASKENKPKIDDF"
FT   gene            complement(510326..511450)
FT                   /locus_tag="CNH02220"
FT   mRNA            complement(join(510326..510453,510505..510720,
FT                   510780..511088,511151..511279,511338..511450))
FT                   /locus_tag="CNH02220"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(510403..510453,510505..510720,
FT                   510780..511088,511151..511279,511338..511379))
FT                   /codon_start=1
FT                   /locus_tag="CNH02220"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45088"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT9"
FT                   /protein_id="AAW45088.1"
FT                   /translation="MPSQKFTEYLLNKYADDFKAATTHPFLEQAGKGAIDPRPLRAWLK
FT                   QDYLYAYVGYIKFASSVLSHLHIPTPLSAPSPNTSKAISVLTFSLANVKRETDFFVSTA
FT                   KAHGLDVFSPEANDGAEGGLLGEYNEITRAYVDFLHAVGGVGAVEEGLVLLWAMEIAYL
FT                   TAWRNAKSLRPETLTSADPSSLSQTQQALLKFVDNWTCDEFVEFVADCAEIVDGAGIEI
FT                   GSALAERCETVFKRTLWLEQRFWPSV"
FT   gene            511607..513073
FT                   /locus_tag="CNH02210"
FT   mRNA            join(511607..511885,511942..512160,512211..512472,
FT                   512526..512673,512726..513073)
FT                   /locus_tag="CNH02210"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(511735..511885,511942..512160,512211..512472,
FT                   512526..512673,512726..512986)
FT                   /codon_start=1
FT                   /locus_tag="CNH02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45257"
FT                   /db_xref="GOA:Q5KCT8"
FT                   /db_xref="InterPro:IPR009450"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT8"
FT                   /protein_id="AAW45257.1"
FT                   /translation="MSPPSSKQPLTPSLQINRKPLPKWEKVLWRSQPYPDNYVPPDFLS
FT                   ELNDILPRPRPPFYALLLACLPISQHISIIAIFLAIFAALLEERVTPEAVGWGCVLGGI
FT                   SGWAIWTWGWGRWGPKEPQDSLIPTPTPLRTLILPPLLLSLLSPVLGTLTSATTSDSIW
FT                   PLAGGLGFVHLLLVDFRTGEDVRVVRRRERLRKRRGSVGLKEIGEEKSLTSSLSLTSAL
FT                   SASVVLASRLPSTAHVFSLVLLAVLLFAGWPVITKSVRETGRAYSFVLTVSTTTLALSL
FT                   FPPTPSTFSGIYFGYLPSTPTLVFLLILFLVNFIGPAMLWYAWRWKVRRGGGWDVATVR
FT                   IRQSRP"
FT   gene            complement(513032..513682)
FT                   /locus_tag="CNH02200"
FT   mRNA            complement(join(513032..513310,513369..513476,
FT                   513529..513682))
FT                   /locus_tag="CNH02200"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(513172..513310,513369..513476,
FT                   513529..513551))
FT                   /codon_start=1
FT                   /locus_tag="CNH02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45087"
FT                   /db_xref="GOA:Q5KCT7"
FT                   /db_xref="InterPro:IPR007745"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT7"
FT                   /protein_id="AAW45087.1"
FT                   /translation="MVSLVANSSQVSSPATTLPPRPTSSSPDATAKEVNPLNPNNLKPC
FT                   CACPETKQARDDCFIKSAPGEGETNCRDFIEAHKACMRGYGFKV"
FT   gene            513848..514926
FT                   /locus_tag="CNH02190"
FT   mRNA            join(513848..514155,514227..514249,514342..514391,
FT                   514448..514516,514588..514926)
FT                   /locus_tag="CNH02190"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(514012..514155,514227..514249,514342..514391,
FT                   514448..514516,514588..514664)
FT                   /codon_start=1
FT                   /locus_tag="CNH02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45086"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT6"
FT                   /protein_id="AAW45086.2"
FT                   /translation="MPIPLLRPLTGAVRQQARRGYTSVLEKPSQKPTQELPLRLQAIRL
FT                   YKELHRLGRDYPDPEYDFNKRLRRAFEKNAKVTDPEAMKKQLELGEHIKKEVLALISLK
FT                   KFRHLRRAYHPNEGPR"
FT   gene            complement(514906..523515)
FT                   /locus_tag="CNH02180"
FT   mRNA            complement(join(514906..515047,515105..515339,
FT                   515396..515561,515615..515779,515827..520683,
FT                   520739..521375,521439..521987,522036..522124,
FT                   522179..523276,523324..523515))
FT                   /locus_tag="CNH02180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(515005..515047,515105..515339,
FT                   515396..515561,515615..515779,515827..520683,
FT                   520739..521375,521439..521987,522036..522124,
FT                   522179..523276,523324..523458))
FT                   /codon_start=1
FT                   /locus_tag="CNH02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45085"
FT                   /db_xref="GOA:Q5KCT5"
FT                   /db_xref="InterPro:IPR011430"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT5"
FT                   /protein_id="AAW45085.2"
FT                   /translation="MEEPPQKRFKYTSYTDQIKNIALDTGNKRGLAWETEQYNEDTEQT
FT                   NTPLTAQLDRLSLLDLTVPYQDLQRALLPLTNTLPITLHNLPEIQKIFHEFYAKLDDGQ
FT                   EHIHSGLDSTLYLHQALYETCLSEALAYVPETAKDLLRVGALRALDPKLVERTYSTLSL
FT                   ILRTMAFSLLKPNEANRSTLKETWITINPFLSPKSNKRYVRRCVADAWVGVIRKARSEG
FT                   LARLMELLMEDNVDGMEAVWAHSLKGSSGQLHSRALTIYTILLDNLVKNPSPQQTITLG
FT                   QVSTALVHHASASVVQPVIELVINKLESDTITLPSSTAVLNVLSTFLFTRKGKRFPETT
FT                   LKPLMQKFLSLVPKLATDAAVNEDMDKGEAEIKEQWRKTLVICIVGSLQAGQLAQWLSP
FT                   GVTLIDSLWQKLNDRECFSFVNALIALKWTGIEQFILSHVAKASLPSLNSDPLSTLILL
FT                   NNLAASGYLSGGLSNVQGGRWRQALISAIVGLLKPLTKSNLDLNERRITGQVLKLLPAL
FT                   PSDADKFAPQVVKILESALDRLDSKGLEVIKTEWEEGGAWNDTHLVGSLLRTADQLIAS
FT                   PKADVSKDAKDLLVGKGWLSKILEKWYWNKEVMESVVPHVERWATNLGLSHDVILEQFM
FT                   PNLISSDSTLRLSSLQILAAVAPGTALAPDSEENTTSLREIYNLCVQIESSEMTLRNVR
FT                   ERTTNISRLTRSISALPVPLPTLVLKGIVTYLVAQFKVNFRPVYPETIAALSTLTEKHK
FT                   EEVWEIVWTELERTNNSKEAVTPDLDAKYPDWAEERGSNEDRVEKDEEEAEFRCPNLEK
FT                   SKVVFSRVWGQRSQEEKLDQQEISVQVSHDKLDVLNYESQLLATLAAIPSVAEKHSRLI
FT                   IPVVFSVARQGTSDQGDEVQSATHLSTKQLQARTANYLELLTKFANPKAAFRSEELHNL
FT                   YLDILSKGEPRLQGLALKCLMTYKSPKLTPYEEPLENLLVDSKFRDELARLRLGVDSQD
FT                   YALAARDSEATGTTRVVVIEPTHRDEALPVIIRLLYGVITSRRGRSSNSQGQGARKQAV
FT                   LSALNGCSESELGVLVDLMLEPFGSTVEDVGKVPGRQQMGFLSLLTDVIRYLGPQLGSH
FT                   WSRLVSTTISLVANAQERLTASDIVTEDANEGEEGEGIEAEKGMAPLRNIRSIGLKRLV
FT                   QFLRSPVTFDVNPYLPTIFKSIVSPRLDKLEVENTQAPSGTLDLIATLAGEPDLAKQLT
FT                   ALDDRTLPKTFACMTAVKVKPAVVLRVFDILESLLPEEDDQEITKEVLLPHIRVLIDNI
FT                   IGLVGSLKSSQNDDITRRLLGILSRLSTIVEDGTQAQQLATLLAPMLRHKQTPEKAKTN
FT                   ILATLQRLYAISPDFADPSSKFFYQSYDLISSLFQTLFFSTSRRALVSTLETFIAVDKS
FT                   LEKSIKLVADLNAYSTRRLEEPDFDRRLSAYEEINDAEIESLPSDIRAWLPILRTALFF
FT                   LHEPEELSIRTNASAVLQKFITLIGDSSEGPYVEALQNIILPGLKRALKSKQELVRNEA
FT                   LLAIAHGVKTCEGVPELTEMRPLLAHGDDEASFFTNIAHIQVHRRTRALRRLRDIIAEP
FT                   TTVIRESSLTSIFLPLLEHVIAGATDVTDHHLINEAIQTVGGLARELRWGKWYGLIGRY
FT                   MKLGIGSGKTGQQKYYVRSVAAVIDGFHFELSEGMDVDKGDEERDEEKGDEEEEDEEVE
FT                   KKEVEGASPEKITAILLNKLLPSLSRFVSGKDETDSAIRVPLALGIVKIAHALPRGSSD
FT                   IEVLRVITNVAQILRSKDQDTRDITRETICKIAIYLGPEWLVRIIKELEIALPRGPQKH
FT                   VLAVTTHAILVQATTQAADRFINLDDAVELAVQVTAEVIWGESGKDVATEGFKTKMREV
FT                   RGATSRGFDTLQLLSQLVSPSKIGVVLAPLREVMHASQAVKPMQQVDEALRRVSLGLNA
FT                   NSLLRPQELLSLCYSLISGNSSYLKAKRKMVRPTETPDAFKVVMKRDIKKEDDFYPANA
FT                   HKFVMFGLDLFVTAFRRGKFDFDDVDILARLGPMVNAVGNTLYSPATNVLLLSLKATAA
FT                   IARCPVPQVEPALHVFINNIFKIIKHAGGTAESEVAQTALKTLAVILRDCKSSEVSENQ
FT                   LRYLIEVISPDLEEPERQSAIFTILRSIITRKFVVPEIYDLMERVSSIMVTSQSTQVQE
FT                   LCRGSVMAFLLDYPQGKGRLKSQMTFFAQNLQYTYEAGRLSVMEVLFAVFEKFSEGLIE
FT                   EYAGMFFVALVVVRANDDSEKCRVAAGELLKLLWKRLDEADRAKMAEVIRSWVAKRNEN
FT                   ETLAGAAMGVLGLLVETGENGLEEVISVIEPVLSESAAKLQEAEEEDEIVDLDYTLPHQ
FT                   TLSTTAKLVLATPSSSSALPWSDIVPHLLFPHDYVRYDTAKLVSNLFANGSEASAVCEM
FT                   LGDELCLDIVRKGCLVLKGNRGDSGEWIVGSGKLADEIVKVLWNISKHWASLRVESADA
FT                   GEEEAGDDHDVEEPTRNPLTWLMSRMSFLARHLIVNRPAPNSYQAQEPWSAPIMSILRF
FT                   FAGITESLNKAQAVGFLLHILSPVYRILDEGGDLGQVEEKQVDDLRALATQIRDFVQEK
FT                   TGTTAFSRKWEKLRQATQAKRLERREGRVKLAVTNPEKYAERKGKKVERAKEGKKRKNI
FT                   AFAEGRKTAGAKKRRQ"
FT   gene            523693..525051
FT                   /locus_tag="CNH02170"
FT   mRNA            join(523693..523933,523988..525051)
FT                   /locus_tag="CNH02170"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(523723..523933,523988..524628)
FT                   /codon_start=1
FT                   /locus_tag="CNH02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45084"
FT                   /db_xref="GOA:Q5KCT4"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT4"
FT                   /protein_id="AAW45084.2"
FT                   /translation="MQDKPLSAQRITEERAFIKRYTESLADYTVQYPADFSAPLHERPR
FT                   KVPAIAIPVADPPSADAMDVDSPSKDTVISLTVKSLKPSLTIPVTAQLTDTVSDLKTII
FT                   SKSSASAPAPDAQRLLLKGKALTDTKLLKEYALESGATVHLIIKAPSATPSSAPTPSIS
FT                   TSDATIPPPSSVAPHPPALTITTSVDESSEAGTSMPLTLADQVAPPLGPQPEVSSATFH
FT                   HTISDPTFWQKIHALCVSEFDNEQEANSAWETFLVSMKGGLSAGEAAKIRDVVGVWGMG
FT                   GQ"
FT   gene            complement(524603..525599)
FT                   /locus_tag="CNH02165"
FT   mRNA            complement(join(524603..525038,525110..525198,
FT                   525261..525599))
FT                   /locus_tag="CNH02165"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(524730..525038,525110..525198,
FT                   525261..525495))
FT                   /codon_start=1
FT                   /locus_tag="CNH02165"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5U9"
FT                   /protein_id="ALO69522.1"
FT                   /translation="MGAQSSKSIRKLPKSSLPKATPETRFPPPPHQAPPPPVEEIEDEP
FT                   SGPIDYGRITEDVKRQEKGQKQGAVEFSGEKDDAIRKDAMDPQFMQNLLKLGPVEIHDA
FT                   GKFRPAAAQRTLQSRKDEFTSSSQIAPPGHLTFPFLASLLDGLKTLPPGSDPAPLYKQY
FT                   GVDKEKIEELRKWVNSVSVEEEDIVRVEEGNEIREMKAVWIGGVKKP"
FT   gene            525706..527182
FT                   /locus_tag="CNH02160"
FT   mRNA            join(525706..525933,526013..526117,526179..526245,
FT                   526327..526433,526490..526550,526607..526643,
FT                   526699..526741,526790..526858,526917..526972,
FT                   527023..527182)
FT                   /locus_tag="CNH02160"
FT                   /product="expressed protein"
FT   CDS_pept        join(525811..525933,526013..526117,526179..526245,
FT                   526327..526433,526490..526550,526607..526643,
FT                   526699..526741,526790..526858,526917..526972,
FT                   527023..527098)
FT                   /codon_start=1
FT                   /locus_tag="CNH02160"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45083"
FT                   /db_xref="GOA:Q5KCT3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT3"
FT                   /protein_id="AAW45083.2"
FT                   /translation="MATYNPVGPNALSLPIFKKLANRRVVLASASPRRKEIFANAGFFP
FT                   EIVPSTFAEDLPHSRFEGHLADYPIATGAEKAMEVYERLVKQDAENPPDLVISADTVVV
FT                   FPPEKDTAEGGPAHGEVSEILEKPINKDEQARSLAHMSGRKCEVITGISIVYPTVEYPG
FT                   FKVHSISCSTLVKFYDNTPQTIQAYVDSKEGIDRAGGFAIQGLGGILIEGIEGNYDNCV
FT                   GFPSAPFWRWMSELDADGVFDEAWE"
FT   gene            complement(527092..528702)
FT                   /locus_tag="CNH02150"
FT   mRNA            complement(join(527092..527454,527509..527857,
FT                   527912..528010,528064..528298,528375..528702))
FT                   /locus_tag="CNH02150"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(527155..527454,527509..527857,
FT                   527912..528010,528064..528298,528375..528549))
FT                   /codon_start=1
FT                   /locus_tag="CNH02150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45082"
FT                   /db_xref="GOA:Q5KCT2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT2"
FT                   /protein_id="AAW45082.1"
FT                   /translation="MPARQTIVIVSVVSLLLLYLFVHHTTSSHKPSVPNVPSRGAGEAA
FT                   YRQRLVAVGDLHGDIDNAKKTLQMARIIDDDSKWVASTDILVQTGDIVDRGAYADDIYR
FT                   LMQSLRGQAASQGGKVVSILGNHEVMNAIGDWRYVTKGDIARFGGTKSRQHALSAEGWL
FT                   GQEWLANYSTTALVPISPYPSSPTFSFTHGSLRPSYANLTPYPAAINDLGHSLLTKALT
FT                   PPMAPPYPPNPYSGLPKGTTHEEADLYAEGGPLWWRGLAEREEAQVCEWAKNLKQKIGA
FT                   RRIIGGHTPNFEKIVARCNASVIIIDTGISSAYGGVLSALEIVYTLTPVDRRGRDHSQD
FT                   PLLLSTSSESIAGLKGRFVEREEVHAIYEHSRKWLALEEREVVLD"
FT   gene            528792..529954
FT                   /locus_tag="CNH02140"
FT   mRNA            join(528792..529262,529323..529647,529707..529954)
FT                   /locus_tag="CNH02140"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(528889..529262,529323..529647,529707..529874)
FT                   /codon_start=1
FT                   /locus_tag="CNH02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45081"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT1"
FT                   /protein_id="AAW45081.2"
FT                   /translation="MSTLATAILSSDESDAEFIPEAPKVKRSRKPRAKRVGSGSATDSS
FT                   SCSSGSGSEDEDAEGDKRAAKKAKLEEDAKNEAEERRRKAREEFERMKAELSGTPAESV
FT                   KETEEMVEIKRPRRFAGETIYETVRLRASDPEAVAYLKSLAAKPDLDEDRPDLAAKQPL
FT                   SRQETPNPPPASLGLDKSTAAVNADVPASTSVAALSVTARPKGPPRRKRQTLEQMSAAL
FT                   DKGKKMTTLEKSQMDWKSHTSSSASMADELAANRRNGGYLEKKDFLDRVGERRAGAFSE
FT                   QGSTRRK"
FT   gene            complement(529924..532916)
FT                   /locus_tag="CNH02130"
FT   mRNA            complement(join(529924..532295,532366..532516,
FT                   532584..532916))
FT                   /locus_tag="CNH02130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(530139..532289)
FT                   /codon_start=1
FT                   /locus_tag="CNH02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45080"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCT0"
FT                   /protein_id="AAW45080.2"
FT                   /translation="MTAPHTPTPIQRYPPSLSQSPSGPSRPPRTYPIPSIDSSVASPPI
FT                   PSAPLNEYTSLQELLQRAGYKETRVYTPEAEKVRKHIKKTLDDNEEEVSALYGTYGFDR
FT                   TRGPGIHHAHQNVTEPIMPMKRSASILRSLALQAAARSKAAVKEEAPEHSWWTTWGKTQ
FT                   KISSPEGPTKVGLGLAKNGEGVRKVQSAWDIERGRWRRAETDSLPQEERPPLPQMRQTS
FT                   TPHEMTAATGYTTTKTTTCPMDRDIFSSPPPPQALSDDAFGYCPLPDDYEAQCDEDEAL
FT                   YDMGVNDYDVYSIGSYSASDSAHSMHSRTPSDDRAEREIRDFENEVDDGLLDEVNDVGK
FT                   RLLASAVEYDEDLECDSPPMRTWVLPQVDTSRPHEAPKIPLPSPPIEVAPREEKGDKIP
FT                   EPAKPLKYGDRATKLRLAHSTPNLKKPDAQNPSLPAGWLGSIRSALLGSTQSPSPTPAT
FT                   SSWNPSMPIKVTAPTPAQPRLVTAGPVICDSASGDAEDLPPIPPPKAKQSSGPISILRL
FT                   RPSIAKLRDVVLGQYAEADRDDPLVLSPRMDWKQQGEQFAGWSPIRKKGDGGEGESLYS
FT                   VRSGGVDFSKSFFYKPGTPPKVKASGSCETPKASNTVSRGLKKQRSIKSLQAALLLPVA
FT                   SSPIPPVPPIPSHLSTPKRIPVLAIQSPQAAQPRELVLDGDEFNPQSAPGSGKRGRANT
FT                   KKGNGVRRRKSKKKGVLKEDSP"
FT   gene            complement(533128..534821)
FT                   /locus_tag="CNH02120"
FT   mRNA            complement(join(533128..533498,533549..533935,
FT                   533982..534224,534277..534434,534496..534573,
FT                   534630..534821))
FT                   /locus_tag="CNH02120"
FT                   /product="peroxisome assembly protein per8 (peroxin-10),
FT                   putative"
FT   CDS_pept        complement(join(533433..533498,533549..533935,
FT                   533982..534224,534277..534434,534496..534573,
FT                   534630..534732))
FT                   /codon_start=1
FT                   /locus_tag="CNH02120"
FT                   /product="peroxisome assembly protein per8 (peroxin-10),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45079"
FT                   /db_xref="GOA:Q5KCS9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS9"
FT                   /protein_id="AAW45079.1"
FT                   /translation="MDAPVASSSSHHPQAPLPAPYADLSFEPASQAQILRSHQRDTAQI
FT                   HRLTELASEITRSLAGTRWLAQKQMIIDLLVKAIYLSLTLGRGSQTLGEEYTDILPYSP
FT                   GRKPPPSKTRRFFTIMFLLFPTILVSPASTSYIRTGGLSQPSSRWRIAREKLGDFLSSP
FT                   LGRAIPELHMIAFLFRGRFFELARRLTGMSYISALPPSPPEQRPASYEPLGLLLLIPFI
FT                   HRLLLPLLNSQAELPESANHETWIADTIHDGKPTERASIVGANTFYDSPNTYLTQEALE
FT                   LPERQCTLCLEPRGTGEGSGGTVAVTECGHVFCWGCLGGLEKLECPLCRQSLRMERLIA
FT                   AYNL"
FT   gene            534993..536914
FT                   /locus_tag="CNH02110"
FT   mRNA            join(534993..535196,535249..535311,535369..535526,
FT                   535580..535840,535889..536914)
FT                   /locus_tag="CNH02110"
FT                   /product="histone deacetylation-related protein, putative"
FT   CDS_pept        join(535101..535196,535249..535311,535369..535526,
FT                   535580..535840,535889..536738)
FT                   /codon_start=1
FT                   /locus_tag="CNH02110"
FT                   /product="histone deacetylation-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45078"
FT                   /db_xref="GOA:Q5KCS8"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS8"
FT                   /protein_id="AAW45078.1"
FT                   /translation="MTLTDYPTFSSSPFFYDPRNPVLPEAEQGHIRAHSNPSVAYYHPK
FT                   NVGNYHYGERHPMRPHRLELTNQLVLSYGLHEKMSYHAPRAATEEELLEFHEADYVDFL
FT                   KRVTPKNAQALTKDWTKFNVGDDCPIFYDLFSFCKQYAGGSLAAARKLSSGSADIAINW
FT                   SGGLHHAKKGEASGFCYINDIVLGILELLRYHPRVLYIDIDIHHGDGVQEAFYLSNRVL
FT                   TVSFHKYAADFFPNTGNLSEIGSDLGKYFCLNVPLQDGIDDESYISLFKAVMEPTITIF
FT                   KPSAIVLQCGADSLGCDRLGTFNLSIAAHGECVRFIKSFGLPLLALGGGGYRQSSVSRC
FT                   WTYETGVLAGVQLSNELPQNNYYEFFAPDYKLHPPLTGKIQNLNTAKSLERIRISIREK
FT                   LRYLGGAPSVQMQEIPPDLQGLLEEDEKSAAEKMDEKEEERREGKGKEIDWLDREVGGS
FT                   GDGVGSGRYFGGARRRF"
FT   gene            complement(536928..539453)
FT                   /locus_tag="CNH02100"
FT   mRNA            complement(join(536928..537416,537474..537600,
FT                   537647..538007,538065..539453))
FT                   /locus_tag="CNH02100"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(537090..537416,537474..537600,
FT                   537647..538007,538065..539361))
FT                   /codon_start=1
FT                   /locus_tag="CNH02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45077"
FT                   /db_xref="GOA:Q5KCS7"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS7"
FT                   /protein_id="AAW45077.1"
FT                   /translation="MALSPLPSSTELVFYSQKRRRRRICSTATGCPSTPYATRVASDPY
FT                   KRVGMRLSSFCCILITLLSHLLLVTAAPPCVRFADYDSINQMFIDGGPGTKVLLCPNRL
FT                   YRLSGPIIFTAADQEIATYGYPTGSERAVLRVESRNTATAIQGDCRRCARVSIKNLVVD
FT                   GNRKKLGRMRDFELATGLVVLGGNEGQSIQNSWIKNPRGFTAIHIREGDKLQCTGARIE
FT                   KNEIGPVGEEYDRERDGDDPEMSPLGRPLADGISIACRDSFIRDNTFRDNTDAAIVVYC
FT                   SPGTLIHANHIFAQSLSAMAGILMVDSTPFDGDYTGTVVKSNIIDAVSRTIRVGIGIGA
FT                   TVWSDDTETILTGGSVVGNGLKGRYMGYGIAAAGLKQWTIKDNWDEAKHEGRKSARCFD
FT                   EPVNPDPIGLLYNQPTMQDCTVQSEFADHDFQYLVCIDGLYDKSNPPKHDLLPPPHDVS
FT                   PTNAQEEDNTVQQDGGGSEPIKQPREVGDIEAEPPVEKMFSTGSEMMDDVLEHSHQRMH
FT                   EAIDHLSRRIDILGAASAGKGSGDSKISDVLDPALSSHLEKLQRKIEHLEFSLRSQIET
FT                   AIQLRSAIQGWDQEMALVTDWEYDILLDVRHKLELSSYPHDQPLDPKLMRGQSYLDNEA
FT                   VLVDDHSHPSLEGENLRAMSNRARLNANEETETRASVLQIGLIGGSVIALAWVGLRWWR
FT                   KRKVHGKLL"
FT   gene            539831..541463
FT                   /locus_tag="CNH02090"
FT   mRNA            join(539831..539934,540011..540148,540198..540299,
FT                   540359..540460,540514..540590,540644..540729,
FT                   540787..540917,540977..541463)
FT                   /locus_tag="CNH02090"
FT                   /product="retinal short-chain dehydrogenase/reductase,
FT                   putative"
FT   CDS_pept        join(539913..539934,540011..540148,540198..540299,
FT                   540359..540460,540514..540590,540644..540729,
FT                   540787..540917,540977..541428)
FT                   /codon_start=1
FT                   /locus_tag="CNH02090"
FT                   /product="retinal short-chain dehydrogenase/reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45076"
FT                   /db_xref="GOA:Q5KCS6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS6"
FT                   /protein_id="AAW45076.2"
FT                   /translation="MALTLDIVVCCLRKTIFSPYLAISIPVVLHLHSISSRLVLIVSYF
FT                   WGVVICFIRLLCYADWRYANQAPWFHAPPKLQWEDQVVLITGGGSGIGALLAQTLANRN
FT                   VAVAILTKDLPKQPFSHSHIHVFACDVSDYNAVMGVSARVREAVGDPTIIINNAGIVSG
FT                   KLLLDLTEEDITSTFGSNTLAHFWVLKAFLPAMLRRGRGHIVTMSSILGIVGAAQMTDY
FT                   CASKAAVLSLHQTLRFELDSRYQTPGIRTTLVLPAYTLTSLFNRVKLPTNRLFDFLCPP
FT                   VQPRAVVEHIISALDDNESRIIRLPFYSNFARLCGDAVGLVPAGVRDFVQWLSGADYAM
FT                   KGYGPTPDAGERLLAERQSHTPLNRKRTE"
FT   gene            complement(541429..544921)
FT                   /locus_tag="CNH02080"
FT   mRNA            complement(join(541429..542527,542578..542737,
FT                   542789..544921))
FT                   /locus_tag="CNH02080"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(541477..542527,542578..542737,
FT                   542789..544805))
FT                   /codon_start=1
FT                   /locus_tag="CNH02080"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45075"
FT                   /db_xref="GOA:Q5KCS5"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS5"
FT                   /protein_id="AAW45075.2"
FT                   /translation="MTEEGLLETLPIPFTSASFIQALITLSDSEAISLCFKLLISGKVD
FT                   DASLAKDVIGQGLEKGLVYFADVLASPEEVTEEELEKVVGAREETLRAYLGLEEMRRRL
FT                   DTWEIISPKQVAATEAKVEALDALMIDKDERQPLPQDDTELGDPWGEYGDPKEEDSKGS
FT                   TLLDDPWSQDSSVPASGSTSQAVITPAAPSTTAFESADPLPITMSGFLSQPVLVSALTL
FT                   ASTSSLQALRLLCQHNHGELYPYRFDLLEAVPGWVSPSDLEAVELLPAVDSDDNERWIR
FT                   PVVASSIVTHQAFPQIINDVYLPPSISTIPPTILLQPRQHAVSPSDLTKWYTTHVLSLD
FT                   EVGILDIQLAWVQHGASLGVPSLDSLGEDLSLLSRLVYDANLTQDQHAKWTLGNWMLAK
FT                   ESDIIAAYLSNSTPESIVDDVRRLVMPYLYVLESRAERAGIASSSLVSDSLNSTILSLP
FT                   LRLALPLFEASKATLPLSERVIRNDLDVARLALACLYGSQERGGAVWSTMSSIFECLPV
FT                   WELTGEDAEDEELTSTTLDSISNFLRPTSASTPPPSKSDILLFFHPLPFASLSRALDIL
FT                   DVQLESGEILARWGVEKRLGELLGMAGDQKAQVELAERLARQSGASVGKSGDDRWRKLW
FT                   NDMERLSSGEGLLKGALGTLTLQTRGRIYFDGILRSGDFEIAKKMLKMLQGDGAIDDAA
FT                   VEEVVLKVSKDFYVSADSCNIYTGNMKLAYDSLSVAPSTPATVAERQYIEATSRLSSFS
FT                   TFTLSPSEIRRNVNPISLLSTVLSDSSSDAYRLPDLMLDLAEKLGCRSETDRGLVWGMV
FT                   GRAAIAKEDWAMASKAVENMVQMVKKSQSSQTAVKQEQQGNHVTEPGNALRSETWALAH
FT                   ALSSQSEFSDISAKLKFVSSAMELCPASELPSIIETFRQIEKGRIRLDEAARRRRMKGI
FT                   ASPELPSEPSIGVSSVAAVQERVLGSRTAAKAAKLALDIGGRLTAHRQLPSPALLSSAT
FT                   FSSPFAGQELSRPLSRNSAAGSEVGSDGGYKVGGSLSSGSAGARDLFEHLGRDEAERVR
FT                   KGARRALVRGVGWLLGADESEIAGVEQ"
FT   gene            546031..551464
FT                   /locus_tag="CNH02070"
FT   mRNA            join(546031..546242,546463..547201,547264..547348,
FT                   547394..549398,549453..549611,549666..550563,
FT                   550617..550849,550902..551039,551095..551464)
FT                   /locus_tag="CNH02070"
FT                   /product="protein kinase SNF, putative"
FT   CDS_pept        join(546506..547201,547264..547348,547394..549398,
FT                   549453..549611,549666..550563,550617..550849,
FT                   550902..551039,551095..551119)
FT                   /codon_start=1
FT                   /locus_tag="CNH02070"
FT                   /product="protein kinase SNF, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45074"
FT                   /db_xref="GOA:Q5KCS4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001772"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR028375"
FT                   /db_xref="InterPro:IPR034674"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS4"
FT                   /protein_id="AAW45074.1"
FT                   /translation="MHQQRAPAAHHHSYSYAPYPHASVSAENTVPSMAQPQVYYQQPPA
FT                   DFYPHVPGHNPHTGASHGTQAGPSQSAENNAFAMPDVRQSKSARPRPPPSSVTMPMIPT
FT                   SLPDPSMHSYAPVQAPVPQQQTRTANRRSHNPAATLNSPSAPRPEELTDEYVLHPSVYA
FT                   FKQEYPRRAMVGLGPYIVLQTLGEGEFGKVKLGVHADYGVEVAIKLIRRGDLQEEAHAS
FT                   KVEREINVLKTLKHPNIVRMFDVLDTHKYIGIVLEFAGGGELFEYILANEYLKDKEGQR
FT                   IFAQLISGVDYLHKKGVIHRDLKLENLLLDKNRNLIITDFGFANQFDLSKGDLMSTSCG
FT                   SPCYAAPELVVLDTPYHGSAVDIWSCGVILYAMLAGYLPYDDDPDNPDAGNVVELYRYI
FT                   MNTELHYPDHVSPLGKNLLQHMLILHPEHRIKIPVIVKHPWLKSYHDMFNKSVEECEAA
FT                   FQDAMYRKSRQARKELQERRRVQTQARESLQTKERAHVQRSQSSAPGTIINAAALDQIR
FT                   RRPHSAMPGSTPLPEIIAKHSESVDDVALTMRSATPPTALSQPTEIRSPTTESPRPRSE
FT                   SMAPRLSFTTSVSTPTAMTVETPSSVPVQSPTDALPPAAMTVMQPSVEAAPPMRDHKNR
FT                   NTIQVEHAGEGLHDRAKEAFDANHGRADGSMETTSTADTGMVASSLLDVKREESTDIEM
FT                   ESGSSDSEQPKPANDGISQQPGEKSMDIPPIVPITIPLAPPAESGTATAANDSSQVLEP
FT                   QEKLSPALVEHGSASIDEMASPSTPRVSTSVEQEPVNITPRAKMRAPPVATTPKASLVN
FT                   ERKRHGSMPPPMGPSFVSDSRPESSLTATGLPKLPKKDRYRKGMSLDKFGLAKLLGHAS
FT                   QAHTTVHGEGKMAPPSASSSALALQHQLQQHGGQSQAVSESDSVKKSRRRTLQFGFHSR
FT                   KDSKASSAAVATPGTPLMDKDTNGENRLSSITGGTASLRDKRRKTVQIGLSTQSEQKDT
FT                   TVNVPGLSSSGHLVKNPATEPPQGISIGPVVGTDASALSQSSPSAVALEAFAAQQGHYP
FT                   SYRGSSSRASKVMDWFRRKTFVKETLPEPKSPVIKSDSQSSFVRIGEVASPASKTQESA
FT                   QASTVSQENTDKAEEKIDSTADQENAAKTTPTKSPVLPQPIGATATTPSVMITPPRPTA
FT                   ATTPTIGSSTQQSPPTTIRTRSASTFTFDESKIRVHTGLVDQSALSTKPPQDVFVEVIQ
FT                   VLRGMGVEMKRESDFKLRCTRAKKKAAGTSIGLGSVVSTGSGMSPFSIMNNASASKTDS
FT                   RGLPRPTSPSAVANRSSAGIKGLLRRGSSRSSAHPARLTRTGDEVPNPPSQSTPNLELP
FT                   ESSMASKPEPLYGKELMDAGDEVKFTVELCKMKNLPGLFILKIKRTKGNLWSFKFIYQT
FT                   VIERTTTLTH"
FT   gene            complement(553516..555504)
FT                   /locus_tag="CNH02060"
FT   mRNA            complement(join(553516..554380,554438..554558,
FT                   554605..554742,554799..555113,555169..555504))
FT                   /locus_tag="CNH02060"
FT                   /product="mitochondrial outer membrane protein, putative"
FT   CDS_pept        complement(join(553692..554380,554438..554558,
FT                   554605..554742,554799..555113,555169..555333))
FT                   /codon_start=1
FT                   /locus_tag="CNH02060"
FT                   /product="mitochondrial outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45073"
FT                   /db_xref="GOA:P0CO80"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="InterPro:IPR027537"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO80"
FT                   /protein_id="AAW45073.1"
FT                   /translation="MSETFSPNLTFTEGFVLGQASFLIILLLFIRYVVFSPSEQIDHEG
FT                   WRKRRAERADLLSNHTPPPLSNLLSKTSYDMSIHPAESSDWVNVLLAQILQGYRNDLLS
FT                   EGGEEGARQRIEGWLNPKGENLSWLDPIDVTSLSLGTSYPLLSNARIRPADGQGRLRAE
FT                   IDVDYLDSLSMTLSTAVLVNFPKPRFAVLPVTLGVELVSIGGTMSVQLHEPIEDRQHIH
FT                   VNLLPDFHLNLKVTSLLGSRAKLQDIPKLEQLIVSRLRNLVQDRFVHPNHISLALPRIL
FT                   SPSVSSTPILEGLGEGAVDAMKDAVSDGMKRMVEDFMGENPVEGALNGQGEEQWLDDDF
FT                   PPTPLVQPPGTFPTLSVSSRQSHRQSLPPSRPQSTTQGQPQLFYRRPLIHPTQSYPHYN
FT                   TYTLDPQIPHSVSYRHPPRGSHVHNPPETPVPQRPSHGQGRMSTTSSLTPSQSQSQFRF
FT                   RGQFASGVTPGQVGTSR"
FT   gene            complement(555626..556584)
FT                   /locus_tag="CNH02050"
FT   mRNA            complement(join(555626..555814,555870..556052,
FT                   556105..556165,556551..556584))
FT                   /locus_tag="CNH02050"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(555771..555814,555870..556052,
FT                   556105..556165,556551..556553))
FT                   /codon_start=1
FT                   /locus_tag="CNH02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45072"
FT                   /db_xref="GOA:Q5KCS2"
FT                   /db_xref="InterPro:IPR002675"
FT                   /db_xref="InterPro:IPR038464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS2"
FT                   /protein_id="AAW45072.2"
FT                   /translation="MPQQVRDIKKFLEIARRKDATLARIKKTAIKPAHTTTASSKSKAA
FT                   KTPTHVTKFKVRCSKYLYTLVLDDAEKAEKLKQSLPPGLKVEEVGAKPAKK"
FT   gene            556812..558196
FT                   /locus_tag="CNH02040"
FT   mRNA            join(556812..556835,557144..557177,557228..557299,
FT                   557352..557452,557507..558196)
FT                   /locus_tag="CNH02040"
FT                   /product="ribosomal protein L4, putative"
FT   CDS_pept        join(556833..556835,557144..557177,557228..557299,
FT                   557352..557452,557507..558097)
FT                   /codon_start=1
FT                   /locus_tag="CNH02040"
FT                   /product="ribosomal protein L4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45071"
FT                   /db_xref="GOA:Q5KCS1"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS1"
FT                   /protein_id="AAW45071.1"
FT                   /translation="MAPKGKKPAAAPFGTKKAGKKVQNPLFEKRSKTFGIGGDLPPKRD
FT                   LTRFVKWPEYVRLQRQKVILNQRLKVPPAIAQFSNTLDKNTATQLFQLLNKYKPESTQE
FT                   KKARLLAEAEKREKEGDKATTADTKKPIFAKYGLNHVVALVEAKKAQLVVIADDVDPIE
FT                   LVVFLPALCRKMGVPYVIVKGKARLGLVTGKKTAATVAITEVRSEDQQALATLVSAAKA
FT                   NFLEKYEDHRRHWGGGVRGNKSINKLKKRAKALGQDAKKIDLSL"
FT   gene            558374..559329
FT                   /locus_tag="CNH02030"
FT   mRNA            join(558374..558667,558786..558822,558883..558977,
FT                   559058..559119,559170..559329)
FT                   /locus_tag="CNH02030"
FT                   /product="cytochrome b5, putative"
FT   CDS_pept        join(558455..558667,558786..558822,558883..558977,
FT                   559058..559119,559170..559239)
FT                   /codon_start=1
FT                   /locus_tag="CNH02030"
FT                   /product="cytochrome b5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45070"
FT                   /db_xref="GOA:Q5KCS0"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCS0"
FT                   /protein_id="AAW45070.1"
FT                   /translation="MAAPAPPVAADPARTADPSAYSGPDVGAESGSKQEEKLLYTFETL
FT                   AQHNTREELWMLLHDKVYDVTAFMDEHPGGDEVLLEEAGRDATEAFEDVGHSDEAREML
FT                   TKMYLGEFQGEKKGKAKKGSSSTGTSSSSSSGFPTWTIPLALFVAFLAWRLLLA"
FT   gene            complement(559313..560748)
FT                   /locus_tag="CNH02020"
FT   mRNA            complement(join(559313..560427,560483..560618,
FT                   560671..560748))
FT                   /locus_tag="CNH02020"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(559373..560427,560483..560618,
FT                   560671..560703))
FT                   /codon_start=1
FT                   /locus_tag="CNH02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45069"
FT                   /db_xref="GOA:Q5KCR9"
FT                   /db_xref="InterPro:IPR007900"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR9"
FT                   /protein_id="AAW45069.1"
FT                   /translation="MSATKDTFDLRAEEDAARRLNVGRVLPSAALSGTNSRAKHTELIG
FT                   KPFLRQKVEAASKSHGIKFDEEATLYLTGAIESSLRSLVNLTRAAQLHRTSSSHLHAPP
FT                   MAKSSSTSSDEKDGKPMWSLTLRDDPNAVIEALNRRNRDAEQEFRKMRMDRLARDAELQ
FT                   KARERQASQSQTVEAAASPFPATAAVSPAESSSSPSTPSKPLFGATKETPKGTPPASSS
FT                   SKKKSSTKKPSSRDVSAEVQHKMTNLTAMRSAGMGKKYGWMMGNAPAVSSPLAGKKRKA
FT                   EGAEGKEKDGEKGKASESPLGQDRPSKKARPIPVPTRRMVAVSSPPPPPPAPSAAANNP
FT                   NNTTTDKAEPLKVSDDKALTMVDLVFALEHGGLGQAGGLGMGSVSGDILQGIWAKGGPW
FT                   SESEGKKP"
FT   gene            560902..565494
FT                   /locus_tag="CNH02010"
FT   mRNA            join(560902..560997,561051..561161,561285..561413,
FT                   561549..561671,561727..561801,561857..561936,
FT                   561985..562082,562132..562232,562283..562746,
FT                   562797..563101,563159..563347,563404..563572,
FT                   563629..563813,563867..563939,563999..564158,
FT                   564211..564751,564805..565069,565128..565251,
FT                   565310..565494)
FT                   /locus_tag="CNH02010"
FT                   /product="transcription activator snf2l1, putative"
FT   CDS_pept        join(560995..560997,561051..561161,561285..561413,
FT                   561549..561671,561727..561801,561857..561936,
FT                   561985..562082,562132..562232,562283..562746,
FT                   562797..563101,563159..563347,563404..563572,
FT                   563629..563813,563867..563939,563999..564158,
FT                   564211..564751,564805..565069,565128..565251,
FT                   565310..565405)
FT                   /codon_start=1
FT                   /locus_tag="CNH02010"
FT                   /product="transcription activator snf2l1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH02010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45068"
FT                   /db_xref="GOA:Q5KCR8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR015194"
FT                   /db_xref="InterPro:IPR015195"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR020838"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036306"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR8"
FT                   /protein_id="AAW45068.1"
FT                   /translation="MNPLLAASSAANPNNTSVDDDKLSDYVPNSRDLSVSRAPSVIASE
FT                   DAGHLDTAPQTPEPEEDEEDEIPEDELNEEELMDGKKITPSAAKRAAQASAKKAQTAER
FT                   KAQHAEIGKKRSAIEQARFADSMKRFNYLLGQTELFQHFIDLKRQREPQFAQMLDEQIA
FT                   KQAGKGKKKAIDNRHRKSEKEEDEELLKDEEEDEPFVFEESPAYVKGGKMRDYQVQGLN
FT                   WMVSLHHNGINGILADEMGLGKTLQTVAFIGYLKFHLGIPGPHLIIVPKSTLDNWAREV
FT                   AKWVPGFDVVVLQGTKEERGELISRRILTQDFDVLITSYEMCLREKSTLKRFSWEYIII
FT                   DEAHRIKNVDSLLSQIIRTFVSRGRLLITGTPLQNNLQELWALLNFILPDVFSSSEDFD
FT                   AWFKTKDEADPDAVVKQLHKVLRPFLLRRVKADVEHSLLPKKEINLYVGMTEMQRKWYK
FT                   SLLEKDIDAVNGMTGKKEGKTRLLNIVMQLRKCCNHPYLFDGAEPGPPFTTDQHLVDNA
FT                   GKMVILDKLLKSMKAKGSRVLIFSQMSRMLDILEDYCQFRGHQYCRIDGSTAHEDRIAA
FT                   IDEYNAPESEKFVFLLTTRAGGLGINLVTADIVVLFDSDWNPQADLQAMDRAHRIGQTK
FT                   QVYVFRFITQDAVEERILERATQKLKLDQLVIQEGRAQQTAKVAQNKDDLLDMIQHGAE
FT                   KIINNKESMLIDDDIDEIIRRGEERTKEINSKYAGLDLDALNNFKSESLVNTWEGEDYG
FT                   NRQQKRPLLWIEPSKRERKTNYSVDQYYRDSLKTGGPKADKPKVARAPKQVVVNDFQFY
FT                   PPRLAELQNKETDWHRKSINYQVPVREPEEGETQEQVEAEQKEEQERIDNAVPLSEEEV
FT                   AEKETLVGEGFHDWQRRHFQSFIRALEKYGRDDLEKVVTDVADRTEDEVREYAAVFFER
FT                   YKELKDWERIMDRIRAGEEKIKEQQDRIDVLHRKIKATRFPLQELKIVYGQNKGKAYSD
FT                   EEDRFLLVRMHHHGIDRDDCYELIKRDIGEWPLFRFDWFFKSRTPDELRRRAQTLLLCI
FT                   MKEDDKVEDEKKPIKGKKRPIDELKSGPGSRDTTPSAAGSKGSKKKKV"
FT   gene            565711..569232
FT                   /locus_tag="CNH02000"
FT   mRNA            join(565711..566149,566210..566642,566690..566751,
FT                   566800..566895,566948..568033,568083..568259,
FT                   568315..568529,568587..568700,568753..569232)
FT                   /locus_tag="CNH02000"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(565793..566149,566210..566642,566690..566751,
FT                   566800..566895,566948..568033,568083..568259,
FT                   568315..568529,568587..568700,568753..569170)
FT                   /codon_start=1
FT                   /locus_tag="CNH02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45066"
FT                   /db_xref="GOA:Q5KCR6"
FT                   /db_xref="InterPro:IPR007259"
FT                   /db_xref="InterPro:IPR040457"
FT                   /db_xref="InterPro:IPR041470"
FT                   /db_xref="InterPro:IPR042241"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR6"
FT                   /protein_id="AAW45066.2"
FT                   /translation="MPSDSTSLSMFSLSQDLVRSLIPSITESSNSRLSDHLSSKVRSQI
FT                   KADKYGGTRKEWNEVSQSIMGLAEAGRIRVQEDLAEGLEKNLSNLNRHREQGKNVWEED
FT                   VPIKMDNLPQHVQFLLNLAEKPTYQTHAFAYDYIHRSTPIGPTPEQLIYQQIMEEDPFD
FT                   PGEVWDEEVRHGWTDSDTDDMSDLSTQSPSEDELATPSDLAMRMRLEDKEQEERAQREE
FT                   AEVKERAIEELAKKLKNGYWKGQPEVEIMRKDLHGWKELTTNTNAAAMAKNFFPASFSN
FT                   NSKAISASQLQRELIFALSGRPGILFTFDEKADCQIISDHPHVKTFSPGALEGILMTFR
FT                   SHASQASKLRLFVQKTLQPRVPADPAKQTQATNKTAQAFAEATREVLELYDTWLSNLEA
FT                   SFTLGSRHGQSSSSVTGVPASTTPLLLIHELEQAHAPILRYLSEFVPYAHSPTLILNLI
FT                   YSAIVNTRQTGSTPHITSSLFKLFYRSAEPMWHVLGVWLQQGMPVPLSLTDPEQMAFSS
FT                   LSLDDGERELDRDFFIKRDKDVSWADEDFWECGFVVGDEGWPLWMGDEIGAMVMEAGKA
FT                   QGLLRSLLGNVNTEIVKEWSFLFDVLMGPMDGFASPFPLGEMDIVEKVIGYLQPLCQLV
FT                   QFHLRRVLDEECGLMQHLEAIEGTMLLRGFEVIHEWTEGLFKKIVKGEPWSDFQLLTSS
FT                   IRTVAEVRQAFWMNPNALRIRTTRRQGVYLGPRALGAIRADYLIPFPLSQIFTETSIAI
FT                   RAEVFSFLLQLLMSRWILAETKRTDKEMMVYSLSTDQRRELRSLWCMRGKLLWFLDMVY
FT                   TWLTGRVIENQTASFRAKLEELTSLGSMITLELEHTRKLRDYSFLNPASSDLLEAIFGI
FT                   LDMTCTLSDSLTLFKAQSTPDKTPQFVTKRRRRVRRLQRDLSSDEEMGKMIEGPSQTTG
FT                   EYKKVSSGKANLKEMQRELQFCVGVIKNAVEKLSMERDGELWAELSIALEEWHEV"
FT   gene            complement(569191..571765)
FT                   /locus_tag="CNH01980"
FT   mRNA            complement(join(569191..569513,569569..570191,
FT                   570240..570364,570413..570513,570566..571037,
FT                   571396..571765))
FT                   /locus_tag="CNH01980"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(569191..569513,569569..570191,
FT                   570240..570364,570413..570513,570566..571241))
FT                   /locus_tag="CNH01980"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(569483..569513,569569..570191,
FT                   570240..570364,570413..570513,570566..571037,
FT                   571396..571405))
FT                   /codon_start=1
FT                   /locus_tag="CNH01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45065"
FT                   /db_xref="GOA:Q5KCR5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR5"
FT                   /protein_id="AAW45065.1"
FT                   /translation="MAETIASSSAPTTSATPTTSPQVSTDVESSAAVTASDTSIVPQSS
FT                   SVTTTSESTTSTTSTTESSTAPSSAESSTDPITSSTSTSASQQPSVEPSSTSSSQSVEP
FT                   SSIPISSSSSIEPSTSTEPITSTVTSTSSSSSEDPTSSTSSSSDATSASERHSTSVVVV
FT                   TVTDSNGSMRVTASSIATGAATDTENSGSGTNIGAIVGGVIGGVAGLAIILALLWFFCI
FT                   RRRRNNEQAFDEKTFDPSRAARHSVNDPMDLLSPSVPAVGGAAFSGNSTPRVDPFPFQN
FT                   ASSPEDQPYDPISHAPMRMPDARDYMGGAYDPYGGMEGGYGLAAGAGAGIGAGSAADHY
FT                   NYGESAHSSSDYPSSVSPTQTSAAMAKQREAAAERRTSRTSSGYNVPSGSGNGPQEVIG
FT                   SPAPSETGGRRESGISEGRTSVYQHTDMKSLPDEEEEQLDEIPPDYQSISRQTQ"
FT   CDS_pept        complement(join(569483..569513,569569..570191,
FT                   570240..570364,570413..570513,570566..571086))
FT                   /codon_start=1
FT                   /locus_tag="CNH01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45064"
FT                   /db_xref="GOA:Q5KCR4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR4"
FT                   /protein_id="AAW45064.1"
FT                   /translation="MADLSPSSSNSRATTSAIASSSAPTTSATPTTSPQVSTDVESSAA
FT                   VTASDTSIVPQSSSVTTTSESTTSTTSTTESSTAPSSAESSTDPITSSTSTSASQQPSV
FT                   EPSSTSSSQSVEPSSIPISSSSSIEPSTSTEPITSTVTSTSSSSSEDPTSSTSSSSDAT
FT                   SASERHSTSVVVVTVTDSNGSMRVTASSIATGAATDTENSGSGTNIGAIVGGVIGGVAG
FT                   LAIILALLWFFCIRRRRNNEQAFDEKTFDPSRAARHSVNDPMDLLSPSVPAVGGAAFSG
FT                   NSTPRVDPFPFQNASSPEDQPYDPISHAPMRMPDARDYMGGAYDPYGGMEGGYGLAAGA
FT                   GAGIGAGSAADHYNYGESAHSSSDYPSSVSPTQTSAAMAKQREAAAERRTSRTSSGYNV
FT                   PSGSGNGPQEVIGSPAPSETGGRRESGISEGRTSVYQHTDMKSLPDEEEEQLDEIPPDY
FT                   QSISRQTQ"
FT   gene            complement(571939..575824)
FT                   /locus_tag="CNH01970"
FT   mRNA            complement(join(571939..572968,573034..573156,
FT                   573214..573826,573884..573974,574034..574115,
FT                   574167..575559,575618..575692,575753..575824))
FT                   /locus_tag="CNH01970"
FT                   /product="cyclin dependent kinase C, putative"
FT   CDS_pept        complement(join(572149..572968,573034..573156,
FT                   573214..573826,573884..573974,574034..574115,
FT                   574167..575530))
FT                   /codon_start=1
FT                   /locus_tag="CNH01970"
FT                   /product="cyclin dependent kinase C, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45063"
FT                   /db_xref="GOA:Q5KCR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR3"
FT                   /protein_id="AAW45063.1"
FT                   /translation="MRFSSRDEEPEDGEVVEDDAVWKNPLATTKYLKGAPSVSSSQKTS
FT                   SYKKSRPSFIPSLDPADDDGHRPRRPPPPSLSSPPYQQSRHRSSSHNRKTISYEDEERG
FT                   SGMQHALPKNPQTRQYPHSTEMREPEQRREDKYAKEPRSPHRREGYYSSRRGDGRDYPP
FT                   QLDRERYGPARRLESGGDGGYGDRSRDRNMDRGGYRDKDDRRSYGRPSDSSAWGRPPRE
FT                   EYRDRRPEEFARHPTGERYREDSRERFPVDRDTGQRRSCSPVRIRSPERSSDRPLTPVP
FT                   DNGRTSSPDHGAKNIASSRGHRSSPSHSSNHEDHNGEKGNGPIKLNRNRHRPSLPLKHI
FT                   STQPPRSPSAPPPPPPPDPSTVPPSPTEPPPPMPGNLSLEQTVPHAPNPRAQMATRPPS
FT                   PKREEGEIRQETESVVFKFKLWTAEEELKALGKNFGGSSTLMRYNMGTKLGEGTFGVVT
FT                   KAVENDTKRAVALKKITQHNFRDGAHITTLREIKILKSLQHPNVVPLLNMVISRHDNHS
FT                   ENTFIKNEVFMVFPYMDHDLCGLLSNNDFKVNHSGAKCIMKQLLDGMAYIHSNNIIHRD
FT                   IKTANILVDKHGQIMIADFGLARPWTDNKKMPPHLATEYTNMVVTRWYRAPELLLGWCN
FT                   YGPAVDIWSIGCVLGEMYLRRPILPGGGDREQLSMIFAKCGPLNEETWSGWQDLPGFPE
FT                   AHGFAWDKTPRDTSILEESKSWHMDRGGADLLVKLLSLDPSKRPTASEALDHPWFWVSP
FT                   KPAETINLDFAASHEMSAWHKQPAAAPVQPPPQKAYQTQQAYQSQQTHHAQQIYQPQQP
FT                   YVAYQSGYGNQQRGHGGYQQQTANATRHNLAMNPYASSQVGNAQGYNQQPYMQAQGVSN
FT                   MPPGADAYGGINPYGAPVAYNTASLPPPNMAYNGQSSFNGGGGLTGGGGQQYSLPHQSY
FT                   LPPGPPPMMHGNVNRPSRPPPPTSSEGRPLAAAPFPLAGGGGGGGGMKTFAPPPPFSLA
FT                   GGGGGGRGGMPPTMKRPPSDSRRDFGGDHKRQRTEAPLPYD"
FT   gene            complement(575869..576783)
FT                   /locus_tag="CNH01960"
FT   mRNA            complement(join(575869..576218,576285..576409,
FT                   576465..576522,576572..576783))
FT                   /locus_tag="CNH01960"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(576114..576218,576285..576409,
FT                   576465..576522,576572..576733))
FT                   /codon_start=1
FT                   /locus_tag="CNH01960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45255"
FT                   /db_xref="GOA:Q5KCR2"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR2"
FT                   /protein_id="AAW45255.2"
FT                   /translation="MFRTLSLSAFSPRIFTRAMSTAPLPMPQLPRTDEGKRICQIVKVK
FT                   PERLDEYKKVHAEVWPEVLGALRKAHVVDYSIHYFAPHNLLIAHMRYIGSDFQKDMDGI
FT                   KENEATRKWWQLTDGMQESFVPGATGSESGPGWWVDAEEVFRLEG"
FT   gene            577003..578693
FT                   /locus_tag="CNH01950"
FT   mRNA            577003..578693
FT                   /locus_tag="CNH01950"
FT                   /product="hypothetical protein"
FT   CDS_pept        577117..578628
FT                   /codon_start=1
FT                   /locus_tag="CNH01950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR1"
FT                   /protein_id="AAW45062.1"
FT                   /translation="MPPLFTSTSLTTFIRQIRGVAKYIQQPATVMSRTAPKRTINTLGR
FT                   ARNAVHHLAHQTFPSLSTPAHQLHQSTTIRAGVRFATSSAGSSSSKTSQRHLGAVGRAL
FT                   QASKRPQWGRGRSIPSNVGLGSARGFASAPAAGGIPGNIPIVLRAFANLVDDDCSGKKS
FT                   LPRASRYSPYARKARRTRRKVCKSIDSSFISDLHHYFPRVAASQLDEVKVDLPPLPEQL
FT                   VTPGKTATLAIPLSPSLEALLHPTSSLTYPETSIGVHILARLTAGLLPIHSAFSLHSST
FT                   RVIPLLTKLDGLGVMEFHPGGPNVLAEVVRDPEGRPDILRLIFEQRSSENVKALLGGSL
FT                   RENEEGEWWALWDQEDRVMELTQGERRAMMERWDGGEEKNEHDQESLVYPTLDMSLVNS
FT                   VDPLVTPPPPSEVSSLNSTPSTQSTLSLSSLLSDMDDSLEGWSIPPSEADTDVDSVYSG
FT                   SEEWGDVSSRIVSIHSEQGEESSDGVVSVWWAGAGEGFGFVAQPW"
FT   gene            complement(578668..579856)
FT                   /locus_tag="CNH01940"
FT   mRNA            complement(join(578668..578828,578887..578975,
FT                   579034..579309,579362..579425,579476..579560,
FT                   579625..579692,579760..579856))
FT                   /locus_tag="CNH01940"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(578729..578828,578887..578975,
FT                   579034..579309,579362..579425,579476..579560,
FT                   579625..579692,579760..579788))
FT                   /codon_start=1
FT                   /locus_tag="CNH01940"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45254"
FT                   /db_xref="GOA:Q5KCR0"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR019008"
FT                   /db_xref="InterPro:IPR039163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCR0"
FT                   /protein_id="AAW45254.1"
FT                   /translation="MRIPGILPFLPLLPFIYAATISGNIAFNGLLTLDSLPPTSQISLD
FT                   HGLTKVWVKQDGSFTFHNVPEGTHQLEPLIPGYIFHPLLVTVKPTVSSESDPAKASSED
FT                   QMHVQILNPARQPLPISSVSLPYPLVLEPVAKENYFIPKNGMNMLGLLKSPMVLMMLFS
FT                   GIMMWGMPKLLSNMDDPEFSKEMAETRQKMQGLQNGDWTGALSNMLAGTAEDKSAPVQS
FT                   GGGSAKAGGKKRRK"
FT   gene            579941..580954
FT                   /locus_tag="CNH01930"
FT   mRNA            join(579941..580107,580172..580231,580294..580439,
FT                   580499..580954)
FT                   /locus_tag="CNH01930"
FT                   /product="nucleoside-triphosphatase, putative"
FT   CDS_pept        join(580062..580107,580172..580231,580294..580439,
FT                   580499..580813)
FT                   /codon_start=1
FT                   /locus_tag="CNH01930"
FT                   /product="nucleoside-triphosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01930"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45061"
FT                   /db_xref="GOA:Q5KCQ9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ9"
FT                   /protein_id="AAW45061.2"
FT                   /translation="MSQKQLFAAFDVTRQVFYRSSLSVGIVNLKPLLPGHVLIVPKRVV
FT                   PRLADLEANEVSDLFLSVQHIGKVLEDVYKARAMTVSLQDGVAAGQSVPHVHIHLIPRH
FT                   PTDYDGKNDRIYPLLEQSEKQLHGDLKNSDVPVANGRDDDGQTEAQVGKWEVPKDEDRK
FT                   PRSMEEMEREANWLASFFKSSTNSL"
FT   gene            complement(580878..581761)
FT                   /locus_tag="CNH01920"
FT   mRNA            complement(join(580878..581287,581352..581614,
FT                   581666..581761))
FT                   /locus_tag="CNH01920"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(580967..581287,581352..581549))
FT                   /codon_start=1
FT                   /locus_tag="CNH01920"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45060"
FT                   /db_xref="GOA:Q5KCQ8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ8"
FT                   /protein_id="AAW45060.1"
FT                   /translation="MPGLFSLPPPSVTLALGGLTTSYVFFSSVTDMNWGIVPLLNGRFG
FT                   AVDIDEKKRIKMWSIYFKRAATGLVGGSVLSALLNFTTAYIHPSPLTRRITFISAVTSL
FT                   LILPITFASGILPINSRLFEIAKGAETTKDDEVKSLVEAWGKKHLLRMPAYTGAWVLSF
FT                   FALVYDGRI"
FT   gene            582129..583521
FT                   /locus_tag="CNH01910"
FT   mRNA            join(582129..582250,582317..582336,582434..582504,
FT                   582572..582644,582713..582780,582840..582898,
FT                   582958..583178,583232..583278,583328..583521)
FT                   /locus_tag="CNH01910"
FT                   /product="kinase regulator, putative"
FT   CDS_pept        join(582231..582250,582317..582336,582434..582504,
FT                   582572..582644,582713..582780,582840..582898,
FT                   582958..583178,583232..583278,583328..583405)
FT                   /codon_start=1
FT                   /locus_tag="CNH01910"
FT                   /product="kinase regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45059"
FT                   /db_xref="GOA:Q5KCQ7"
FT                   /db_xref="InterPro:IPR005301"
FT                   /db_xref="InterPro:IPR036703"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ7"
FT                   /protein_id="AAW45059.2"
FT                   /translation="MSTLFNIKSGQSRTFKPKKVPEGTKQWQLKQYAQQTLGSGNLRTA
FT                   VKLPEGEDLQEWIAVHVVDFFNHVNMLYGTVSEFCTPTECPVMNAGPKYEYFWEDGTNY
FT                   KKPTQLSAPAYVEALMSWTQSILDDEKHFPQTIGKRFPPTFMTTAKTILRRLFRVYAHI
FT                   YHAHFDQICALGIEAHLNTNYRHFLLFVDEFALLSEKDLVPLEDFNKTILNETGK"
FT   gene            584027..587480
FT                   /locus_tag="CNH01900"
FT   mRNA            join(584027..584095,584157..584332,584389..584683,
FT                   584738..585231,585288..585405,585457..585566,
FT                   585617..585808,585858..586148,586210..586425,
FT                   586479..587034,587090..587197,587252..587480)
FT                   /locus_tag="CNH01900"
FT                   /product="urease"
FT   CDS_pept        join(584309..584332,584389..584683,584738..585231,
FT                   585288..585405,585457..585566,585617..585808,
FT                   585858..586148,586210..586425,586479..587034,
FT                   587090..587197,587252..587349)
FT                   /codon_start=1
FT                   /locus_tag="CNH01900"
FT                   /product="urease"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45058"
FT                   /db_xref="GOA:P0CS22"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR008221"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS22"
FT                   /protein_id="AAW45058.1"
FT                   /translation="MHLLPRETDKLIVTTLGTLAQRRLARGLILNRAETIALISSQLQE
FT                   FIRDGRHSVAELMDLGKKMLGRRHVRKGVPESIHTIQVEGTFPDGVFLVTVDDPISSDD
FT                   GDLNNAFYGSFLPIPSADVFPAAPEPADTLLGALICRKEPIKINASRRRFKLEVKNAGD
FT                   RPIQVGSHYHFLETNPALIFDRLLSYGYHLDIPAGTAVRFEPGEKKTVTMVEFGGKKIF
FT                   HGGSGLASGSFDENLRETKVKEMVEKGGFGHKDQEKVEEGPTTEMNREVYASMFGPTTG
FT                   DKIKLADMDLWIEVEKDYTVYGEECKFGGGKVLRDGGGQASGRHEHEVLDLVITNALIV
FT                   DWNGIYKADIGVKNGIIVGIGKAGNPDMMDGVTDGMIVGSSTEVIAGEKLIITAGALDV
FT                   HVHYICPQLMTEALASGITTVVGGGTGPADGSNATTCTSSSFYMQNMIKATDTVPLNFG
FT                   FTGKGNDSGTNALRDVIEAGACGLKVHEDWGATPEVIDRALSIADEYDVQVNLHSDTLN
FT                   ESGYVESTLAAIKGRTIHSYHTEGAGGGHAPDIIVVCEYENVLPSSTNPTRPYAVNTLD
FT                   EHLDMLMVCHHLDKSIPEDIAFADSRIRSETVAAEDVLQDTGAISMISSDCQAMGRIGE
FT                   VITRTWRTAAKMKQFRGPLEGDEPTRDNNRVKRYVAKYTINPAITHGMSHLIGQVAVGC
FT                   LADLVFWTAESFGARPEMILKGGVIAWAAMGDANASIPTVQPVIGRPMWGSQPEAAALN
FT                   SIVWVSQASLDKDLVKRFNIKKRAEAVKNCRAIGKKDMKWNDSMPKMTVDPETYDVHAD
FT                   GVLCDVPPADKLPLTKRYFVY"
FT   gene            complement(587651..592931)
FT                   /locus_tag="CNH01890"
FT   mRNA            complement(join(587651..587967,588034..588130,
FT                   588194..588278,588332..588556,588615..588686,
FT                   588742..588917,588972..589089,589142..589264,
FT                   589316..589349,589430..589503,589561..589568,
FT                   589641..589651,589701..589751,589805..590006,
FT                   590063..590282,590339..590669,590723..591708,
FT                   591763..591840,591896..592021,592077..592183,
FT                   592244..592307,592372..592931))
FT                   /locus_tag="CNH01890"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(587907..587967,588034..588130,
FT                   588194..588278,588332..588556,588615..588686,
FT                   588742..588917,588972..589089,589142..589264,
FT                   589316..589349,589430..589503,589561..589568,
FT                   589641..589651,589701..589751,589805..590006,
FT                   590063..590282,590339..590669,590723..591708,
FT                   591763..591840,591896..592021,592077..592183,
FT                   592244..592307,592372..592863))
FT                   /codon_start=1
FT                   /locus_tag="CNH01890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45057"
FT                   /db_xref="GOA:Q5KCQ5"
FT                   /db_xref="InterPro:IPR018820"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ5"
FT                   /protein_id="AAW45057.2"
FT                   /translation="MSFQETNTPPPPAITISSSNAPHSEQPMPSTPPSPLRSTSSSSGE
FT                   KRESNDITTPRKRRGSHSHVRINDDPEITISNADGEPSGSGHRKQASFALTADDEADRH
FT                   NAEKKETADDDQVNEKTRYEKVKILAELRVKKILGHRWFSWIGPKLTWGKLKPVIRCAI
FT                   SAWLGLVLLMIVPVERSIGNGAFFLLIVSFMLPPSDPVVQTLEKYVNLFFFTSLSWVWV
FT                   IITVLIAGATRGPPNPDKVAAAEARWAYLKDVDPTKYQQRIIFDGTYLQAKPAVVCCVF
FT                   LSAGTGALLWWKLRTQPSPATFPLVLSCILIDVSLTVVVFYPYNSYTSGLIFFLPMSVQ
FT                   AGIGTLCSFLIFPESVGHSFQSKFPGILTPLASAMKSIETLFGEAEKHDNGQEENTDDL
FT                   LSVRNSDYGPKFYADKLDDWADRSKKIRTQLLQSLAGIPPLRAQQRYLAVDISYSRLSG
FT                   EDLRNLFDRLAIVQARSGGMAFFFDVIINNAKHSHLDSSAWSVHHVSQSRSGSRAASIR
FT                   HEFLDERRGSVDDSLHGDGTVTPPPEVDDHAESPHHDRGLYFGSRKFNFSGILRRNGSP
FT                   HGFAATQKGSHLSLLDHLRKSQQPVGVYESTRYMDIERNFAVDTEHVLEQLDILARGSV
FT                   PLIRACEAALSEATDWILNVNRDRSIFTWPNRHRESQKEKRRDEKVIATTKLEEVTGHL
FT                   QSALDDFHIARLEIVKPYKHLFDPTHPEEGRRGKMHFRSLFQNFVAQYHVLEFSEALLN
FT                   LLRLMEELDKSRQKRRLWYPHLTSMIDHFRHSHKDKHLTDGDDGHENDAAFEQEEEEDF
FT                   LGEVKKRNPEYKPFDNSFLNLIAKCSKVMDILSSRSFMYALKAAVLGALTTLPNFIASS
FT                   ASFYYLNRGVWCTIMAQLIYSGDTASAWLGRVVASFWGCLVGMVLWYIGSGSGQGNPYG
FT                   IAAACAVAFPLASFFRIYFPGPVLTAVMAPVTMGLVIGYSYYNGTIGPLTYAQWGWDVA
FT                   WRRYVCVLIGISAAWAFSYVPPVYSAKRAIRYSYARTIGTAGSILCDVLSHANDHHYHL
FT                   KENDTIRHNLITWRSKLNKLGARHINATREFSLRGRWPEERYKALFDTLQDLLSLLSQL
FT                   NHVLTQLERPWRKALLDRTRLSDPAFLGDVMVVLSMCSTALRAGTPLPQITPSPLVARF
FT                   GMGKTKGLDLPHDSSDQSGELPTLVTVDVLESDNYMRYALGITTTFSLISRLDRIVVIC
FT                   KTLLGENYHIAGLHLEQTTRA"
FT   gene            complement(593036..596760)
FT                   /locus_tag="CNH01880"
FT   mRNA            complement(join(593036..593491,593549..593852,
FT                   593908..594006,594054..594199,594252..594766,
FT                   594815..595464,595517..595852,595908..596117,
FT                   596171..596188,596237..596317,596379..596399,
FT                   596458..596760))
FT                   /locus_tag="CNH01880"
FT                   /product="endocytosis-related protein, putative"
FT   CDS_pept        complement(join(593310..593491,593549..593852,
FT                   593908..594006,594054..594199,594252..594766,
FT                   594815..595464,595517..595852,595908..596117,
FT                   596171..596188,596237..596317,596379..596399,
FT                   596458..596574))
FT                   /codon_start=1
FT                   /locus_tag="CNH01880"
FT                   /product="endocytosis-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01880"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45056"
FT                   /db_xref="GOA:Q5KCQ4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR012942"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ4"
FT                   /protein_id="AAW45056.2"
FT                   /translation="MGNDQSRTSSGDGKQVDEKPPDYYELLQVDEEAGYDEIKRSYRKL
FT                   ALINHPDKNPHRIEEATKLFADLQHAYEVLSDPQERAFYDSHRNAPVAATDDDIFEHVR
FT                   TGDKATNDPKSKLNRRRQGDPGVTIAQLMRFFDPKIASKMDDTSEGFYSIYRTLFALLA
FT                   SDEALHTTSTTPLSYPSFGNSSTAYAPPPGLTRAQKDSQVWARDFYAVWGEFVTEKKFE
FT                   WLNKWDAERGDDRMVRRAMEKENKKAREETRKEYNETVRQLVVFIQHRDPRYKAHQTKL
FT                   AQERAASKSAKTSGASTPAGKPVVDAEAAKRRHEERLRAAAQYEEQDWQKFSSRNSDDE
FT                   EMEEEEPEEELGDGTGVRLDDGQGGEIFECVACGKTFASEASWINHERSKKHKQAVWRL
FT                   KKEMRAEAKAMGLTEPQSEEEPGDERAEDADAGEGEIGGETKGVGMTEEEQLAELQALE
FT                   AEMVDLALEESEDVDYGNKKSKKKGKKNRRDGVIDEVDTATGLSPSRNESQPDASNTPS
FT                   AAVSDDGVARESDKTSELSKRDKRRAREARKKIEEEERKAAFKEARKAAKKAGASVETF
FT                   ASPQQSDRKDKVDDDGFVAPKQKGKNSIKSGKGTKGGREQGENDYSDERVAKVVAGIQE
FT                   KREKMVEKWGDTWADLVSKLKHLLSGDSHLPLSILCLGLGKPFSDRTAQIQLALALELA
FT                   DALNCTVHDLEMYDPVWDEGDKKVLSSIGVTLLQDNLLGRHTLETGRPYLLYLPHAPKQ
FT                   LYESILSTNYAPSLCGNKPGRILLGNDLAEYLPGFVRPSQKKEPSGEADGDGEFVKPKK
FT                   KRRGRGEVKPQIKDGVLSRVVPHMSVLPLSDALPETNLPGFARAFLSFTFQWLEENKIE
FT                   KIDWETKLPEEEWGDDGEIIQ"
FT   gene            596901..598445
FT                   /locus_tag="CNH01875"
FT   mRNA            join(596901..597096,597186..597307,597364..597554,
FT                   597615..597819,597878..597950,598012..598445)
FT                   /locus_tag="CNH01875"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(596932..597096,597186..597307,597364..597554,
FT                   597615..597819,597878..597950,598012..598350)
FT                   /codon_start=1
FT                   /locus_tag="CNH01875"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5X0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X0"
FT                   /protein_id="ALO69523.1"
FT                   /translation="MDKSHPLLANFDDPPPFPETYPQLRRLDRSVVCQICKEPFTAPVS
FT                   IGCGHSFCSHCIRSSLDVQKKCPSCNEPASEGSIRRNRALEEIAEAWEQSRPTLIDLSK
FT                   PLSRKRAAPEVDSRPSSSGIVKRLKDQDGKPSQSPAPAESIESEEEDEIQELTENDEAP
FT                   CPICMTRMSISSIPMHVERGCPPPPKSIKASAGGGKGNQKADWKKVFSGQTLSGSKGKE
FT                   NGKGKEPEMKKITKPNYSLATPADLRALLSQYSLPTSGDKVALIARVQEWIILYNANLD
FT                   TSRPSSLSALRAKLTEAEASRKRDKEKGKDELVGQLGSKEGLAKYAQEKKGEFERLRKE
FT                   IMERDKRRKAEEKGSGRDSAIEVD"
FT   gene            complement(598406..599901)
FT                   /locus_tag="CNH01870"
FT   mRNA            complement(join(598406..599183,599237..599266,
FT                   599329..599425,599491..599901))
FT                   /locus_tag="CNH01870"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(598453..599183,599237..599266,
FT                   599329..599425,599491..599721))
FT                   /codon_start=1
FT                   /locus_tag="CNH01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45055"
FT                   /db_xref="GOA:Q5KCQ3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ3"
FT                   /protein_id="AAW45055.2"
FT                   /translation="MHRDQATKRSEHSQQPHLPFRMPSFTIPLLLLGALPLILLYIPTL
FT                   TEPYALWDPKVLNSRNASDGRIKAWCNMGWWKNTDIFPEAAEALAGKLLGLAQEGGYQG
FT                   GGSVLDIGHGAGESLLLHLSQENPPSQLHALTSLSSDTAVAKAVVESAYPDTSTHIKFY
FT                   TFSAQFRPGKDVGHPLDPMRGFLGEQSSQRFFEEDQSAGGEEWADEPLEDKSQSSSKYD
FT                   LVYILDSIYHYPPSLPSFLASLRCALHSSSLVVYTDILPPPNLSKINAYLLSRLLSVPM
FT                   PNLSSRPRNLEEYKAQLGTQGWEDVVVEDWSDGVWDGFSNNLKARGHVWSLVGKGIKAA
FT                   EENGWKFIGVRARKGGNVHIEA"
FT   gene            600115..604282
FT                   /locus_tag="CNH01860"
FT   mRNA            join(600115..600324,600377..600864,600914..604282)
FT                   /locus_tag="CNH01860"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(600166..600324,600377..600864,600914..604124)
FT                   /codon_start=1
FT                   /locus_tag="CNH01860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45054"
FT                   /db_xref="GOA:Q5KCQ2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ2"
FT                   /protein_id="AAW45054.1"
FT                   /translation="MSHHPPAPSLAALPVDTSKTDPTPAYYKLQFGDDLTGFSYYVRTL
FT                   TVVIGRNCERPAPVPPPAITNPSVPTNPPLDPNAPSPPSLYTGSILRTPPVANFNSPSV
FT                   VEEDHEANLEDYGPLVELAEAVAVKEEDVADDISPVLELPDAPPPPPPPKSSANVEHVD
FT                   VDLGPLKSVSRNHAKIEYRAELGRFCLEILGRNGAWIDDRFYVKGAVVPLAQGSQVQIA
FT                   TRIFSFVLPPSSLPSPPYNYYGQSALDNVENLPYPYNLPASEVRYQEFFGEAGPGPATA
FT                   AAMASRQPPAFNAFAAADGYGLGLGVDMESQWGQWESEEESDSDAERDYEHSFERDSEK
FT                   DVHEEEQAEDEDWDDAQSEDEDEDEYEEAKPKQATKIKLKKPLIVPGEDESDLSSLESE
FT                   PERPLKSVKKQAGKKQSQSQSKSVENEKVKALKDAKKPSKKESKSKKKIKEPTPPVEES
FT                   SAEVKGTPSKSKKKEKEKEKSKVDSGAEQKPDIQAMTNDEKEKTTPQKKDQKKKIKPAS
FT                   ESKPPAKPAPGLKLPIPLAQQQQQHQPAAQPQPPSVPTLAAALANTPTPPTIASTPASQ
FT                   PAVRPLQQPVRPAPGQPQQGAVRPPGMPGQTGQPMIRPGQPGVPMGVRPPMSGPGQIPV
FT                   RPGQPHSHLKQPLPSTPGVRPPLPQTPVPRTTPSSTGTTPQPTQPFFCTELKETSGRPG
FT                   HIIVNVPIPPSGAGPRPPPGPILGLDGKPFIGPPPLKPTSTFATIIHKALSCLPRGRGT
FT                   LGEVCNWVAGEWEWFRLNVDSGWQNSIRHNLSLNKAFLKVPRIPEDDPESKGSVWIIDP
FT                   QEGPLFEEKQRRDAMKSASKDKNAESRREKERIRAEERAKKQREAAIEAARNPHAHPSY
FT                   VHHPHPTMARAMPPMATARAIARPPANVVHSHPQPSTTQPVPSQPTSANIKGVLQPKAK
FT                   ITVVMQPITPALRAKSVIANTDSNGNPLPFVCDGTTLVLDQSTFGHLTSDILDKLTLLG
FT                   AAGAVDVLSAWVINKNKMQASKAAQQAKTGVTGTAATSSGAPGAVAAKNGVVNGAARPT
FT                   NGVQPARPQPQVAPKPNTTPIARPAVPPKPAATPAAPAAPTTTATTTPAQPTPSTAPAV
FT                   KPASSNPPKSLPGPAPPGTSLTKVIGMIAAVANAKGDVNTVGPNASALLRYIRVVGVEI
FT                   DLRVAERIWATGVVPPLPVKKVSKPASGAATGSTGTGGAKPAQGAGVKPQGQVQGGAKP
FT                   VQNASVPASAPNATGVAGLKRKLEDAAPEQGQAQGNSNGTASGTGGDQEAKKPRLEASN
FT                   V"
FT   gene            complement(604325..606059)
FT                   /locus_tag="CNH01850"
FT   mRNA            complement(join(604325..604520,604575..604736,
FT                   604793..605113,605169..605370,605423..605608,
FT                   605657..605725,605798..606059))
FT                   /locus_tag="CNH01850"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(604512..604520,604575..604736,
FT                   604793..605113,605169..605370,605423..605608,
FT                   605657..605725,605798..605850))
FT                   /codon_start=1
FT                   /locus_tag="CNH01850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45053"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ1"
FT                   /protein_id="AAW45053.1"
FT                   /translation="MSTVPTVTVAGKQVGRMGYGLMQLTWNPQPPPQDVSFAAMKAAAD
FT                   SGSTVWSSAAFYGNPGNNFANIKLLGAFFDKYPEYKSKVVLVVKGGADYADLHPRGTEL
FT                   DFLRTELTEMKKILGDKEIDVYSLARLPEGPVEDIFKGLDTLKKEGLFGDVGASEMSAA
FT                   SLEKAHKITPIAINEIEISLFSYDESIRDAIEWHNNNKVPVFAYSPLGRGFITRTYKSP
FT                   DDIPEGDFKKYLPRFQGQAFYENLKLVDKLDEIAVRKGVKGSQVALAWILSLSDYTIPI
FT                   PGSSNPKRVVENIQSTNVALTSEEKKEINDFLDAFEVQGTRYPAQAMAHLMK"
FT   gene            606334..607768
FT                   /locus_tag="CNH01840"
FT   mRNA            join(606334..606482,606533..606582,606664..606786,
FT                   606840..607120,607178..607768)
FT                   /locus_tag="CNH01840"
FT                   /product="expressed protein"
FT   CDS_pept        join(606410..606482,606533..606582,606664..606786,
FT                   606840..607120,607178..607220)
FT                   /codon_start=1
FT                   /locus_tag="CNH01840"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01840"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45052"
FT                   /db_xref="GOA:Q5KCQ0"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCQ0"
FT                   /protein_id="AAW45052.1"
FT                   /translation="MEDIIATIILISAVYFFVKWLVGTKSGNTSDGGIRGVTPSMVETV
FT                   HSAFPHIPVPNIVYHLSRTRSAQATSEEILERGMLPPPPPTFNIPASLIPTATPQPALT
FT                   HSSSNTNTKAANAKTQSLIDRYNLSSRLPSHKGKEKAEGETAQIDNKWEESKEKRELGL
FT                   KERKEKMILEARKRMLEKQAKEQATN"
FT   gene            complement(607255..608878)
FT                   /locus_tag="CNH01830"
FT   mRNA            complement(join(607255..607757,607809..607900,
FT                   607958..608679,608743..608878))
FT                   /locus_tag="CNH01830"
FT                   /product="arylformamidase, putative"
FT   CDS_pept        complement(join(607272..607757,607809..607900,
FT                   607958..608679,608743..608798))
FT                   /codon_start=1
FT                   /locus_tag="CNH01830"
FT                   /product="arylformamidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45051"
FT                   /db_xref="GOA:Q5KCP9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP9"
FT                   /protein_id="AAW45051.1"
FT                   /translation="MTSLNFKVAPAVQATEAPPIPKAQAWGCQYVPSPSAPLLDLSQGV
FT                   PRAAPHPNVLAALSKVASDPQAARYGPILGEPGLRQALAEEIKVQYHVSGQGVTFEDVA
FT                   ITTGCNMAFLSLLMTLCPPGKSSVLLPLPAYFNHTMSLSLQDVKPVYVLCEPDNMLKAS
FT                   LPSARSYLASLRKGNGDRREPRMIVLVSPSNPTGTVYTNEEIKQWYDLAREYKVALVLD
FT                   ETYRDFVEGESGQRGLPHRLFEEPDWRSTLVSLGSFSKGYRIPGHRLGSIIASPELLQH
FT                   ITTICDCMQICPPRPPQIALTPLLPSLRPDLFAASSQLSHRRHLFETTVNAIPGWEVIS
FT                   SGGFFAYVQFPEDYIYASSILGLKRKKLGSEDVARVLALRCGVVTLPGSFFMPPLADDE
FT                   QWDDILNGETLRQDKWLRFAVANVEDDVILSLGPRLKLMNKIMGVDNEGVAS"
FT   gene            complement(609021..613541)
FT                   /locus_tag="CNH01820"
FT   mRNA            complement(join(609021..609211,609276..609826,
FT                   609881..609965,610014..610186,610238..610360,
FT                   610418..610555,610606..610927,610980..611072,
FT                   611129..611507,611564..612252,612301..612452,
FT                   612503..612656,612721..612833,612884..612996,
FT                   613054..613121,613172..613541))
FT                   /locus_tag="CNH01820"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(609371..609826,609881..609965,
FT                   610014..610186,610238..610360,610418..610555,
FT                   610606..610927,610980..611072,611129..611507,
FT                   611564..612252,612301..612452,612503..612656,
FT                   612721..612833,612884..612996,613054..613121,
FT                   613172..613458))
FT                   /codon_start=1
FT                   /locus_tag="CNH01820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45049"
FT                   /db_xref="GOA:Q5KCP8"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP8"
FT                   /protein_id="AAW45049.2"
FT                   /translation="MSTKPRRHIPYLPFHKNLIRTLCRPQQDDLLLIAKGLGLRRIVCA
FT                   LLKTYDRKEDLVLVVGATPADEAGIGDELGIMGVRDPGFRVVGYEMSVKEREEMYRHGG
FT                   LFSVTSKILVNDLLKGTVPVKLITGLVILHAERISHGSQEEFAVRLFRRENQSGFCKAF
FT                   SDEPEVFAHGMSPLRDMLINLNMTSVLIWPRFNEVVKVDLSSRRADVVEMYVPMTDLMR
FT                   HCQDAITECMEAMLVELKRDHSLNLDLEDINVRNAQFKNFDTIVRMKLKPVWHKVGAKT
FT                   KIHVAALTELRNLHTWLLEYDSATFASYINTLQRQHFQAERLTTGAGRHIHDWFNAKAA
FT                   SQLVEASQARVSRRKMVMDNIPGPEEDADRREVSISRDEGVDSQEGEYGLEEEALREQE
FT                   LAEQQRREIQGIVPDDDEEEIMEIFATQTQTLPQHHRPNDADNDLEQGPMAQDENSDET
FT                   LRSAEGVPPPVFRPVMLSVKDDLGRSVEKRLKKGYEAVLEEQPKWSVLAKVLKEIEDTI
FT                   ASVQVSHADSPGTNIILVMTSSDRTCLQLRQYLTTMSRTDPPFGPNAGRKMMESLFLSN
FT                   WQHEKNGEKLGSAGTGMHRSNEDEIRVRGDIESKRVEEQRRAERTRGRGRGVPSYKRRR
FT                   QRGGAAAPAPRLAEMEKEHKEAMMKAHSAFGGGENDEDTQMQWALGESTRSASFNDLST
FT                   PSTSLSSSDPSSALLASTGILDEDDLQPVSGSQTIAEAQYGLLPENFEEAYGLIAPEGA
FT                   VIIRPYGGEDDDILLQELRPRFVVMYEPNLAFIRRLEVYRNCNPGLSLRVYQMIYTNSF
FT                   EEDRFLSTIQREAEAFKKLIDDRQSMVIPIYNNNPRAPMRDTVTRSKTTYSSRNAGGGE
FT                   SAEEARIIVDIREMGALLPSLIDSAGIKVVPSTLTVGDYILSPKMCVERKSLADLEGSF
FT                   NNGRLHTQCEAMTSHYETCILLIEFDEDKFGMRTKEDARREAAGRANDPDETWRDTFYL
FT                   QSKLALLALHFPRLRIIWSSSPHESVKILSDLKLNHDEPDEITATLKGSSEGEQGVRSG
FT                   VENAAAVEMLRSIPGVSGRNLKFVMSKVESIKHLVSMSRGQLKEILGEEGGEKAWEFLH
FT                   HDPRYSR"
FT   gene            613721..614677
FT                   /locus_tag="CNH01810"
FT   mRNA            join(613721..614002,614060..614167,614227..614677)
FT                   /locus_tag="CNH01810"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(613859..614002,614060..614167,614227..614520)
FT                   /codon_start=1
FT                   /locus_tag="CNH01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45048"
FT                   /db_xref="GOA:Q5KCP7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP7"
FT                   /protein_id="AAW45048.1"
FT                   /translation="MFSQVFIRRSLHTTPRLLSTASALEVSLRNALKTAMKSKDRPAAS
FT                   CLKSVLADVTNAAKSGPNPNEPPTHESVISVLRKGIAQRTQAAESYAPSSPSAHPENHA
FT                   SLTNEISLLRSFLPAAPSEEVLQSIIKKTIESLPEDVRSSKGAAGKVLQALWEELGESK
FT                   AAVDKKAVGKWVQEALKA"
FT   gene            complement(614212..616930)
FT                   /locus_tag="CNH01800"
FT   mRNA            complement(join(614212..615890,615940..616652,
FT                   616714..616930))
FT                   /locus_tag="CNH01800"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(614704..615890,615940..616652,
FT                   616714..616781))
FT                   /codon_start=1
FT                   /locus_tag="CNH01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45047"
FT                   /db_xref="GOA:Q5KCP6"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP6"
FT                   /protein_id="AAW45047.2"
FT                   /translation="MPKPHLKALAITDLRPSFLSTISHAINMSFNRSSHHDDLPGQELE
FT                   RRPRHTRSGREWRRYSPSWPVDFSSPPPDYRSYSTSPVRTRLYHSRPSPSETTRGPWRP
FT                   PPPPPVSFPPPHYVDLARPSTKKNKALVKKTVTPKLLVLDLNGALVWRNRSYRAHMSNP
FT                   RPYLSCFLEYLFLPEPSSDNGNRPGDTQSVRPWEVFVWSSAQPHNVRAMVEACFGSRWI
FT                   EGIWEQASEEGKKGTEEGEGRLLGVWARDKMGLKGFDYSRKVQTTKDLRKVLSHLIETK
FT                   KLPDPTTPYSEKTIVLLDDSPLKAVFQPWNQIVIPEFDKALHRSSRLAAGLKSDTHDDS
FT                   DDGEASTSQTGQGHEMDKILLAVIGILDQLRHVSNVPLWVRAGGLTFDLDETNLHPPTH
FT                   ESLPSHVDYQHWFNDQEVYSKWVAKGEEALKRKGIEVRHGLDIPPSPPSRETQDGIFHV
FT                   APIASLRSPSLDSREEREESRARYSPSRPTSCLSPSSSDDRLDFEVSDGEMECTKSESA
FT                   FARRKREERAREKAARKVRKGQQQFARYAEHKVDEEAIKGEVHPGDIADLSINENAAVP
FT                   SENKIDSKAPNENDIESVAARKEAKQVRRKQTRAERKVKKNEKERELEELRRERKGEQA
FT                   SGEAPRKRASHLQRRHPLKE"
FT   gene            617071..620405
FT                   /locus_tag="CNH01790"
FT   mRNA            join(617071..617415,617464..618270,618312..619058,
FT                   619120..619172,619227..620405)
FT                   /locus_tag="CNH01790"
FT                   /product="vesicle-mediated transport-related protein,
FT                   putative"
FT   CDS_pept        join(617315..617415,617464..618270,618312..619058,
FT                   619120..619172,619227..620275)
FT                   /codon_start=1
FT                   /locus_tag="CNH01790"
FT                   /product="vesicle-mediated transport-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP5"
FT                   /protein_id="AAW45046.2"
FT                   /translation="MTLPFFLQPLLLVACYYNRVIRSLKSWFHRYNDQLFGPLEQAVAA
FT                   MVIINLAMKPTAAPLGIFIQPSQVQMLQTPLSNLTDDQDGRRSGGSETASDGTTAIDSW
FT                   SDGFSMLILSLSFFCSKLTSWMNPASIIIIILLTLNLVKGLDDGHLLGELRDLFTMLWD
FT                   RHRSLGRQERVVETQAHRSTNEEVKTEAPYKKGKDSESETRLSSIDKKTVRQAVKQLAE
FT                   DSVNCPPDPVQEGRERTKEPIEIDNNGQISSTDKAVDASQKEKPKHFENPSASEQIRVL
FT                   TESEKTQKSKITNDQVKSQSNKSQDKGKERMAGERTGDVKDETLVKTNTEKKAGSKESL
FT                   IADPSVASAQSKIQEEDALISGDYRSLKSALKKPTKKPKQTQNIHHNYFMTMRGFRPAL
FT                   VPFPQGLHPKPHYPRNTMWWNNIPDTPEHIMAAPKVPKEPEEEVDVEEPKEKKKVTEEK
FT                   PIEKKFIEKKNEARKDDGKDMNGKLISESRGSEKTSANRIKAEAESKARKKAEIKASST
FT                   GATSASSIATIDKDSGRASVAAKISQGHMSRNHQLDKATYAAQAMLCILLYQLYPQLSF
FT                   LLLVFFVWQYIDSHQGSLPTLDDPRATDRSTVASSVAVSKPVSSKTTAPSTTEKAAAET
FT                   KHKVAEESNIGTSRSSPSQKSPENKDGSEKKLAELENLIKKLKSENDLTPALKDQLKAA
FT                   LKRREGLIASLYDEGAEDNKTTTKGLMHKLEDVESYLKKHHAQNKVTSGSEMKLSKVKA
FT                   QHEVLKTKVANLQRRNMPVDKVKESGVTTPASKDDDHRNDTRSLPEQREKKLQRDERAS
FT                   IKEHSSKRAKSSEEPNKSANSVTADNSEALSVDCRKMKDKIKAIESYIMKYRKLATLSD
FT                   EQKEKVVKAEKQRKEMKEKLESIARKMANVGSSGLSIEEKETITKDT"
FT   gene            complement(620376..627719)
FT                   /locus_tag="CNH01780"
FT   mRNA            complement(join(620376..620519,620582..620687,
FT                   620744..621226,621281..621521,621572..621934,
FT                   621978..622092,622144..622865,622927..623142,
FT                   623193..624713,624766..626045,626098..626543,
FT                   626592..627205,627255..627719))
FT                   /locus_tag="CNH01780"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(620673..620687,620744..621226,
FT                   621281..621521,621572..621934,621978..622092,
FT                   622144..622865,622927..623142,623193..624713,
FT                   624766..626045,626098..626543,626592..627205,
FT                   627255..627598))
FT                   /codon_start=1
FT                   /locus_tag="CNH01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45045"
FT                   /db_xref="GOA:Q5KCP4"
FT                   /db_xref="InterPro:IPR024481"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP4"
FT                   /protein_id="AAW45045.2"
FT                   /translation="MSSDNPRPEDVETLLAARRRVQEKPNTDALLPVYLYLLPQSNEAS
FT                   SGSSPLEDHWYCSRSKSTLHIEAATYLIFLFAFQRQGTSKTWVDKLEVVLESCENCARS
FT                   FGVARRRLESRYLSEWPAHVRKNFFAAVDKWQSTFILNHSDKASDRGYGKPSSTEPALY
FT                   SLSQPIVQLLLGEPSLLSDPGVNSLYQDAFQSTLPAPTSLTALGMTPIHARLLSSSEPA
FT                   QNRWSAAQLPALARRPIRFSEWCNLGIGSEIQDLYNDGALDGEKRWQNVAAILNNKVLD
FT                   QETVEKGLLGGQLETDSRGRKGRGVMSVLSGLLSSDIPYLESVISCLATLLHTSPTRYI
FT                   WSFDTSPDLPHTLISELRTNPAFNELLETRYPSPLDSEADGHSAHGNGSNKSKGRRKPD
FT                   TNPLDWLGDYLLSVADTEKGLVTQVGEEKGSGMAFAEALAVTTNMVFQELQHGRLSNEL
FT                   RATAASAGFEAILRVYQTLIAEDVSVNTAISSTLDLHSSFITTVAFRSKNHPLPAWCEA
FT                   RSSARALLTTIFQADARSTIHSLLTMAAVAHEERKRQQKKRRTKSDVAVGPAKKVDHLP
FT                   LASVRKDLWSMAYDALSPNDAAGAAILLKSLAPFSHIELLDRQASWYHHGLEEAVKKED
FT                   WVAAIRAINTAIKATRESFPRAIESLASQADPSGVRSLWKEQGVAKAATILLLSPDDEI
FT                   HTPIISIIQQSFDDVDDRGDCFRALLQHYPDTAVDGLNDFLRTFIETARITPESCSLAK
FT                   WLVRCFHDVLEVLCRPSGVLGPLLQSDDFLTSFADGRSMRKRLEELWHLMTTSLALIFK
FT                   RTLDWAPHFENEVMVDWMRDALIFGRQMTDHIRAFEAAVLGSSARGSETMSESSARQSL
FT                   VGKKMTKQLELVLSDLILWLRLTDIETLFQTHQLIKTILGRISKSTTDVSKNPTLEKTL
FT                   LDIDKFCRKGSRSFTSRLSDDLLSELSDLLEPFNLVDDSEVQFVKEVKPKSSSDVGTSR
FT                   ESTSNISTPSTSKAPVRNAFTEMMKASGGKLASSSKTSTSTAKSKLPTPNDVVDVDDFD
FT                   DDFLSNISASDLDLIEKRAILKESARQAPPKPSIQSRLSTSARPHMPSSKLHVDLTYKV
FT                   PPKPAPSFQSKVMQDIRREHYASIHERKRLEAGQVAPKLPTASALGSGLGAYTGPPKPR
FT                   VVEPVDSGSSASDSSDDERAAMKGLLSKQKSPAKPVRPVVEKRSIKVLGDPIAEIHRRN
FT                   EDRRAKAHATKMRLKPDLSPLYRYILSWDPDHQGPSPPYGTKFAAELSDMRVVPTTFDS
FT                   PRQYERIMLPLFLQELWSQCANDQVQVGPVIPVEVASRQYEDDLVEIDLMVIGAGDFYC
FT                   NDSDLVTLRQPSNPKGIFAKIMGFKKHPKGSMIRARIMSAMDQKELCGKSKWQLRKHVS
FT                   LSTSIREFAALKGLPWYESSLLSDILAGRSAVMPKLSTQRIEDTMKCLSLNEPQAKAVL
FT                   GALEVRGFALIQGPPGTGKTKTISGLVGKWMSERRVPISVDGQPPVKPKLLVCAPSNAA
FT                   IDEVCKRLILGVPNPDGGQYNPNIVRVGIDASVNIAVKDVSLDSLVEALISNSSGRNVG
FT                   GEYGRIQAELDDVKQQIKDKQEAIKLAQDHDEKRKVLEDEYHALITRRTQLGQASSKAK
FT                   DAARDATRHLDGARRAARDQILKDADIICATLSGAGHDTLAAHTFETVIIDEAAQAIEM
FT                   SCLIPLKYGCKRCVMVGDPNQLPPTTFSTNAEKLQYNKSLFVRMTKRDASHVQLLSIQY
FT                   RMHPFISELPSKVFYHGQLKDGPSMAKKTAAIWHQRNIFGPYRFFNVEGTEMKTGTSTK
FT                   NPAEALAAVELYRRLSADFGTRVNLAMRVGVISMYREQLWELKRKFTEAFGSAILELVE
FT                   FNTVDGFQGQEKDIIILSCVRSGPNLSHIGFLKDTRRMNVALTRAKSSLFIFGNGPTLE
FT                   RSDERWKIIVQDARDRGFFVNYDSTTFNTAFLEPPPSVKKKASATSKSKASPGASKSTT
FT                   MPDGLLPPKDLAADISTPSKVKREASVELAKEKKKKRKMSDGSSRAEESNSNVAVATSK
FT                   PTSRLSSGSTLPSVKHAEDSPQPSSSKPPLPRIPRPPQSSTASKMTRPPPPPPEDVLFI
FT                   KKKKKRLNK"
FT   gene            627779..629179
FT                   /locus_tag="CNH01775"
FT   mRNA            join(627779..628469,628536..628645,628704..629179)
FT                   /locus_tag="CNH01775"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(627890..628469,628536..628645,628704..629099)
FT                   /codon_start=1
FT                   /locus_tag="CNH01775"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5X2"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X2"
FT                   /protein_id="ALO69524.1"
FT                   /translation="MPSRPNQAISSASRRAKRTIDSASPSTSSASLTPPLSSQSHAATT
FT                   TRSGRSVKRPLPDYTDDSDDEEDNGAAEDVDEDELEDEEESIDTDSVPVANPLRIKLTV
FT                   NNPGIQPKPRQSTSFTKKSATHKKKKAEEPPDMDGDMLDDDDLENEKGVTFGEGEDDSA
FT                   TGSKSPTKMTARQRAKGNKDLQEGLLVLEEAPSSRALVLTEQEKLERKEEASRRRRRQV
FT                   EQKLQDEQDETINRLLRAQTSRSRSKLDNPMDLDGDSPAVASPSRRVQPAPEGMIRWSS
FT                   KITKEGDVVMRVAAPKEKESWLDLVGTKLDEVDGKRRSLNSGKGMCDVPGCGEKRKYRS
FT                   VKDFERGGCCIEHLKAVEASL"
FT   gene            complement(629567..630467)
FT                   /locus_tag="CNH01770"
FT   mRNA            complement(join(629567..629723,629777..629865,
FT                   629926..630076,630262..630467))
FT                   /locus_tag="CNH01770"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(629661..629723,629777..629865,
FT                   629926..630076,630262..630357))
FT                   /codon_start=1
FT                   /locus_tag="CNH01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45044"
FT                   /db_xref="GOA:Q5KCP3"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="InterPro:IPR038551"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP3"
FT                   /protein_id="AAW45044.1"
FT                   /translation="MTFKRRGGGRNKKGRGHVKFVRCSNCSRCVPKDKAIKRFTVKNMV
FT                   EAAAVRDLSEASVYAEYALPKLYIRLAYCVSCAIHAKIVRVRSAKPGAINSRKNRNPPP
FT                   RAIFKDGKRVNPAVAAAMAAKTAQAEKV"
FT   gene            631553..633756
FT                   /locus_tag="CNH01760"
FT   mRNA            join(631553..632798,632846..633756)
FT                   /locus_tag="CNH01760"
FT                   /product="glycogen storage control protein, putative"
FT   CDS_pept        join(631877..632798,632846..633597)
FT                   /codon_start=1
FT                   /locus_tag="CNH01760"
FT                   /product="glycogen storage control protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45043"
FT                   /db_xref="GOA:Q5KCP2"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP2"
FT                   /protein_id="AAW45043.2"
FT                   /translation="MYHSMPDSHDLPAQSIASSSRQPSSILNRADQHASEAGPSRSAST
FT                   DKGYHADVVNRPKGDHLGVPPSSAYARGPTSPTSELSPLSCSGMTPHLDICKYPTQQLL
FT                   RLLAGLLQHIAGSNDQLRAELEAEEDDEMDEQHVDDNTANVDRRSRPHSRASGRSYVPS
FT                   GTSSTAELFSEPASSTLTSPALTSRSSSAASSPTSYPLSQFPLFTASKSSLSHPSALLA
FT                   FHARHIPSISIEAYLLRILKYCPATNEVFLGVLVYFDRMTKLGTPAGIGGESSKVGKKG
FT                   KGFAIDSYNVHRLVIAGVTVASKFFSDVFYTNSRYAKVGGLPPTELNSLELQFLLLNDF
FT                   RLRVSVEEMQRYGDRLLAYAEEAGEDIGTVGVERRRSDASEWGEFEGRHNERGFEGRTF
FT                   RESSGGRDSRSTRPTVEEANSAFSSTPTRNPASAASANAPLPNPVSIKYASTQPPLPPN
FT                   QSSTPVTVPTSPRIVQSKTQPREAQQPQTRAQTQPMKSHTFPVGSSVPSASAGSRTGTG
FT                   GGVANAGNGADTVSGGIRDWVRGDDPIAVVGGRMTSPMRD"
FT   gene            634317..638334
FT                   /locus_tag="CNH01750"
FT   mRNA            join(634317..634950,634998..635892,635959..636321,
FT                   636371..636434,636485..637413,637466..637998,
FT                   638053..638334)
FT                   /locus_tag="CNH01750"
FT                   /product="expressed protein"
FT   CDS_pept        join(635010..635892,635959..636321,636371..636434,
FT                   636485..637413,637466..637998,638053..638112)
FT                   /codon_start=1
FT                   /locus_tag="CNH01750"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45042"
FT                   /db_xref="GOA:Q5KCP1"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP1"
FT                   /protein_id="AAW45042.2"
FT                   /translation="MPTNSTSPLSVSRPATTNPDVHVSSPTRPSFMSHRRGLQSSDSAR
FT                   DKDPMENLEGVHVRGHHQKRVSISSLADPVVNHSRRVSFSSEAIGDGQKSPIYQIPQRL
FT                   GRGSLSISPETEVSDKNSIAKPRAKPRPLSFQGSPAASLLSPSSQSKFSITAAGKGLTI
FT                   SPSLARNPSSGFKSIWSASATLPDNTYSGWNSPVNSPKTVGSDSGTIGSAALVAKKRGL
FT                   SIAIVKDNGGVIPVTPSLGSAGFKSQGTALEGAEMKMICASKNDREIVHATAASGLITG
FT                   KLDSAKSSGSKKEIILCKFYHTTGLTCTSRPCRFVHALSSAKSPLPTDDISQYAMLSPT
FT                   RPIDPTSGTFAFAQQQINQVPKQLKVDSGGIDQDDVEMGERVVLKDQNGQEVTGQVFLM
FT                   SGGGKGAGGKGRNKYKTVPCKDFAEGHCPYGDYCSFLHDEKTRNVLPTDDKSSRTKDHK
FT                   PSKAGHKDCLVPSIRVGPDVIHKSRSSGLSAFGTRFSQIAVQVDRSRETVAAPTPRRAV
FT                   FPASSATLKAHTPPVPTSEPASVPMAVVTSAPPKSNAWSKGPPAPIKKIRSLKKVTIAD
FT                   MGHKRDLNVSLDAPLKTPTSAGPLAVPLSAMSLWTESDPATPFDPMTHRKRMLEIEEQA
FT                   KKNGHSKVMPKSSLVNLAFDSSPAPSQVFTPSESFLPFMAPTYPWGMPMSPVSVGAYQD
FT                   PSIPDIEGGLGVIWTPTGWAVQDVAMKHALRSTEMKQKFENAKGRKPMSYYRTRPCKFF
FT                   AEGHCPHGEECTFLHIIPASSPEPLSSSDSDSADYKPKGQGNRRLKTLPCKFFNSAAGC
FT                   INGDDCAFLHTRIVPESAPLVARPRPWRTKPCRHYQLGRCMLGDACHFAHVDDPTWIAS
FT                   GRKTGIMTPVKVENALEQLTAEKVEMTIKRIREMSKERKEDDEEDDEEDDIQIVTYSTL
FT                   SPSTSSYGSSYAV"
FT   gene            638606..640075
FT                   /locus_tag="CNH01740"
FT   mRNA            join(638606..638852,639037..639105,639336..639486,
FT                   639538..639700,639755..640075)
FT                   /locus_tag="CNH01740"
FT                   /product="expressed protein"
FT   CDS_pept        join(638810..638852,639037..639105,639336..639486,
FT                   639538..639700,639755..639793)
FT                   /codon_start=1
FT                   /locus_tag="CNH01740"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45276"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCP0"
FT                   /protein_id="AAW45276.1"
FT                   /translation="MLAAFALAVLPLLSSVIAIDGCTRNATVQSGDTCDSISRQYGVST
FT                   YQLALVNDATIDENCDNLTPDETVCLGIEGQDCTKVYTVVANDTCAWVQEMYGISNETL
FT                   YANNPQIDADCENIYVGEVLCVDTDAFSYPSYNESLYNALAWTYLPYCDE"
FT   gene            640691..642157
FT                   /locus_tag="CNH01730"
FT   mRNA            join(640691..640950,641035..641199,641254..641349,
FT                   641403..641422,641473..641628,641682..642157)
FT                   /locus_tag="CNH01730"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(640887..640950,641035..641199,641254..641349,
FT                   641403..641422,641473..641628,641682..642068)
FT                   /codon_start=1
FT                   /locus_tag="CNH01730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45041"
FT                   /db_xref="GOA:Q5KCN9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN9"
FT                   /protein_id="AAW45041.1"
FT                   /translation="MSTPTVTLNDGVKIPKIGFGLGTTHYAKECVEHLVSALKTGYTYI
FT                   DCAQMYKNSKSVKDALEKWGGKREDIFLLQKCGSGGGDSESEKNPKVILKGLLQEMGVD
FT                   YVDLYLLHSPLLFAPKYSINEAWAIMEEIKSEGLAKSIGVSNFREEDLMELQKTWKIVP
FT                   SVNQIEFHPYNYHADNMVRLQDFCHSNKITIQCYGPLTPLTKVPGGPVDSVVKKIAQAK
FT                   GYEDSQVLLNWAVQKSQGVVVTTSANEGRQKLQLEAITEKGELTQEEVDEISEAGKKMF
FT                   VRAFMQQVWDKARK"
FT   gene            643461..646509
FT                   /locus_tag="CNH01720"
FT   mRNA            join(643461..644397,644461..644660,644718..644816,
FT                   644870..646509)
FT                   /locus_tag="CNH01720"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(643867..644397,644461..644660,644718..644816,
FT                   644870..646274)
FT                   /codon_start=1
FT                   /locus_tag="CNH01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45251"
FT                   /db_xref="GOA:Q5KCN8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN8"
FT                   /protein_id="AAW45251.1"
FT                   /translation="MNKEESWRREGIWERQCHAGPSRLRDEPEHAHYAARDTASRSSNE
FT                   DGSRRRHHGPTRTRRQIRQNQTLHLSTILPPLFLLPFLGVTSAAPAVIPAQPTRLRLPS
FT                   IPTVLPTVTTTLQPTRTLDKRVKYLTSVITPSVLPTEIHFVDETTLPYLLTQHADGSWR
FT                   KAEAGWFLYGRRIALPTDKATPSNDDEDHTEDAAESVTNRTVSIDSDNAMLTNGSNSSV
FT                   TASNATSTAVPSFAVEKALPNGWGYSSNRTSIYKVPLIAVASVIMAIAIVVLIIIYALN
FT                   RRKKHRKQKRAKERLRRKALAAAGLTEDDIKCSTAETAFKEKLAEMERKHKAKKKRDGQ
FT                   MGLARSKVKGWNARLGTVRRRKGKKEEKEHDAMSLKENKIMEEDIFERETVEQPEIIVS
FT                   PHLVSPPSPAPSQTPSEQPASVETSAPQSDTSFPVSPTPYFPPAYRPASVRSIPTSTAG
FT                   PSRPSASAHPPYVSSESSAQNSLAGEKTQAPGYYPAPATEDGEIALAVASRADGKARLV
FT                   EPPAVTEEEDPHLRMNHVATDDKRVLERLRMGGSAPPPVQTEAEEGPTAPVVDVDDAGF
FT                   EIIPTIPEEDEAVRTSRESEREGLAFPPPPQLSARLVQFHNLDSPVPSAPPITSPSAPD
FT                   HQYTTPSAPPLEVPDVEPSAPPLALDAEINGPSAPPLGSDVDSELEAGPDSSHSLPGSH
FT                   ASTDASTMGQSDPDGMVSEERPESIASSIASSRSGSVQGVQGVFLPRYEP"
FT   gene            646768..649914
FT                   /locus_tag="CNH01710"
FT   mRNA            join(646768..648646,648698..648824,648874..649277,
FT                   649321..649914)
FT                   /locus_tag="CNH01710"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(646893..648646,648698..648824,648874..649277,
FT                   649321..649879)
FT                   /codon_start=1
FT                   /locus_tag="CNH01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45252"
FT                   /db_xref="InterPro:IPR028094"
FT                   /db_xref="InterPro:IPR039024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN7"
FT                   /protein_id="AAW45252.2"
FT                   /translation="METELVNHGDVFSSSPGRAQEHEQYKRTKSDNANSSVETRFIFGG
FT                   DKGQVSIGSMFIPKKKPLGMTRRQVVPTGSLSSVGYQGAAETSATDLRRQRQMGMDKGE
FT                   NELRALGLTSRAEFENGKEERKAGKTRERDQDKRRFQKGALHTSRVSRSCSAAHDFSDE
FT                   SDTKSPESFKKRSLLSSNREADRVFEQLLATEQNLEKLYNQTTSGARSGVTSRKAVDAT
FT                   RKKGKGRESEPVDLRSPTKPTSAFKSSNRGTTSSNRAESNARRSNALRPTSSSRSRSPH
FT                   KTKETSKTKGRSTLDGVPRNRLVSVTKSEINDRLSSTVVEVSDTENDEDDELALGSTPP
FT                   KHQSEGYRDKASAASSSSLSNGKANDVDAFSLMYGSQAPTKPIRNGRRLGRRDSDVLVS
FT                   PSDESMVFTPKPSRSLAASKRADRTINTTKNKATKRRSSNSSDNDETVVRVGKGKGRPL
FT                   SVEDSTPKSRNMKYTREGASKADVKAQHEDSDDDYVIHTKKSPVKRRKTTVSQRYGKKT
FT                   INSDDEDTTPAPFVPEKLTPETQKEREDTTRQPSVRNNDKGFYFFETLSSNMDSSDYDE
FT                   FDDEFLDGPSILVNADDELDAEKMALLGEDEFTKKEREYLLSHMDWTNLCPYCNLPLPN
FT                   KPSKHHEYLKAKLHKLSTPAPTDENPNARALSWQKAIEFCSLHHAETTIIPLGIRAGFP
FT                   VDIDFGNLDRRLETGWIRNELDKIVRQPEESAVFREVKKEVEEVGRMKWSSLAHQSKEE
FT                   RLAAVKPGYYGELGRIIITDHFQLLRRLNYMMPNIPPAKSASELTQDVVTAIDPLSPSD
FT                   FIANVLVPEAANFLIMQDRGREGFDQAAYEAASKTRTESSKYGEWKFPEASKSSKRVLE
FT                   DLRSGIDDKRRRLAKIRGKKKMKSEKENLESAGESGDRQEDSIVVEESSKEVHRSSSLY
FT                   DKGWEEDHWKSAAKLVD"
FT   gene            complement(650709..655399)
FT                   /locus_tag="CNH01700"
FT   mRNA            complement(join(650709..650977,651041..651254,
FT                   651323..651441,651504..651618,651694..651851,
FT                   651924..652189,652256..652394,652477..652929,
FT                   652993..653115,653183..653269,653374..653671,
FT                   653746..654371,654435..654603,654660..655399))
FT                   /locus_tag="CNH01700"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(650804..650977,651041..651254,
FT                   651323..651441,651504..651618,651694..651851,
FT                   651924..652189,652256..652394,652477..652929,
FT                   652993..653115,653183..653269,653374..653671,
FT                   653746..654371,654435..654603,654660..655291))
FT                   /codon_start=1
FT                   /locus_tag="CNH01700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45040"
FT                   /db_xref="GOA:Q5KCN6"
FT                   /db_xref="InterPro:IPR007191"
FT                   /db_xref="InterPro:IPR039682"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN6"
FT                   /protein_id="AAW45040.2"
FT                   /translation="MQMRAQMSAAAQQQASQPFQLSGATNTETMRNVVGAFMSAGRQHE
FT                   QPAPARRPHKSEARMKKSHREEVWEDEEGGQFGEIDSAMRQVKKDWPFVMESDFSSSSL
FT                   ALSLLSQAPSPSLPQHPGLSSFLRLHDSLSAGLQAAVQANSKSFAASLPAHQNFLDILE
FT                   RAQEQVRKSKQELKAARDGFAGKGKSELSGIRARERTVRDMLRILDTIDNLRQVPDQLE
FT                   SLVGDKRFLQASLILVRSLETINKPELREIGALSDLRSYFMSQETTITEILIEELHNHI
FT                   YLKTFYSDSRWRPYTPGRADLPIIGSQDEDLAFLRSPDPNSTSPNLSGNNTSSTTTNGN
FT                   ANATAGPGTSSKFSRYLSQLSTKPSTRPMLQYDGDPIPSTYTLPAVHSHQQPNALGLGS
FT                   GTGIVQPGGSHTSLSSLLGTAGNTGNPETDSYVYIENLLEALAVLGRLGQALDTVAQRA
FT                   PGEIFALVDGTLDEVEERTERHREEDLSVRPQNLLGNVDPTPSSRTNPPTATTTAVPSR
FT                   KSLFSSAETSRIEISLGAAGPPQHAALLKDLFWTLYSKLAAVLEGHRVMYEVSRWISSR
FT                   PDFKDSTTPKGSSINIPVLEMWRPVQQEVRTLLSNYLTDDRPGSRLDRNPILSINEVLR
FT                   DPKVSRDKSKSMFRFNDSDSRAIQKEIKPIDDSVQQALRSSVPGLVNMQSDQPVSIAPD
FT                   TDDRFSPSSSRYRTLVPPNAFNVTTLFHPTLAFIHRASAIVPPGFESETQGFSTILEDF
FT                   VVKVFLRQLDEKVTAGFQKAVSGYDAYQVDRGVLADTKQRPLKSSVRVMALIHSLCIML
FT                   QTTPFHRENYSRLIVGVIVQYYQQCSARFKDLVSHPATFETDSERPMVIPAVWAQREDI
FT                   TKCLSEMRSVPTTDRAGMASVSHKEIRLEMELLRDRPVSESNLINSSRKLEALGNLSQS
FT                   LRWFIAALLDLQWVSEEPVSPEGEQPELDVLKTAPPLSADSDEPRLPLTRAMAQRYQAI
FT                   IQTYEQLAEMVVNAIRLEIRCKVMCNIGASMQKGDFRLESEALEPDSDILDLNASLVEF
FT                   EELAQRTISPDDHSFIFRALGQLVDHCLIAYASKYVKGVNAAGVRKIKRNILSLQQTLR
FT                   GIATANEQGVLVRATEFWDLYEQGPKKMLEDLKNINGTPPYAFEDYNTMLKLQCKSNTD
FT                   ELNTYLIDLHALSMDVEGWDLGED"
FT   gene            655688..658665
FT                   /locus_tag="CNH01690"
FT   mRNA            join(655688..655949,655997..656285,656353..656417,
FT                   656465..656583,656650..656712,656764..656863,
FT                   656920..656995,657064..657214,657292..657507,
FT                   657576..657720,657794..657802,657875..657887,
FT                   657963..658241,658314..658665)
FT                   /locus_tag="CNH01690"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(655690..655949,655997..656285,656353..656417,
FT                   656465..656583,656650..656712,656764..656863,
FT                   656920..656995,657064..657214,657292..657507,
FT                   657576..657720,657794..657802,657875..657887,
FT                   657963..658241,658314..658553)
FT                   /codon_start=1
FT                   /locus_tag="CNH01690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45039"
FT                   /db_xref="GOA:Q5KCN5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN5"
FT                   /protein_id="AAW45039.1"
FT                   /translation="MPDTPPHKHHYTSLRSLMHSPDPGNPAKRDSLTPRQPRPSRNSSS
FT                   SRSRERRLDPPRKADKDKGRLSTWKLMCLTVSMGGSQIAWTVELGYGTPYLLSLGLSEQ
FT                   LTSLVWLAGPISGLIAQPLIGAISDSSHSRYRRRYWIVTSTMLLVFSGLGLAFTEPIAK
FT                   ALVDLIGGGQGDWDPKTIRLVKNTAIGIAVFSFYCLDFALNALQASLRNLVLDITPGEQ
FT                   LATANAWHGRFNHVGNIVGFTMGFLNLSHVPIIRLVGGGQFRKVCIVALVLLVMTVWIT
FT                   CWTQEEKETDSIFGERRSKIRDVVGTIYEAVLHLPKPIRRVCIVQIAAFMGWFPYLFYS
FT                   TTYVAEVMAKELHHKPDIDRATRAGSLALLIYSFVAIIAGTLLPYLAARDRRLLKPTSE
FT                   KLRDGEIEIENEDEEDEEHVEMERIREMVQQWKAEAAREGRPLKLPTMPFMLRNIWTAG
FT                   LVIFGCLMMSTFFITKVWQATVMIALVGICWAIACWVPFAIIMEFLKELDDKPPPRISD
FT                   GRPRPTHARTASTPLGWRSHPTSPAGRASPDERTPLARSYSTADLDGANEMEYTGQGPV
FT                   AGGTIMGIHNLAIVFPQFIIAVVASIIFKLADTQPDIQPTSPEIGGPHGQDKNGVAWVL
FT                   RFGGLMAFVGALVSRKVPPTKTEKAMRRRLADMREESAE"
FT   gene            658884..661354
FT                   /locus_tag="CNH01680"
FT   mRNA            join(658884..659077,659139..659178,659238..659388,
FT                   659501..659772,659828..660270,660326..660449,
FT                   660502..661354)
FT                   /locus_tag="CNH01680"
FT                   /product="expressed protein"
FT   CDS_pept        join(658969..659077,659139..659178,659238..659388,
FT                   659501..659772,659828..660270,660326..660449,
FT                   660502..661297)
FT                   /codon_start=1
FT                   /locus_tag="CNH01680"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01680"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45253"
FT                   /db_xref="GOA:Q5KCN4"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN4"
FT                   /protein_id="AAW45253.2"
FT                   /translation="MSQRQGRRSMGPTSLPQQTSQERREQGFVEQQKFDDFRRRHREQN
FT                   KDIILDNVERKKIIKTLQDEISILQNELLDVRRRNMALESRVKKMERENSRLGGVDVLK
FT                   ALDHLLAAAPALYNLRQSLSSLPIPLHSTSYKQPSNTRPTLTFVGNPTATRPAANGKQR
FT                   QDLGAVVESEEGDWVDDRRVTSRSRGRGRQTDVGSVAASRSPRPKTPVSPARSSISPSP
FT                   KKIISTRKVPAKRRRESGLLSTRPRSCSPEVVSEQEPAIPVQQEPQVMDEEPVGGTKVD
FT                   EEPLGETSEWEEGPVVEMKPDEALALVQEEEQVDFSRKEKEATIEPGAEIVKVNETESE
FT                   SDPSRPSDLTITDNAEPEGTGRGRRARASVVSYKEPSLVKKMRKPDGIQTQDVIKTLTR
FT                   KSISPRRVKSSLSPKRTKKDAYNTSPSPPMPLIPEGSLSSRSASTRTANLSASSQSMRR
FT                   KSTLPKANSRSRGKQEEFGKMARAEDKGGEDLEEYEDVHDEGEELDLKFGRSLQIGTGS
FT                   GFRKPSSSSTSSHHSAMRSNAPKTLPTASVPAITLISAPLPANKGESLSAALNVDPRLV
FT                   ISTGSGMTTSSRRQSSARGFRPTSTTRPRDVLTEVRPSNIETKPALEQDLKKDAGEVAR
FT                   GTRAVGVLQ"
FT   gene            complement(661503..664891)
FT                   /locus_tag="CNH01670"
FT   mRNA            complement(join(661503..661812,661870..661952,
FT                   662010..663175,663221..664891))
FT                   /locus_tag="CNH01670"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(661726..661812,661870..661952,
FT                   662010..663175,663221..664455))
FT                   /codon_start=1
FT                   /locus_tag="CNH01670"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN3"
FT                   /protein_id="AAW45250.1"
FT                   /translation="MDDDYGTGVPDARAPSGSHSYHCSHNRSYSEAPHDVAHSSATSSF
FT                   ASDQPLTAVLGHHPHHPPHSCSPVHIRHHAISTARVPHSRVSSAGHYGTHADEIAYAML
FT                   AVVIGRASASDLRTVIGKKRTRCGMIVQNERRPNIQTRRSSSVASVKRPHGSPTSQTSF
FT                   KLLTLDPRTLPTLPIPLPPVDHILDPPKDGDFFSSFIPPEKSGWYDSIPRSSSAPSVPF
FT                   LALERRGSNASLTSAMSVDTHLVAQKTFLNASQPHDHDAPRIIRYNPLEPLISSPETAT
FT                   FDHRAATPQTHQAMLDVRQSEPHGRYNTFELMAHDSAGVTSYLDPDLSATFRKRMAESS
FT                   SSRNNDGDARVMGPDTMGVSSDNAWVGESRSGKEVFSESEWTFEEPILKAMGDAVRGKI
FT                   EMIKEIDHYHVAEYGCHKETPNPIIAEVIESLCLRSTSKSPKVFSVTHQANPDFDTRAL
FT                   QYNLASQASSYRKIGKLPLAPSPLILTSFSFAGFTENALPADTVDFALCAGELSKLQGE
FT                   ISPRPFSAFASQADEKEKQAIKDLVDWLEAKSREVKKGGILVCWMVIRTRQPPESTSSC
FT                   DSLPHPPKASPYRAPASFPNSPNINLFTPHPHAPLTEIHPSILPHQNHHLTPSTQSTLP
FT                   TRYRTDIFQLISQALSPAIQSLVTLGEIRTHVAPALVDIPYWPRTLASVQAALGQAEDW
FT                   EVIIDRDEVNEDETGDNLEHMLDDMDVDSSSPISKDSEGFDVDKPLKASSRAKTAAESH
FT                   YPPEEVREWAQAGVRIHRLMHPAWKAFHQGRIDRQAYARRIATYCHSVYGPHLKKVLRE
FT                   KGRMDISQCENTVQEMFKILAEKCELGALSALAIDIGVIVLRRK"
FT   gene            complement(665315..667255)
FT                   /locus_tag="CNH01665"
FT   mRNA            complement(join(665315..666066,666124..666168,
FT                   666225..666276,666329..666444,666531..666581,
FT                   666630..667050,667207..667255))
FT                   /locus_tag="CNH01665"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(665368..666066,666124..666168,
FT                   666225..666276,666329..666444,666531..666581,
FT                   666630..666890))
FT                   /codon_start=1
FT                   /locus_tag="CNH01665"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M659"
FT                   /protein_id="ALO69525.1"
FT                   /translation="MANHHPLLSALPQPSPTTYGASLSVQTRAKNLLSMSSNTNTSPLK
FT                   RSKSTIPMPGARPKRLSTTSSLVKRGSIMMMGEFGGDGSGDENAGLKRMNDELNKTVAA
FT                   LRGRISELESAIDHGTGPEVERLTKEVSTLEDLLEETQRDNKAKHAESERQKQYVKDLE
FT                   NLLTELAGPHWRIHHGIVSPHAPTANNVTAPTPLPKPKPIHSLRHSVSFSNTRSGSKLH
FT                   HRTSSNLELAASSITLPGMALQSVKEVGEADNNTPTGALKRLCVNSSTELKGMGQDTRK
FT                   AKKELEDVVLVKTPKLNNDLTLVEKCAFSKATPCLKSCDVNHEKLGQILGILSSLDPGK
FT                   LLALNNAGPCAEPHGDEKAARMRKQESSMLRRMLDEQEKRLNEREGRLKWMVEMVRAEK
FT                   GKYDSRSC"
FT   gene            complement(667330..668706)
FT                   /locus_tag="CNH01660"
FT   mRNA            complement(join(667330..667578,667630..667707,
FT                   667763..668035,668088..668166,668214..668297,
FT                   668359..668706))
FT                   /locus_tag="CNH01660"
FT                   /product="small monomeric GTPase, putative"
FT   CDS_pept        complement(join(667519..667578,667630..667707,
FT                   667763..668035,668088..668166,668214..668297,
FT                   668359..668435))
FT                   /codon_start=1
FT                   /locus_tag="CNH01660"
FT                   /product="small monomeric GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45038"
FT                   /db_xref="GOA:Q5KCN2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR017231"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN2"
FT                   /protein_id="AAW45038.2"
FT                   /translation="MADQGYMSSGSGSGRASGGEGSDRNSIVLKVGMVGDSQIGKTSLM
FT                   VKYVEGSFDEDYIQTLGVNFMEKAISIRNTEITFSIWDLGGQREFVSMLPLVSNDAVAI
FT                   LFMFDLTRKSTLNSVKEWYRQARGFNKTAIPVLIGTKYDQFASFPRAEQEEITRQAKRF
FT                   SKAMHAPLIFCSTSHSINVQKIFKIVLAKAFDLKCVIPEIDAVGEPILLYVDV"
FT   gene            668880..671257
FT                   /locus_tag="CNH01650"
FT   mRNA            join(668880..669242,669298..669433,669483..669574,
FT                   669621..670435,670497..670994,671053..671257)
FT                   /locus_tag="CNH01650"
FT                   /product="expressed protein"
FT   CDS_pept        join(668897..669242,669298..669433,669483..669574,
FT                   669621..670435,670497..670994,671053..671196)
FT                   /codon_start=1
FT                   /locus_tag="CNH01650"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45037"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN1"
FT                   /protein_id="AAW45037.2"
FT                   /translation="MSLASHAASVVRSSTRRRTLIAAAHRTQRPLYRLAFLLPARTYAS
FT                   TVTARLDADPVPVIAASKRATPVEGATTILPVLQELIVLLENEIGGDGSWAKRVRRSME
FT                   DLAVKRRGRIAVVGDTAAAPRDVVSALLQDPLADSATTRQALVSRHQDANIDVFEISQG
FT                   ERLNREPQSLSLSSSWLQATGYDVVEVNIRNLETEPVISTLLSTDALIVVLDPIRLTST
FT                   PQLSPILPHLLARSPIHFVVNGHLPSGVSQSSIEHTLREQLKQITIEPLDDVHYDPAAL
FT                   KVSFVQAEKALMALEALSGGLSKAASSETKAEAFEVFQREFIQSHVGPLQSTLHQTLSN
FT                   RASPQLSTAKQVASLALMHISNVILSDRDVARAASHTVSKLRRAAHEGAAKAKHMSVAT
FT                   RGVDGALVEGEVKYEMEKIKRQIETSFQGRLSWLGLLGRLRVDDVALELGGFVGSRFAV
FT                   DLERQMVFESGQLSHLQSSLSSSSDQIIRQLSHTSTSPTQSFPHPHPFTSPLLANHLST
FT                   LSLSIPPLTPTTLLSPILTRRNQLVTQSIPRLQLSAQRALLTTYSTALLGASLSWAAYV
FT                   PPIEILSAGTAGGLGLLSIVGSLALGQKFWAGAQRKFWRDWNRVTGMLKGDLETRLDTV
FT                   LQTQVLAKPLAASEGLEKLIEKREQRLDALQNDVDKLKSRL"
FT   gene            complement(671239..674863)
FT                   /locus_tag="CNH01640"
FT   mRNA            complement(join(671239..672022,672080..672181,
FT                   672253..672551,672604..673581,673635..674409,
FT                   674459..674863))
FT                   /locus_tag="CNH01640"
FT                   /product="ATPase, putative"
FT   CDS_pept        complement(join(671316..672022,672080..672181,
FT                   672253..672551,672604..673581,673635..674409,
FT                   674459..674534))
FT                   /codon_start=1
FT                   /locus_tag="CNH01640"
FT                   /product="ATPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45036"
FT                   /db_xref="GOA:Q5KCN0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCN0"
FT                   /protein_id="AAW45036.2"
FT                   /translation="MEADVVRLDLVMGVALDGMAAPLGVFGPPALAHSLNPLYQAAPSP
FT                   FPNLRKESREADDQEEGMGLGFTSMPVAVLGGGGLPMPQMGHMGQQEEDFVAGRANEEW
FT                   IAFFSRIINAETAEAGKKRIVVLESPLAMSKTFPVWWPSLVEAVQRRRRGLITPGRKKM
FT                   IPKNGSAEPSLVHPTSIVLQCTPSPLLPHTSPSMFAPTEKEDHELAAEEHVEDVDEQEE
FT                   ATHAAISALEDKFRSMGFNVHHHVEVVKPRSGAKLWWGNEESDPAGRREGDQSRLKAIL
FT                   GKGLSSVLPPFDGQSSDSGNQSRNPLQRLLMSRMGHVNRSEQNESSGAPLVWKAFPIVP
FT                   LHRNFDAEKESRTLRRRIYSAALITRAVYQLGGELQDPLEILKLSESTGRPLTRKTGPS
FT                   SVSKGWGNAVVSWSDALHIASIAVGRAVQNGQVDGGGATVHWADIIAARQAAVEEKTMT
FT                   ADQISKHIPAALKRDGAGPAAKGAKKEEAQQVVDPVVENLRKDKKLSQHEKRLLNCIVD
FT                   PSKLASTTFRDVHLPEKTIDGIRSMISLPLLFPEAFRGGVLKDHATTGALLFGPPGTGK
FT                   TLLARAVAAESGARMLAIQPSDVNDMYVGEGEKLVKAVFSLARRLSPCVVFLDEVDALF
FT                   GARISRGSSGSMSHNLILTEFMQEMDGLSSAIANKDKRVVVIGATNRPFDLDDAVMRRL
FT                   PRRLLVDLPGVEDRKAILEILLRGEQLGEDVHLDQIAKETDGFSGSDLKHLCVSAALSA
FT                   VKDTVSVPWRHLSPSSVVSSSLGSEERPRTPLPGGDGRGRGGGGGGLGNEVLVMAPTEG
FT                   GGGGGGGRKKVRVKKEKASATASYGEESISSAAREESESPDEEQEQLGVGEVPEQVEEE
FT                   QLLSADRTRDASPSEDAPEPAKPPPIEEEQTVPKRVLMHKHFKTALEEIRPSASEEGSL
FT                   PELRKWAEQFGEGGKRRGKKSGFGKGFGFSDEPVRDRDTGYGKVRQDD"
FT   gene            675209..676319
FT                   /locus_tag="CNH01630"
FT   mRNA            join(675209..675293,675346..675579,675617..675664,
FT                   675715..675854,675912..676319)
FT                   /locus_tag="CNH01630"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(675245..675293,675346..675579,675617..675664,
FT                   675715..675854,675912..676133)
FT                   /codon_start=1
FT                   /locus_tag="CNH01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45035"
FT                   /db_xref="GOA:Q5KCM9"
FT                   /db_xref="InterPro:IPR013248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM9"
FT                   /protein_id="AAW45035.1"
FT                   /translation="MVWRTMLVTVSTSFLLGTTFTHWIADHNVLWRSPVTTEAISHSIK
FT                   YYSLLASAPNGLGWVYIAVGLVLLLSAGGRSIKGYRGSSGEVLFDGGSLVLVASIAYYQ
FT                   LSEVYPAVTMIPSPLPVNLVDHPLYPALTTAVSDLATGNIMTALMLTGLILLQAGRYYA
FT                   KRPTFPPTTTDESAASTPASASCPSSPETHPIPVSQRSATPFRELTEDEALELDASGGE
FT                   ESATRTTY"
FT   gene            complement(676249..677309)
FT                   /locus_tag="CNH01620"
FT   mRNA            complement(join(676249..676443,676508..676607,
FT                   676658..676742,676805..676990,677061..677309))
FT                   /locus_tag="CNH01620"
FT                   /product="imidazoleglycerol-phosphate dehydratase,
FT                   putative"
FT   CDS_pept        complement(join(676341..676443,676508..676607,
FT                   676658..676742,676805..676990,677061..677195))
FT                   /codon_start=1
FT                   /locus_tag="CNH01620"
FT                   /product="imidazoleglycerol-phosphate dehydratase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45034"
FT                   /db_xref="GOA:P0CO22"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="PDB:1RHY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CO22"
FT                   /protein_id="AAW45034.1"
FT                   /translation="MSERIASVERTTSETHISCTIDLDHIPGVTEQKINVSTGIGFLDH
FT                   MFTALAKHGGMSLQLQCKGDLHIDDHHTAEDCALALGEAFKKALGERKGIKRYGYAYAP
FT                   LDESLSRAVIDISSRPYFMCHLPFTREKVGDLSTEMVSHLLQSFAFAAGVTLHIDSIRG
FT                   ENNHHIAESAFKALALAIRMAISRTGGDDVPSTKGVLAL"
FT   gene            677466..680506
FT                   /locus_tag="CNH01610"
FT   mRNA            join(677466..678322,678374..678510,678562..678661,
FT                   678737..679096,679147..679345,679403..679530,
FT                   679583..679935,680009..680235,680295..680506)
FT                   /locus_tag="CNH01610"
FT                   /product="expressed protein"
FT   CDS_pept        join(677627..678322,678374..678510,678562..678661,
FT                   678737..679096,679147..679345,679403..679530,
FT                   679583..679935,680009..680235,680295..680416)
FT                   /codon_start=1
FT                   /locus_tag="CNH01610"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45277"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM7"
FT                   /protein_id="AAW45277.2"
FT                   /translation="MSTLPRPSATISSRNNPPSSDTIVASSPLAAVAPDRRLRFHSAEG
FT                   LGPMKRRKISPEMFEPAATGQTQSPVAGRRLNQQPPPQAACIPIAALLYHSAQVAHQTS
FT                   HVHLQQAFVPTEISTDRTSGYSIIKLYSYSSTPQSSQSNRFSHDPQAFAKALGLQLYAL
FT                   DLLRAGLNINSLSDKERVAFSLEFGVVGIKVYMAQQILQSKSKGKEKIQGVQVDCQRLM
FT                   DDMQDIVGQAFFIAQRQSSLTPMRLELELINARLAFMQKKFNLGKKLVQTALAASRDNA
FT                   VHRYSLCLLYLEYVESTGPADFLNIATEFLNEARKNNHQMIVQLALLIKARITFVHRRW
FT                   ELVPTALAEFASSIGWSDSNPPTDLLSGQKEERTWLACLNIHYLILRALWEGRIGNDSV
FT                   AKEIMKRAYALMDETADKKVFSELRANGGVITLHIPNSRPLQVQTTPPNILYMLTYLTT
FT                   VVGRRDFTGSNATCKSIVHPRVLRETEGVARTEDMWDSGFSSVHGLAQAMALRKQVISI
FT                   KGEVMIEQATAMIYRSCFAEGRQLLYETVEQLHDHNLFHPLSPHLCLTFAQHAHHLGLT
FT                   SSAIRYYKACRDLINSGSELSLIAQVGLLAVQNKLEGLEKNAEGQDEVNALAEKCKGSS
FT                   SAMFSAAGYFLASLTDDNRVNSKKKLSTAYEISQRSNNNILRLLIFAFTTSTHHYGGRE
FT                   RMLRQLETGRDISKMLGGKDRDDGVGQVVLGMWFARRLKEFYRQEGYQTGVQVAKESEK
FT                   SHFARLNDLMREAEKVAKGG"
FT   gene            complement(680468..681151)
FT                   /locus_tag="CNH01605"
FT   mRNA            complement(680468..681151)
FT                   /locus_tag="CNH01605"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(680565..681062)
FT                   /codon_start=1
FT                   /locus_tag="CNH01605"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M608"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M608"
FT                   /protein_id="ALO69526.1"
FT                   /translation="MSRLGSLPANLCAHLQNTSRSFHPRACIPYTNSALAISNILLRSG
FT                   LVSNISLGSPAGPDPASFNTLPVPAKKLWIGLKHRDGQPVLRRMNLVSKPSFRVVVSKE
FT                   ELGRLLVGKRARNVPGVGIGEILIVKTPEDRREGRSNAERYMEGWEAFRAGLGGEVICR
FT                   VA"
FT   gene            681308..682669
FT                   /locus_tag="CNH01600"
FT   mRNA            join(681308..681653,681707..681892,682268..682669)
FT                   /locus_tag="CNH01600"
FT                   /product="expressed protein"
FT   CDS_pept        join(681324..681653,681707..681892,682268..682621)
FT                   /codon_start=1
FT                   /locus_tag="CNH01600"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45278"
FT                   /db_xref="GOA:Q5KCM6"
FT                   /db_xref="InterPro:IPR021036"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM6"
FT                   /protein_id="AAW45278.2"
FT                   /translation="MSLLSFSNIAGPSRLPLQVTVTACRRAVAARFYATEAQEPQEPLA
FT                   AEQSEQSAPVDELSALTLDPSTPATRSGLEKREGRIFYRDWLRYEGEQFRVPQKGQKAK
FT                   WLGGNVPYPSNPSFRPPPPLSNHIQDQVFADLQRGQSVAELSVKYNISKARVEAIQKLK
FT                   EIETEYKRRSLPLQTAFLEGMEPLLGVRTPISPRTRQHDPALARELDLAHEAHPSTAAE
FT                   RLEEQRFDAGIGEEGAFGQRTRESTKPSIERTVWEFMDEESALLEKETQGQKTREKRQR
FT                   RKEREART"
FT   gene            682807..684987
FT                   /locus_tag="CNH01595"
FT   mRNA            join(682807..683800,683865..684073,684139..684205,
FT                   684259..684987)
FT                   /locus_tag="CNH01595"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(682881..683800,683865..684073,684139..684205,
FT                   684259..684946)
FT                   /codon_start=1
FT                   /locus_tag="CNH01595"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5V7"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5V7"
FT                   /protein_id="ALO69527.1"
FT                   /translation="MVAAYQPLPSSENTYPPPHSEPPRQSLRTLLPWPSSNPLPGPPYP
FT                   LRPTKSRLTPIHIIKYALAVTGGLIIFHYVVVGAFPNSKYTVKFREKFTGYKAWEADEA
FT                   YKAATASAEKVLSHLNPSAGQPGTFFRDSFPIKSMLAFWELAEKEVAAKGLDTCNDQLG
FT                   RGLVEGYHSSELAYCVPPGEGDAFEALNTLNMSASWDVASGEQVPATRISCNPVQDNDF
FT                   TNWWPYPAAPCVSTNLRTIPDESRKYRAVGCKITDKGVKLNVDMGREKFLGAQMESVDM
FT                   EDERAICKERIERTTVLIGRQDQWNPFHVAEDLITTLVTLFIAARTAPALVNSRVQLVF
FT                   TEGYSMDGNHFTPLWDRVGAWAPRRLSLDPWQEGECLTNAIHSVGAGASLLSAMGVGKS
FT                   YSCASTITWAASHYYRHLFGLLPPSVSSASTLSQTRRPINVLWLSRAKLDHYAKEHNDW
FT                   SSWRDVRHINNEKELVTRLKDGLRTMCDQPSSVFGTPGCVFEDARDTPESWTLSSPDSI
FT                   ESDDLPLPVRFAQMDPSVQTIENQVSMVGHATVLISSHGGALGLSLFLPPGSSAIVELQ
FT                   VGGVKGNYHFQHMAYEMGHQYEVLGIERTVDVDQVWESVQRWVEKIAAKGS"
FT   gene            complement(684976..686467)
FT                   /locus_tag="CNH01590"
FT   mRNA            complement(join(684976..685136,685190..685588,
FT                   685645..685841,685904..686175,686228..686467))
FT                   /locus_tag="CNH01590"
FT                   /product="phosphotyrosyl phosphatase activator, putative"
FT   CDS_pept        complement(join(685039..685136,685190..685588,
FT                   685645..685841,685904..686175,686228..686410))
FT                   /codon_start=1
FT                   /locus_tag="CNH01590"
FT                   /product="phosphotyrosyl phosphatase activator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01590"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45033"
FT                   /db_xref="GOA:P0CQ02"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="InterPro:IPR037218"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ02"
FT                   /protein_id="AAW45033.1"
FT                   /translation="MSAPESSPSTFYTVPTKHILSKAHLAAFQRSKTHSDIFNFIEELN
FT                   EDIVGKKLTEAGQGSERTRPLISILDSVREIAESTPPVDNKLSRFGNPAFKTFYDKVGD
FT                   ASLELHKRIPGLPEEAIQEVEVYFKESWGNKQRVDYGSGMELNFLSWLLCLAKLGVVTK
FT                   EDYPFLVLGVFWRYIEVMRYLQSTYWLEPAGSHGVWGLDDYHFLPFLWGSGQLRNHKYL
FT                   RPKAIHDPEILGEFSKDYMYLSCIEFINSIKTASLRWHSPMLDDISAVKTWEKVNQGMK
FT                   KMFVAEVLGKLPVMQHALFGSLLPFPTPEEDPELKRALEEEDGQSATDMHGHIHDPSEK
FT                   GWSMDCCGIPVPSAFAAAQDANSHKGVPTLGNRPGIKPIPFD"
FT   gene            686573..687825
FT                   /locus_tag="CNH01580"
FT   mRNA            join(686573..686666,686724..686823,686875..686890,
FT                   686950..687041,687095..687470,687533..687649,
FT                   687707..687825)
FT                   /locus_tag="CNH01580"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(686574..686666,686724..686823,686875..686890,
FT                   686950..687041,687095..687470,687533..687649,
FT                   687707..687785)
FT                   /codon_start=1
FT                   /locus_tag="CNH01580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45032"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM4"
FT                   /protein_id="AAW45032.2"
FT                   /translation="MVSFSSLLVLLKIIPLFVMSVAAYTDAVMLFGDSLTQAWSAGSFA
FT                   QRMSEFYLRRADVINRGFGGYNSEWAIPVFEQVFATKKDREQGGIQQVKLITIWLGAND
FT                   ACLPSSPQHVPLDKYKSNVKHIVNLIRDPSSPYHSQETRIVLISPPPIIETAWIESRLE
FT                   KWKSFGCEGPEPEQNRDAEVTKQYAEGCKEVGAELGVPVVDFWTAVVEAAGGEKDEQLA
FT                   PYFYDGLHLTSEGYAVLFKAVSGLILATYPELNPETMPMRMPHWADVDTENPRAAFEKV
FT                   KKGRLAGEL"
FT   gene            688066..690006
FT                   /locus_tag="CNH01575"
FT   mRNA            join(688066..689247,689324..689695,689786..690006)
FT                   /locus_tag="CNH01575"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(688081..689247,689324..689695,689786..689875)
FT                   /codon_start=1
FT                   /locus_tag="CNH01575"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5V8"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5V8"
FT                   /protein_id="ALO69528.1"
FT                   /translation="MMASPNAIPGPPPVPPLRSRSPLPPSPSPSLARSYTHGGQPARPL
FT                   PPPGAPSPLSINTNPFPAPPPPAQYSPFTPSQSSQPSAPVSAAVESDLDRSDTLSSVKS
FT                   LDRTSFSSPSSRRPLPKPPGGVNPSRSLDRGVAPSLAVGEGIVRRGAGRKQPSIVNEEC
FT                   EETLIGLPKSGNSSAGSHSPQAVPHPYLPQQPPAIIIPDVTTQKTIDTYTPAKCPQLPV
FT                   INIGDSDSSSAVSPDDEGNNMVSEATPKSKKVSALPVSPGIQFTGAPVIAVSSFDTADD
FT                   MLQGDEISFSVPMINIEGDFSASTKTLPRIASDSSRPPNPPRHQAHIHPNSAILCAGCQ
FT                   TPIIGRIVNAMNQRWHPHCFMCAECGELLEHVSSYEFEGKAYCHLDYHDKFAHHCHHCK
FT                   TPIVESRFITLDDEILGQRYYHELHFFCSECGDPFLDPSKSSAPGTEKGKQGGSDGQEE
FT                   DGETNEFVIHKGHPYCERCHLRLHKPKCKACTLPIPDIAINAMGAKWHKECFVCSRCHN
FT                   DFANNLFFPKDGTAICTICYEQVMS"
FT   gene            complement(689982..692418)
FT                   /locus_tag="CNH01570"
FT   mRNA            complement(join(689982..690412,690471..690533,
FT                   690582..690618,690673..690788,690838..690879,
FT                   690939..690994,691049..691159,691213..692418))
FT                   /locus_tag="CNH01570"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(690156..690412,690471..690533,
FT                   690582..690618,690673..690788,690838..690879,
FT                   690939..690994,691049..691159,691213..692237))
FT                   /codon_start=1
FT                   /locus_tag="CNH01570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45031"
FT                   /db_xref="GOA:Q5KCM3"
FT                   /db_xref="InterPro:IPR018535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM3"
FT                   /protein_id="AAW45031.1"
FT                   /translation="MPSQSPSPFPETSLGASSQPVDSANNLQWSSAPPPLPPRPPPGAH
FT                   RKPVPALRNDDLHGQPLQRHSMSPPPVPSRPAAGIAAPPATFTTAYNTAAQSTLPPQPP
FT                   PPRLIDEKNSSQPPPGKRRGCYPSTRRGRIWFWGLIALIILAIVIVVAVCASVIPKNNS
FT                   SSDTNSSSDTNSSSDTNSSPGKSYHGGHPLSIAEGGVDIGQPGDIAVFGKNSTDHFVMT
FT                   TNRSIVVTRLDPVVFPGSIGAHVHRVHGSSYFTQNLTSATEMQRLANCTTTVVQDDLSA
FT                   YWVAGLYYRYPNGSLASVRLDRTSLYYFQKAPTGVPIYPFPDNYNIIAGNPYRRAINYS
FT                   DPTHISKWFQCYRGGGNDLRTYGFPKSPCSDGLVQAIQFPSCWDGVYAEDGDYSTHVAY
FT                   PIDNTNGYYCPDDFPKKFITLQFETVFAVYDFPYNGNDQITWVLSNGDTSGYGIHADFM
FT                   NGWKPETLEAVLNDCRYMNATSEDPISDDPPNCPPLNKSINMDITHSCRLQTPIVNEEV
FT                   GEHSLLEYLPGCNALWSGNISKPACPSGHIDGGDLDLVSPSVWYREEPYIS"
FT   gene            692928..694920
FT                   /locus_tag="CNH01560"
FT   mRNA            join(692928..693363,693413..694250,694307..694453,
FT                   694515..694728,694783..694920)
FT                   /locus_tag="CNH01560"
FT                   /product="expressed protein"
FT   CDS_pept        join(693952..694250,694307..694453,694515..694728,
FT                   694783..694845)
FT                   /codon_start=1
FT                   /locus_tag="CNH01560"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45030"
FT                   /db_xref="InterPro:IPR021851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM2"
FT                   /protein_id="AAW45030.1"
FT                   /translation="MSFSYYPILGLVALAPIFVLSLPFGLDSYFHSPNLFASSLNIART
FT                   LPQSCSVSNIPVPLGDQTTLSVSDDEVSSMIAVGRGIQNYTCTSGAYVSTGALANLFDV
FT                   TCLYALTAGNFDPSFVNSMLPKMTFVALDYPNTDDLHVAIHHLFVDTPGSTSVGSISPE
FT                   FLTETDRVLASKAATLDDPYNPAINVPWLKLASVEGQGTYAKSIFRINTFQGQPPSSCT
FT                   TENEKISVQYASMYWFTK"
FT   gene            complement(694233..696547)
FT                   /locus_tag="CNH01550"
FT   mRNA            complement(join(694233..695723,695765..696025,
FT                   696077..696300,696342..696547))
FT                   /locus_tag="CNH01550"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(694963..695723,695765..696025,
FT                   696077..696300,696342..696424))
FT                   /codon_start=1
FT                   /locus_tag="CNH01550"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45248"
FT                   /db_xref="GOA:Q5KCM1"
FT                   /db_xref="InterPro:IPR018791"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCM1"
FT                   /protein_id="AAW45248.1"
FT                   /translation="MQDTSPINCNCCQVNQKALYCPACLREGITLHKELLQNLQARLST
FT                   IRQHSQKLLTGTENETKDKADRGLNAWRELRSDVASSEARCHQIKMTISQRQAAISACR
FT                   KRIAENNIRDRRESLSMLKSRPSPVSSLRDSIKQVHSQQQVITSRIIHARRVLVREAVN
FT                   VFGVRQRPSGDWEIAGIPLPDPETFRVHPSSSINAALSHVIHLVSLITTYLSISLPFVP
FT                   MPPPPFYHPHVGRPLMKANLPFVSTTKWREKHVLWMSSTASVSSKIKPQSTPPISNLLA
FT                   QPSICSIIAKSTSKHKQFLVSFALLSFSIAYLAWSQDVPGIGIRGEVDGDDNAGVLFDE
FT                   ESKVTQGQSVSAESSVTETALISPASILRLIHAITQSPTLGHRSHDPGGARTLKHMGFG
FT                   LDVSKLVSTILRAEELQWDLKGDTEAGDDILSEGWDLLDSGAP"
FT   gene            696726..698203
FT                   /locus_tag="CNH01545"
FT   mRNA            join(696726..697011,697059..697119,697191..697211,
FT                   697250..697412,697460..697815,697854..697983,
FT                   698037..698203)
FT                   /locus_tag="CNH01545"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(696882..697011,697059..697119,697191..697211,
FT                   697250..697412,697460..697815,697854..697983,
FT                   698037..698069)
FT                   /codon_start=1
FT                   /locus_tag="CNH01545"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M685"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035522"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M685"
FT                   /protein_id="ALO69529.1"
FT                   /translation="MLGGGSFDPGYVMRHPVFLVTFIIAVPSWIIAFAGQCAAEAKYST
FT                   SNGRAPVAGTLWFNIWLQLLVIIQLFLAISSDDLALHRFQLSIFLAIATTLAVGGVQFI
FT                   FETPGAYIATGVGWLLLTMVNLVWIVYLTSEEDTFLYNILNSGGNGGLSNHNRRIGTTV
FT                   QRRDSTPGYGGGEMGLGNSIGAMPRGISSNTVNSGGYGGGYAPAAMDGTPQKMTSVREE
FT                   YNHTGVQSPGIDESVPRLQRAKALYAYSASPDDPNEVSFMKGEILEVVDATGKWFQVRT
FT                   PAGITGIAPSNYLVLL"
FT   gene            complement(698151..700481)
FT                   /locus_tag="CNH01540"
FT   mRNA            complement(join(698151..700159,700212..700481))
FT                   /locus_tag="CNH01540"
FT                   /product="intra-Golgi transport-related protein, putative"
FT   CDS_pept        complement(join(698445..700159,700212..700272))
FT                   /codon_start=1
FT                   /locus_tag="CNH01540"
FT                   /product="intra-Golgi transport-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45029"
FT                   /db_xref="GOA:Q5KCL9"
FT                   /db_xref="InterPro:IPR007255"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL9"
FT                   /protein_id="AAW45029.1"
FT                   /translation="MSQPSVSTDSAQAWNGPLLDGDHQSLTALLQPLTSVDVSSSSASS
FT                   YLDHLQSLPLPELLRQPSLISIETSTVESDLTNLCFREYPTFISVHKCSSAVKSAFDDF
FT                   SDSLEKLIGSVPALEDECQTFSSSTSKIQRIRNKASLVQEHQDKLLDLLEIPQLMETCV
FT                   RNGYYQEAMELLDHSRTISQRYKDVVLVQDVVREVEGVLQLMLTQLLSLLREPIKLPPL
FT                   IKTVTFLRRLHALDENELALVFISSRYRNFRAQLAYIERDKADPVRYLRRYVDLFREHV
FT                   YDLIAQFTTIFLDSPSTATHIASFASQAVSELVNLVQTYVPQLSTDAASMSSILIQLGY
FT                   CAMSFTRVGLDFAPLIAEPFAATSFSAFSHEISTASKELQELLEESSKLLRPPSQILIT
FT                   ADHLSRVLTAETSPPNLPASIDAVRSFPPLAALVNAHLNALNSLRLLAPLSLRSQIYTF
FT                   HSTSLASDSVTLLQYFFLRSEESVDRLQGGNRERSSHTRTPSAPRVDLLRRNSEVQMTP
FT                   EARATKKKTAKRTCIAAADMWCNIVVPFLVERLAQGVFGDQNAPIHPELSREIENISKW
FT                   IKENGENGHTARLVL"
FT   gene            700693..703080
FT                   /locus_tag="CNH01530"
FT   mRNA            join(700693..700906,700951..701042,701079..701203,
FT                   701242..701570,701617..701811,701848..702212,
FT                   702267..702460,702500..702593,702632..702870,
FT                   702927..703080)
FT                   /locus_tag="CNH01530"
FT                   /product="dihydroxy-acid dehydratase, putative"
FT   CDS_pept        join(700763..700906,700951..701042,701079..701203,
FT                   701242..701570,701617..701811,701848..702212,
FT                   702267..702460,702500..702593,702632..702870,
FT                   702927..702940)
FT                   /codon_start=1
FT                   /locus_tag="CNH01530"
FT                   /product="dihydroxy-acid dehydratase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45028"
FT                   /db_xref="GOA:Q5KCL8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL8"
FT                   /protein_id="AAW45028.1"
FT                   /translation="MLSRRIATASPAAHTRAFHASAAKASKEVIMNRYSRTITQPKAQG
FT                   ASQAMLYATEGIVNDEDFNKAMVGVASVWYEGNPCNRHILGLGQRVKKSLMNAGIVGYQ
FT                   FGTVGVSDGISMGTSGMSYSLQSRDLIADSVETAAGGHWLDGMVVLPGCDKNMPGALIA
FT                   LGRLNRPSMMVYGGTIRPGSCGGEVLDIVSAFQSYGRYLQEGQTPEAEKTRYNTIRNAC
FT                   PGPGACGGMYTANTIASASEALGMTLPGSSSFPAEYPEKHAECDAVGETMRKVLEDNLL
FT                   PRQIMTRQAFENAMALTMALGGSTNVVLHLIAIARSVGINLTIDDFQTVSDRVPLLADL
FT                   KPSGKYVMEDINTIGGTPSVIHYLIKNGIMTGDEMTITGKTLGENCDRWVEEHGSKWEG
FT                   QKILRPINDPLKSTGHIRILRGNLAPGGAVSKITGKEGLRFTGKCRAFDDEEGFVKAVE
FT                   SGSIKKGEKTVVVLRYLGPKGGPGMPEMLKPTSLIMGAGLGYDVACLTDGRFSGGSHGF
FT                   VVGHVVPEAQVGGPIALVQDGDVIHIDAVANTLSVDVSDEEMARRKENWVAPPLKVTHG
FT                   TLLKYARAVTDASHGCVTDA"
FT   gene            703642..706110
FT                   /locus_tag="CNH01520"
FT   mRNA            join(703642..703788,703859..703995,704044..704201,
FT                   704257..704402,704443..704707,704761..704833,
FT                   704884..705304,705357..706110)
FT                   /locus_tag="CNH01520"
FT                   /product="2-isopropylmalate synthase, putative"
FT   CDS_pept        join(703778..703788,703859..703995,704044..704201,
FT                   704257..704402,704443..704707,704761..704833,
FT                   704884..705304,705357..706065)
FT                   /codon_start=1
FT                   /locus_tag="CNH01520"
FT                   /product="2-isopropylmalate synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45027"
FT                   /db_xref="GOA:Q5KCL7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL7"
FT                   /protein_id="AAW45027.1"
FT                   /translation="MPMLSDPSKRYLPFQPVPFPNRTWPDKTHKKAPIWLSTDLRDGNQ
FT                   SLANPMTNQQKLRFFRHLVQLGFKEIEVAYPAASETDYNFVRELIDRKEVPDDVWIQVL
FT                   TPARADLIKRTFEAVAGLKHVIVHMYNATSCLFREVVFNNDRDETIKLAMDHTILIRQL
FT                   AEKYAESHGTSFRYEYSPETFSQTETPYAVEVCEAVKKAWLGGHGSVWADGRKEERIIF
FT                   NLPATVEVATPNCFADQVEIFCNSISEREKCIISLHTHNDRGCAVAAAELGVLAGADRI
FT                   EGTVLGNGERTGNVDLVTLALNCYSQGISPNLDFSDMFSVIDTVTECTGLPVHPRHPYA
FT                   GELVFTAFSGSHQDAIKKGFEAQAKRDHAGDQVWSMPYLPIDPADVGCTYEAVIRVNSQ
FT                   SGKGGIAYIVKSALSLDLPRRMQIAFYKVVQECSEATGREMTSKDITTAFRQTYHLGGS
FT                   IYDGRLVLKSFVTVDLFSSQTPSVAGTPDLSPIRSRSQTRMPPLSLSSSVAEPSPDRSL
FT                   DRNLPSMSKRLTAKVLVDGKLHEIVGEGNGPLSSFLNALESDLGIVLSVREYTEHAVGA
FT                   GSDVKAATYVELIPANVDAKDKTQGGFWGVGVDADITASGLKAVVSAANGFLGQGPIPS
FT                   QNSI"
FT   gene            708426..709817
FT                   /pseudo
FT                   /locus_tag="CNH01510"
FT   gene            complement(712568..713982)
FT                   /locus_tag="CNH01500"
FT   mRNA            complement(join(712568..712909,712968..713491,
FT                   713562..713982))
FT                   /locus_tag="CNH01500"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(712568..712909,712968..713491,
FT                   713562..713982))
FT                   /codon_start=1
FT                   /locus_tag="CNH01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45247"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL6"
FT                   /protein_id="AAW45247.1"
FT                   /translation="MPRRSAKYKATARARELYRMATILNHKQLKTSLSIPYHALRTSRY
FT                   LNRPKKYGQLRSRDAVARITSIHEIPDEDFRRKLHVNHTEFRKLLCLIKDHPVFVSHGP
FT                   RKQANPLLQLTVALYRLGHCGCAASTFEIGEQFGVSEGTSAIWTTRVIKAILSLERNNV
FT                   YWPDENERKAIDRHFEEEEDIPDGCVGIIDGFHVPFAYKPARHDAVDFFSYKGRYGFNI
FT                   LGICDHLKRIRYFQYGYPASAHDARIFKNCSLFEEANADAQSNREAMLQGRAVHSEMIS
FT                   QGEYLLADSAFPAGDWCVPLFKRRRGQNDLDRPEAKFNKKCSSARVKIEHAYGILKNRW
FT                   QSLRSLRVKICNVRDEGVATCWIQACVVLHNLLIDTGDWYNQLDGDADEPDDYIDIERM
FT                   QERMERVLERHREEEEDEARDARDASNLT"
FT   gene            715390..728037
FT                   /pseudo
FT                   /locus_tag="CNH01490"
FT   gene            complement(733171..745296)
FT                   /pseudo
FT                   /locus_tag="CNH01480"
FT   gene            complement(745447..747153)
FT                   /pseudo
FT                   /locus_tag="CNH01470"
FT   gene            747154..749550
FT                   /pseudo
FT                   /locus_tag="CNH01460"
FT   gene            complement(751522..754707)
FT                   /pseudo
FT                   /locus_tag="CNH01450"
FT   gene            complement(760912..765093)
FT                   /locus_tag="CNH01440"
FT   mRNA            complement(join(760912..761009,761067..761273,
FT                   761328..761383,761438..761501,761551..762010,
FT                   762062..762236,762292..762398,762458..762534,
FT                   762588..762633,762689..762779,762825..763064,
FT                   763120..763273,763312..763420,763471..763625,
FT                   763669..763764,763804..764144,764186..764541,
FT                   764603..764675,764714..764828,764888..765093))
FT                   /locus_tag="CNH01440"
FT                   /product="MMS2, putative"
FT   CDS_pept        complement(join(761098..761273,761328..761383,
FT                   761438..761501,761551..762010,762062..762236,
FT                   762292..762398,762458..762534,762588..762633,
FT                   762689..762779,762825..763064,763120..763273,
FT                   763312..763420,763471..763625,763669..763764,
FT                   763804..764144,764186..764541,764603..764675,
FT                   764714..764828,764888..764993))
FT                   /codon_start=1
FT                   /locus_tag="CNH01440"
FT                   /product="MMS2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45026"
FT                   /db_xref="GOA:Q5KCL5"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL5"
FT                   /protein_id="AAW45026.2"
FT                   /translation="MATDIRLLVHSVVYPTSHEQYTRDQQALSDLFKEPEFLISLQTLA
FT                   ADKTLSQPERLMASLITGREMKTKWRSKAITPETRKPEVRRRLFSFLEEEDFAIARPQL
FT                   SLLVAVARIEYPKTWQNLPELFLEPLLSTLPHLANPSSLTPAASTLLINVLWTINALVK
FT                   EWRTVRIAQGATVMQTLEQLFTEPLRKILDIWGESERNGGGYLPLEEAGRYAFKILARF
FT                   CQWHWSKAKPMQTEEAILRIQYLVGHSVTHASVIQSNRLRLIATKVPSEKTLRSITKHL
FT                   RAIGKWWRAMIALDPKGFCKIDGTTAGIGWWWGEVGGVVAGTDGAISNDDSDDSPYPKR
FT                   FLLLGLLLFKDILPILAADHHDIFTPEFILSAFHLLVDKLLPLTSTDLEALEDEPEEWL
FT                   IGESTDAEAWAFEFRPCAERVLIALNNACRNVPRENKVIEPAMLKLLSETQLIPPDNLP
FT                   SVLRHESVYCALGRLSRSMASYGGVNFESLLTGMGPWISQGKPLHRIVKRRVAWLIGEW
FT                   MSGDEESAKLHIVWQLLLHLLSERGDASDRAVNLAAAVAIKECVDLWELPIDYFLPFLE
FT                   QTVQGLIKLLGEASTLDGKRYVNDTVGVVIERVGDKIMPYLPTLAQSVPVLWHGAIGLE
FT                   GEWLFKASLVVLTTKLVSAAKESSGGLMELVIPLIEESLQPPAKEFFEEDGLILWQTAL
FT                   YNSASPYQPSPETGLIRILPGLLLVLGSNLDLLPKLLSLLDSYLLLDPVGISQAHGQAI
FT                   ASNLAMALSTSTGNESAVIRILATVSLWTRIAPLPVISSLLLQAGIFHHITTALEDDKA
FT                   SGLVLAAYLEILSRIAMNNPNIFLQMVEESAKIQSQDVHKLLEEILDAVWRNFDYVGET
FT                   RLRKVVAMGVGNLLLTGNQQVMERLDGDFMNIFLDVLGEVQQSEGSLSVQETGLAPWID
FT                   DNSTLWTEIENTPEGQRRLSLEDNDPAYTVSLKDFILQLLNQASSVGLNPYWEKADAGT
FT                   KRSLEKFLN"
FT   gene            765245..767056
FT                   /locus_tag="CNH01430"
FT   mRNA            join(765245..765393,765431..765538,765581..765849,
FT                   765891..765985,766035..766093,766147..766237,
FT                   766287..767056)
FT                   /locus_tag="CNH01430"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(765322..765393,765431..765538,765581..765849,
FT                   765891..765985,766035..766093,766147..766237,
FT                   766287..766894)
FT                   /codon_start=1
FT                   /locus_tag="CNH01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45025"
FT                   /db_xref="GOA:P0CS08"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS08"
FT                   /protein_id="AAW45025.1"
FT                   /translation="MDIRKPMFHSRVHIEAGDIVILYMARDNMTAITITPGETFHNKYG
FT                   RYPHDMLIGQKYGSKIHSPPPHPGYVHVLRPTPELWTLSLPHRTQILYLPDISYITMRL
FT                   GVRVGGKVIEAGTGSGSMTHSLSRSVGPSGQVMSFEYHRQRFETALKEFESHGLTNVRL
FT                   QHRNVCKEGFGDAQGVEGVFLDLPAPWEAIPHAVKALRRDIITRICCFSPCLEQVLKTV
FT                   TCLRSEGFSDISTQEVLIRTHELVTPPPNTTYLSSISSVVSYLREHEQRKEERRLLQIK
FT                   TAKENNRKVKGIEADDAIPVEGETGSKRKLEQPSVTGSDNAAPANSRPKTNLLWTEPPN
FT                   TLPSTVLTKPSPEMKGHTSYLTFAILYPESVRLSMVAQETSSRVETPTNITKAPETHSQ
FT                   ETHYSEGSEIEKIGAMTSKEMDDWMKSGSTSLSI"
FT   gene            767245..770109
FT                   /locus_tag="CNH01420"
FT   mRNA            join(767245..767842,767898..768160,768214..768223,
FT                   768261..768476,768535..768685,768742..768874,
FT                   768933..769032,769082..769218,769265..769288,
FT                   769346..770109)
FT                   /locus_tag="CNH01420"
FT                   /product="Ser/Thr protein kinase, putative"
FT   CDS_pept        join(767324..767842,767898..768160,768214..768223,
FT                   768261..768476,768535..768685,768742..768874,
FT                   768933..769032,769082..769218,769265..769288,
FT                   769346..769745)
FT                   /codon_start=1
FT                   /locus_tag="CNH01420"
FT                   /product="Ser/Thr protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45024"
FT                   /db_xref="GOA:Q5KCL3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL3"
FT                   /protein_id="AAW45024.2"
FT                   /translation="MDRDSPSSLPSTLLEPPPPATIISPPSPTKDQTVTEDTSPSQLEM
FT                   ISSQASSTIESPDSLPQPTTDSPPSISTPLPVSASPAFLRPTSPPFASPSVFTTVRSPS
FT                   PSSPSLRPKGTHHRRTSSAHRVRETIDGTQTANEDGERMINQYKIGMSLGQGAYAKVEL
FT                   GVDINTGLKYAIKEFSKSRLHHQSLQEKHRASMRSKLRKGRERKAMSGDKGESQERPPQ
FT                   PMEKEEMSGALDNTQSGDEKMEDPLGLIRREIAVMKKLDHPNLVHLYEAISVSTADALF
FT                   LVLEYMPGGTLMKVKVGQDDSNAQPTFDREQTREYFRQLCLGLEYLHANEIVHRDIKPE
FT                   NILLSADRQLVKLCDFGVSEMFTKTGDDRIQKSGGSPAFQSPESFQPSGELHGKAVDIW
FT                   ALGVTLYCMLTGTLPFNYPNIIELYAAVVERSPRIPEDWDASLRDLMERMLCKDPALRI
FT                   DMSSLREHPWTTDETRLPMIDTEENLYEVGKQVEEPTQDEIKDAIVTFRGILYVMRAVH
FT                   KMRRLHLHRSSPSRGATSSPGDSANVSFASESMDSYVSRDPLTSTTSLSSDGEDGPFKD
FT                   IAGNKVTSPRQMSLASPADTEKPDATPFMSFGDIEPIKTDVQENVDGVVLVDSPTSENE
FT                   DAETEKLGSGSSRDL"
FT   gene            complement(769855..770703)
FT                   /locus_tag="CNH01410"
FT   mRNA            complement(join(769855..769990,770050..770110,
FT                   770179..770303,770352..770422,770478..770703))
FT                   /locus_tag="CNH01410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(769922..769990,770050..770110,
FT                   770179..770303,770352..770422,770478..770553))
FT                   /codon_start=1
FT                   /locus_tag="CNH01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45023"
FT                   /db_xref="GOA:Q5KCL2"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL2"
FT                   /protein_id="AAW45023.2"
FT                   /translation="MSDTKIAALQAQLQSSTISFQKIENELASVIEARQRLDSQLSENE
FT                   LVLKELNLLKSHNTVYKLIGPALVPQVSSEAKVNVEKRLEFIRSEIKRVESQLKEVEDK
FT                   AGRKKEEIIVLQQQFQALQAPSAPQQSKA"
FT   gene            770855..772348
FT                   /locus_tag="CNH01405"
FT   mRNA            join(770855..771636,771695..772348)
FT                   /locus_tag="CNH01405"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(770978..771636,771695..772259)
FT                   /codon_start=1
FT                   /locus_tag="CNH01405"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M606"
FT                   /protein_id="ALO69530.1"
FT                   /translation="MPPPGVGPNKRPAPITSSAFAFTLGTPKQKRPKASEQITSLPVNP
FT                   PPPPSPNYQQKARSESSDVTIQTPFRRRNEQCGTSSKETSGSKARTASPFINPTDHPIS
FT                   NMRQHFSPAPLDVARRTAGGSSKLQPVSLHTPSRKSQEPESASKPKSFRRVTDRLDQLP
FT                   AKREESAGTKVALQATRLSGKATVDLAARKRTILAEDEGEIGVSPNGKKITKWNGKGYT
FT                   PASVQLANLLSSSKASTHLFYTSMQNILNPSRRGPGRNRPPRYEGGMDITTPLQHIQRA
FT                   APIRLKPLSCIPGPTHHCEIFWCKVLKWSSSELIQARDQGEKVLLVLQPFTADAPRMGV
FT                   DPKLVAARMKDDNNIKNWLVGIWSCSEIQLPAYEHVMEEGRGVLADSAGEGNLWAVFGT
FT                   RYLIAEDD"
FT   gene            complement(772288..772975)
FT                   /locus_tag="CNH01403"
FT   mRNA            complement(join(772288..772426,772499..772593,
FT                   772647..772710,772760..772975))
FT                   /locus_tag="CNH01403"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(772409..772426,772499..772593,
FT                   772647..772710,772760..772813))
FT                   /codon_start=1
FT                   /locus_tag="CNH01403"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5W1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5W1"
FT                   /protein_id="ALO69531.1"
FT                   /translation="MWGGYWSPLQTMYGYHGAMMSPYYAGGLGIPYMMGMGGLGYGLGA
FT                   SMYGMGMGMPYPYGMTATNPYAYTGMYGIGY"
FT   gene            774116..777099
FT                   /locus_tag="CNH01400"
FT   mRNA            join(774116..774258,774345..774620,774674..774704,
FT                   774762..774806,774860..774942,774993..774999,
FT                   775059..775078,775137..775297,775346..775436,
FT                   775496..775512,775564..775586,775637..775725,
FT                   775781..775975,776051..776093,776140..776195,
FT                   776246..776403,776460..776676,776736..776859,
FT                   776926..777099)
FT                   /locus_tag="CNH01400"
FT                   /product="hexokinase, putative"
FT   mRNA            join(774116..774145,774233..774258,774345..774620,
FT                   774674..774704,774762..774806,774860..774942,
FT                   774993..774999,775059..775078,775137..775297,
FT                   775346..775436,775496..775512,775564..775586,
FT                   775637..775725,775781..775975,776051..776093,
FT                   776140..776195,776246..776403,776460..776676,
FT                   776736..776859,776926..777099)
FT                   /locus_tag="CNH01400"
FT                   /product="hexokinase, putative"
FT   CDS_pept        join(774354..774620,774674..774704,774762..774806,
FT                   774860..774942,774993..774999,775059..775078,
FT                   775137..775297,775346..775436,775496..775512,
FT                   775564..775586,775637..775725,775781..775975,
FT                   776051..776093,776140..776195,776246..776403,
FT                   776460..776676,776736..776859,776926..776972)
FT                   /codon_start=1
FT                   /locus_tag="CNH01400"
FT                   /product="hexokinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45021"
FT                   /db_xref="GOA:Q5KCL1"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL1"
FT                   /protein_id="AAW45021.1"
FT                   /translation="MSETPDQLATRVQNLSTAPTTTQRTGSGSAVLENGTNIGSAAGRK
FT                   ASIPAQVDPERIISTSGSGRTSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAGKKTMAD
FT                   LLRKYESLFTLTPQRMRMIVHAIEETLDNGLQKNGQVVPMIPTYVFGWPTGNEVGDFLA
FT                   LDLGGTNLRVCLVTLLGSGKFEVTQTKYRLTEEQKQGEGQALLDFCAECLNSFIRDTLG
FT                   RTEKDGILPLGFTFSYPCSQDRIDHGVLIRWTKGFGAPNIEGYDVAAMFKDSLKRMDVP
FT                   AELTALINDTTGTLIASNYVDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGLPEEQGM
FT                   AINCEWGAFDSFDHQHLPRTKYDIIIDESSNKPGEQSFEKMIAGLYLGEIFRLVLCELI
FT                   DSGDLFLGQNTYKLEKAYAFDTAFLSLMEADVTEELLTIIGVFAHFFGLETTLEERQFF
FT                   KKLAVLVGTRSARLSACGIAAIVSKKGYLEEGCAVGADGSLYNKYPNFADRVHEALTDI
FT                   FGESGKKIVTHHAEDGSGVGSAIIAAMTKARKDSGFFVEY"
FT   CDS_pept        join(774354..774620,774674..774704,774762..774806,
FT                   774860..774942,774993..774999,775059..775078,
FT                   775137..775297,775346..775436,775496..775512,
FT                   775564..775586,775637..775725,775781..775975,
FT                   776051..776093,776140..776195,776246..776403,
FT                   776460..776676,776736..776859,776926..776972)
FT                   /codon_start=1
FT                   /locus_tag="CNH01400"
FT                   /product="hexokinase, putative"
FT                   /db_xref="GOA:Q5KCL1"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL1"
FT                   /protein_id="ALO69532.1"
FT                   /translation="MSETPDQLATRVQNLSTAPTTTQRTGSGSAVLENGTNIGSAAGRK
FT                   ASIPAQVDPERIISTSGSGRTSRRGSGLVMTPGGVQTVYHTRTNEDIEFPHAGKKTMAD
FT                   LLRKYESLFTLTPQRMRMIVHAIEETLDNGLQKNGQVVPMIPTYVFGWPTGNEVGDFLA
FT                   LDLGGTNLRVCLVTLLGSGKFEVTQTKYRLTEEQKQGEGQALLDFCAECLNSFIRDTLG
FT                   RTEKDGILPLGFTFSYPCSQDRIDHGVLIRWTKGFGAPNIEGYDVAAMFKDSLKRMDVP
FT                   AELTALINDTTGTLIASNYVDPHTKIAVIFGTGCNAAYMETAGSIPKIDYVGLPEEQGM
FT                   AINCEWGAFDSFDHQHLPRTKYDIIIDESSNKPGEQSFEKMIAGLYLGEIFRLVLCELI
FT                   DSGDLFLGQNTYKLEKAYAFDTAFLSLMEADVTEELLTIIGVFAHFFGLETTLEERQFF
FT                   KKLAVLVGTRSARLSACGIAAIVSKKGYLEEGCAVGADGSLYNKYPNFADRVHEALTDI
FT                   FGESGKKIVTHHAEDGSGVGSAIIAAMTKARKDSGFFVEY"
FT   gene            complement(777077..781558)
FT                   /locus_tag="CNH01390"
FT   mRNA            complement(join(777077..777325,777377..777753,
FT                   777821..778152,778213..778429,778488..778579,
FT                   778649..778719,778770..779038,779091..779207,
FT                   779263..779387,779438..779508,779570..779954,
FT                   780002..780017,780068..780278,780329..780479,
FT                   780531..780553,780621..780626,780687..780714,
FT                   780773..780792,780926..781380,781429..781558))
FT                   /locus_tag="CNH01390"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(777270..777325,777377..777753,
FT                   777821..778152,778213..778429,778488..778579,
FT                   778649..778719,778770..779038,779091..779207,
FT                   779263..779387,779438..779508,779570..779954,
FT                   780002..780017,780068..780278,780329..780479,
FT                   780531..780553,780621..780626,780687..780714,
FT                   780773..780792,780926..781211))
FT                   /codon_start=1
FT                   /locus_tag="CNH01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45020"
FT                   /db_xref="GOA:Q5KCL0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCL0"
FT                   /protein_id="AAW45020.2"
FT                   /translation="MASVGHSPYTSKPSPLARTASQTPITPSNLTHASPSPIAPNFPFS
FT                   QPPTPMKRPFPPESQAGGPPERKFSVDSAQGDHGQQQPQKKKRVSLSCAQCAKRKQKCN
FT                   REFPCQHCVARKVPELCVPYNPQANNNVNGPDPQTAARLESIEAVLSVVVRHTGGITHY
FT                   DAIRDWISSLPFQKHLQSAPSTPASPHNLMTHGSVPGPSRAGSTYHLDPQETAHLERGG
FT                   SSDDDNLAKVGKGWLGEIDGGLPENMELNEKVKMKLDIHGTPAENLQRLITDCGVSPHK
FT                   IAELVQELPPKPFADRIIDWFFAKLNFIRYPIDERMFRASYEDLYNKSTALDPSNVRAL
FT                   PLVFIVLALAVRQAPEKWAGNEQTRRLSSLRMYWSSRRSILIATAVQSESLELVVSRLL
FT                   SAMYLVLIHDRRLTECWSQLGASLRTAQAIGLHRDGSKLGLDPFQTEYRRRLWSYLYHA
FT                   DKQYSLVLGRPPSISDSYTDTQTPSNIDLTDYDPALGLPPAKPFHEPTPALFLILRKKL
FT                   AVVIGKIVHHFQKLNEPAQYSDVEKLQQELDLFVEQLPPHFRMHDPDKSLDSVHFWLPV
FT                   HRFMLLTEVLVTTIILHRPWLLRKLSSNRYAASRTACFEAAKLDFQIRQDFERVPEFKL
FT                   FAITGQFKMFNSAMIAGISAIIDPRGPDSDQMRKILTTFLEDNPWHEVATKDATTRKEV
FT                   QIIQTLSRRAAKIFEDSFGPGEPAAHDKDSAALLLALRQSNDSSTHSNAYPRGVQPEDT
FT                   PNPGGSGVMQHKMMLPPRAWGPPPGVSFAPVHHGGINQSPASTGSHEDDHSQKLLDHWI
FT                   NANTSLAVGGSSSGGPLPVLDTSGMGYLPLPTMSGAMTPIGLPGGPALTPNPAFAGYGG
FT                   QAIMEEGGNNFMGHHLTGEFTYPNQFGMLAVEGNGVGVGNGRAGLDSGVENSDEYWNTL
FT                   IDGILGTTGGMSGPSQSGHA"
FT   gene            complement(782508..783891)
FT                   /locus_tag="CNH01380"
FT   mRNA            complement(join(782508..782837,782958..783140,
FT                   783210..783248,783312..783467,783529..783693,
FT                   783753..783891))
FT                   /locus_tag="CNH01380"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(782637..782837,782958..783140,
FT                   783210..783248,783312..783467,783529..783693,
FT                   783753..783764))
FT                   /codon_start=1
FT                   /locus_tag="CNH01380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45019"
FT                   /db_xref="GOA:Q5KCK9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK9"
FT                   /protein_id="AAW45019.2"
FT                   /translation="MNILDTLFGRSMTPAERLRQHQRSLQKAQRELEREKGKLEAQEKK
FT                   TMADIKRNAKAGNMNACKILAKDLVRTRRYIQKFTQMRVQLQAVSLRMQTLRSNEQMAT
FT                   AMKGATRAMGQMNRSLNLPQIQKIMNDFERESSTMDMKEEMMSDAVDDAMEDEEEGEGE
FT                   EVESDKILKEVLDEIGMNMNESLISAPTASPLVPEPLQASRVAVAEGLPSSAAAGGPTN
FT                   VGNGGVGAGSGMSSEEADLQRRLDALRRD"
FT   gene            784039..786632
FT                   /locus_tag="CNH01370"
FT   mRNA            join(784039..784248,784303..784328,784387..784500,
FT                   784552..784581,784637..784652,784702..784953,
FT                   785005..785024,785077..785194,785247..785330,
FT                   785379..785484,785541..785989,786043..786088,
FT                   786146..786316,786372..786632)
FT                   /locus_tag="CNH01370"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(784100..784248,784303..784328,784387..784500,
FT                   784552..784581,784637..784652,784702..784953,
FT                   785005..785024,785077..785194,785247..785330,
FT                   785379..785484,785541..785989,786043..786088,
FT                   786146..786316,786372..786503)
FT                   /codon_start=1
FT                   /locus_tag="CNH01370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45018"
FT                   /db_xref="GOA:Q5KCK8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK8"
FT                   /protein_id="AAW45018.1"
FT                   /translation="MRLPRLLSVTFSLSALLTTATATITDLDDDFQLRELTEDNFKSSV
FT                   SQGVWLVEHFSPKCAHCRAFAPTWTQLARDKRHLERLTGFHMAQINCLAQGDLCNSNGI
FT                   KFYPQIIMYTDGKPSPHYTGDRSYEELSKYIDEHAHTYAETILDPAVQSQEALVIGPAN
FT                   SEGKVQEVDERGLEALKAEGPVLVEYFAPWCGHCKALRPTYEQLALELQGQLNVAAVNC
FT                   DDHRALCVNSGIKAYPTIRLLHHGTSAEYSGARSLAKLKEFSQRAEKPASLTSIKAGDF
FT                   DKIVSANEAFFLYLQTFDTTVAEVDSVKKAFEPLLGTVPAYTSADVALYQRLHVVNPPT
FT                   STLFAFSSYSTRPVGTMGLPASPNDLRKFINLHRFPTLVRLDASNFQSLMRSDTRAIVV
FT                   LAGVHKGEEGKKERDKFADVARAWKRGGRRFEQPVWFVWVEGETSRWANWLKRFYGIKK
FT                   RDLPGVVVIDTPLEEYYDTTIEGTKIEFEGSSIFSVLEGFYQHFLRPKRIESTLEWGSR
FT                   SASETLISVGESAVEHPFLFLTVLVGTVALFVYLLQKCLVKDPKDGYSPSRLD"
FT   gene            786770..787573
FT                   /locus_tag="CNH01365"
FT   mRNA            786770..787573
FT                   /locus_tag="CNH01365"
FT                   /product="hypothetical protein"
FT   CDS_pept        786854..787522
FT                   /codon_start=1
FT                   /locus_tag="CNH01365"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X6"
FT                   /protein_id="ALO69533.1"
FT                   /translation="MPTLDPPSLTPLFNLPPSAPQIPKFISYLATSSTPSTPDIKSYPD
FT                   AIYHNYYDLGLSLCFLPEKGLDSVDIFNCDPNPPALKPGRTVTVYAPPPEVTIHFTSTT
FT                   LTLPPRDPKFKSTEPPESIARPPFITFTPTTTGRQLVSCLGEPSRKGSGGWTGVWLEWK
FT                   RVEFKVDGEGNKGEIGVMVELRDPGAAEMTEEVMKKGMGGVWERAAKWEWKSLKLFKPE
FT                   "
FT   gene            complement(787543..788684)
FT                   /locus_tag="CNH01360"
FT   mRNA            complement(join(787543..787856,787910..787968,
FT                   788020..788325,788377..788402,788457..788472,
FT                   788523..788562,788604..788684))
FT                   /locus_tag="CNH01360"
FT                   /product="proteasome subunit alpha type 5, putative"
FT   CDS_pept        complement(join(787586..787856,787910..787968,
FT                   788020..788325,788377..788402,788457..788472,
FT                   788523..788562,788604..788617))
FT                   /codon_start=1
FT                   /locus_tag="CNH01360"
FT                   /product="proteasome subunit alpha type 5, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45017"
FT                   /db_xref="GOA:Q5KCK7"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK7"
FT                   /protein_id="AAW45017.2"
FT                   /translation="MFMTRSEYDRGVNTFSPEGRLFQVEYAMEAIKLGSTTVGITTPHG
FT                   TVLAVEKRVPSPLLESSSIEKIMEIDSHIGCAMSGLTADARTMVEHARVTSQMHAFTYD
FT                   EPIGVESCTQAVCDLALRFGESVEDDDALMSRPFGVALLIAGIDEKGPQLYHTDPSGTF
FT                   VRYEAKAIGSGSEAAQQGLQDAYHKQMTLAEAQSLALKVLKQVMEEKLDESNVQLAQVT
FT                   KEKGFEILGEQALKGVIETLA"
FT   gene            788798..792237
FT                   /locus_tag="CNH01350"
FT   mRNA            join(788798..789966,790020..790234,790284..790396,
FT                   790449..790538,790604..790886,790950..791061,
FT                   791140..791208,791268..791367,791425..791587,
FT                   791650..791886,791972..792237)
FT                   /locus_tag="CNH01350"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(788861..789966,790020..790234,790284..790396,
FT                   790449..790538,790604..790886,790950..791061,
FT                   791140..791208,791268..791367,791425..791587,
FT                   791650..791886,791972..792108)
FT                   /codon_start=1
FT                   /locus_tag="CNH01350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45016"
FT                   /db_xref="InterPro:IPR002867"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK6"
FT                   /protein_id="AAW45016.2"
FT                   /translation="MRPPTVSHSDILHTAGTTKHKQRNPDNSNDSGSDASIQALEHPPV
FT                   VRGRKDAPIIIDDSDSEQDARRPAKRVRREDAHPTIPRPSARQAPPPHRNVSSHAQAHR
FT                   VHGSPSTAGPSEVFSAERPAQPVAGPPKRRLADQPEQPVAGPSRLYASTTVLSPPSIRR
FT                   TKSHDGKVHESPAKTPRDKRAKRAGSRAPVLSETVPSAHTPRSFSGPSQYAAPASSPAP
FT                   HGLPPVEYLDDEEELLAPPNHTPAPTSFPAAPVVLPPLDPAHSDVILRNVLEILPDLEP
FT                   EWASAEIAKYHASGHTDRLAEAIVDRALELKGGYPKMIEKAKEKKKEEKPDDGYKLNTY
FT                   RHAQRSGPQYYALATQYLEAEFSLIPTTYIRSTFVKTCGSLFTPAYYRLLADSQSNPKP
FT                   YIELQKPRKSKGISLMSGVRLAGDGGEMEFERELAWLEERLAKENAEKEEADRKQKIID
FT                   EAVANGHGIECGCCFGDEILENMFQCAEGHLFCKECTMRNAETKLGEQQITITCMDLSG
FT                   CEAPFPESELGRALSDKTFSLYHRLKQAKELELAAIEGLESCPSCPYSAIIENPDEKLF
FT                   RCMNEICGQVTCRKCRRKEHIPKTCEEMDKERNLDRRHAVEDAMSTALIRNCPKCTKPF
FT                   IKDSGCNKIVCTTCRTMSCYICRKIIKGYEHFDRQRPNYNAAPDKGKCRLWDSDANPDE
FT                   EAIRAARDAAAAEVMAAAAAEGDQVNAEELNVDMPEARPGHSAIGNRHLAIPANIPEAN
FT                   RLAALLPNDVDIQPILQLDARLRQLRQERADRANQIPAAQQHANVALNNYNGHIRQHEE
FT                   NIARMINAALARARPGAPIVPPAGPEFRPAVPVIPARAAADPAARIIAPLPARAARRGG
FT                   GRR"
FT   gene            complement(792210..793447)
FT                   /locus_tag="CNH01345"
FT   mRNA            complement(join(792210..792307,792371..793191,
FT                   793259..793447))
FT                   /locus_tag="CNH01345"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(792223..792307,792371..793137))
FT                   /codon_start=1
FT                   /locus_tag="CNH01345"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M640"
FT                   /protein_id="ALO69534.1"
FT                   /translation="MLLHTLSMSTDGFSPFDGVSSTTWPIILFNLNLPPEMRVHVEEVL
FT                   CAGLLPGDLQDLLFTSFPIPYTSRKNRLRPILFPLRSHDSFISQSRLIVTAPSRVWYKG
FT                   ASIFYKLPAIESTLSFPTDFMHLIFENVLQTLVSLFGGDVKGMEQDVFVIPKKKWEDLG
FT                   RATAACGASIPSCFGSRPPNFVENRQRCTADSWSFWLLYHASNLLDGCLPSAHYRHFAR
FT                   FSELVGECLQFEMPKERLPGLRRDFAEWVQDFEKLYYRNTQMGEIKLLASRFNVHDMHA
FT                   KQ"
FT   gene            793602..794694
FT                   /locus_tag="CNH01340"
FT   mRNA            join(793602..793981,794032..794364,794419..794694)
FT                   /locus_tag="CNH01340"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(793669..793981,794032..794364,794419..794618)
FT                   /codon_start=1
FT                   /locus_tag="CNH01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45015"
FT                   /db_xref="GOA:Q5KCK5"
FT                   /db_xref="InterPro:IPR012459"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK5"
FT                   /protein_id="AAW45015.1"
FT                   /translation="MSVPSLKSALKKPTKSFDTPPAGPSKLSVAAAVPEKSKAKAKQSV
FT                   SIAEKPQRLRGPDLESESEGNASGFEDESASEVEVDEDEEMNTDEEIEKAKEGKPKKST
FT                   KRKKAPTTAADFGATLTSLLADPLTKSNKKAKTADSTKKAAAAPILALSAHKLPTKASV
FT                   SLEAKAKRQLKAEKEEKEDRARVQNVLEGWSGDGVVGGQEFERNLRKTAQKGVVKLFNA
FT                   ILVASKNAEAAQTTLSEKARLKPEAAKKKEKDNILGRGGKEDVLTKESFLEMVRKGSSK
FT                   "
FT   gene            complement(794673..797099)
FT                   /locus_tag="CNH01330"
FT   mRNA            complement(join(794673..794904,794949..794995,
FT                   795050..795104,795154..795315,795367..795431,
FT                   795480..795551,795591..795761,795817..795870,
FT                   795924..795978,796030..796096,796144..796217,
FT                   796262..796495,796547..797099))
FT                   /locus_tag="CNH01330"
FT                   /product="endodeoxyribonuclease, putative"
FT   CDS_pept        complement(join(794724..794904,794949..794995,
FT                   795050..795104,795154..795315,795367..795431,
FT                   795480..795551,795591..795761,795817..795870,
FT                   795924..795978,796030..796096,796144..796217,
FT                   796262..796495,796547..797040))
FT                   /codon_start=1
FT                   /locus_tag="CNH01330"
FT                   /product="endodeoxyribonuclease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45014"
FT                   /db_xref="GOA:Q5KCK4"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK4"
FT                   /protein_id="AAW45014.2"
FT                   /translation="MLRTMPSLAQSSPTHQSFSALPSPSYSGSPAHHMDKEDKDILLVE
FT                   GKNSCHRIDLSGSSEDSGRDTIQVDDDSGDEDDLVWALIADDLNSDASTHDIEDRNEEA
FT                   QEALFEQLIRRTEAMRNPATQTASLQTQFEVSDDDENDFVIDEPYSESLIEDGIQVSDE
FT                   GRENALKFLQSIVLSFLEQISTSLGTIFSHETSKVHKKELKGLKRRKIYAAEAEQKKET
FT                   DQCLETGKIGVTISLKNRKSGSYQAIMLPDSPLQSPDRQSSIMRMTCIMRVASTLYEAI
FT                   LDRNVITLRDVYYRDKQLFERQPVVDKIVDDLVATAGLRRRDFYVCASAKGLIASSSLV
FT                   IRYRTGDEIILSATRANLVDPAEKIDVIEAPNGLDWVLIVEKDAIFQSLCGAGILQDER
FT                   IGHGVLITGKGFPDLATRQILRLIADTFPCVKMYALVDADPHGLKILSTYMYGSKANAY
FT                   STDYGDLPLGDRVQWLGLRASHWSDLHISYDHLIPLEQSDIQMAMSMLRDHQTLPVEWK
FT                   RELSHMLHLHRKAEIEIIIASSWSSDHVGSNGSGDREGDRQPLPDVERLINYIVKNMGF
FT                   "
FT   gene            797328..800010
FT                   /locus_tag="CNH01320"
FT   mRNA            join(797328..798062,798116..798239,798292..798722,
FT                   798777..799156,799211..800010)
FT                   /locus_tag="CNH01320"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(797373..798062,798116..798239,798292..798722,
FT                   798777..799156,799211..799835)
FT                   /codon_start=1
FT                   /locus_tag="CNH01320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45013"
FT                   /db_xref="GOA:Q5KCK3"
FT                   /db_xref="InterPro:IPR005343"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK3"
FT                   /protein_id="AAW45013.1"
FT                   /translation="MGKSTKAFKKFASSGKLKDTIQKRRQHQQAKRKSDDIKTQRAKQR
FT                   GAAHDPEDESEGEGSEGEDEEDEKEAKRIGKPNAGGKAGGVAKTVEDLFGAGGLDVEDD
FT                   EESELEELGSEDEDEEDDGDDEEDEGEGDLLDEEAMKKAMKDLAKNDPEFFKYLKENDE
FT                   DLLDFGQSSKANKGKGKQDEDDEDDEDEEMESDEDLLEEDEEEEEAERKRITVTLKMLR
FT                   QWQEGMLRQHSIRSLRKTLIAFRAAAHMNEDDGDQGSGLDTKYIIDSAQVFNKIVVTAL
FT                   KFTPVVISHHFPYKTLPSGKVKLQPPKKTNQTLNRLILSHFSTLLHLIKSLPTTPSSVA
FT                   SKKDEGASGLLLTAVGESTKLIPWVLSARKHLRAYLKVLLDLWSSAGDDVRIASFLAVR
FT                   KLFVAGDDAVKDLCLRNIYRSLLPPLRNTTPHTLPSLNLMKNTASELYQLAPSLSYQHA
FT                   FGFIRMLAVHLRNVVRSSTTGKAGDNQQAFKTVYNWQYVHCIDFWSQVLAGAASVENQK
FT                   ANAGLESPLKPLVYPLVQIALGAVRLLPSSRYFPLRFHILHSLLRIISRTGTYIPLAPF
FT                   LLEILDSTEFRRANPKKGTIKPLDFEYIIRAPAAYPKTRVFQEGLGEELVFLLGEYHAA
FT                   VSTQIAFPEMVLPVILTIKKHIKKGSAGSPKVVSSLKVLVEKLEATRTFIENKRRNVSF
FT                   APRDRAEVDRFLEGQGPEVTPVGNWMRLQRKIRDQKRSEVEKALREEQDEDEDSE"
FT   gene            800502..805497
FT                   /locus_tag="CNH01310"
FT   mRNA            join(800502..800620,800728..801291,801346..801842,
FT                   801897..801955,802010..802038,802089..802170,
FT                   802219..802292,802346..802526,802587..802606,
FT                   802742..802750,802798..802886,802944..802994,
FT                   803059..803161,803217..803305,803365..803443,
FT                   803497..803573,803624..803941,803997..804040,
FT                   804099..804153,804206..804318,804380..804508,
FT                   804561..804958,805017..805497)
FT                   /locus_tag="CNH01310"
FT                   /product="alpha-glucosidase precursor, putative"
FT   CDS_pept        join(801126..801291,801346..801842,801897..801955,
FT                   802010..802038,802089..802170,802219..802292,
FT                   802346..802526,802587..802606,802742..802750,
FT                   802798..802886,802944..802994,803059..803161,
FT                   803217..803305,803365..803443,803497..803573,
FT                   803624..803941,803997..804040,804099..804153,
FT                   804206..804318,804380..804508,804561..804958,
FT                   805017..805270)
FT                   /codon_start=1
FT                   /locus_tag="CNH01310"
FT                   /product="alpha-glucosidase precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01310"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45012"
FT                   /db_xref="GOA:Q5KCK2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR030459"
FT                   /db_xref="InterPro:IPR031727"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK2"
FT                   /protein_id="AAW45012.1"
FT                   /translation="MTLLFQFLTLLLPILAGAIPAYRPATLESFQLRDQSSWAVASQQP
FT                   DFSGDVTQCKGYAINSDSVRQTSTGGISAQLDLITYCSAYGTDIPSLTLSVEYETSSRL
FT                   HVHIYDTPVKQFQIDDNILPRPKRTLFGTDSADKSDLKFDYENSPFAFWVTRKSDGEIL
FT                   FDTRKDGIPIHEDPSDILGSPSNYTVMPAHPLVFEDQYLQLSSKLPVGANIYGLGEAVS
FT                   GSGYRRNSSSTVQTMWARDIADPVDENLYGTHPFYMEVRYNETSCTLASHGVFLRNSNG
FT                   MDVVLRDGAIQYRVIGGTLDLYFVSGPSPNDVTEQYVSTVGLPQSMPEWSFGFHLCRWG
FT                   YTSANDTLSVVNRMRDAGIPLETQWNDIDWMRSYREFQFDQNYGEVDYRNLVETLHSRN
FT                   QHYIPIFDAAIGHPLNATDRFDVYDKGHELGVWMRNPDGTEYVGAVWPTFAVFPDWFHP
FT                   KMQEVWTEAFYNYSQIVDFDGIWLDMNEPSSFVDGSASNSTMSLENTTVIPPDYSTVAF
FT                   PTDWPEGYSNVTGISGNVTVDGALTYGADGDAAKNTALRRSLIGRDDVLTIPYVDVPPY
FT                   PINNGYGRLSAKTVSPNATHYGGLQEYSVHNLWGSMEEDATNNMFLALKPGKRPFMVSR
FT                   STFAGSGRKTAHWLGDNFSTFAYMKRSIQGVLQFNLFGIPMVGPDVCGFNGNTDEELCN
FT                   RWMQLGAFFPFFRNHNIKSAISQEPYVWDSVRDASIKAINARYQMLPYWSTLFAKSSLA
FT                   GTPAVIPLFHEFPSPSYLDNDYQFLIGPSVLVTPVLQPNESTVVGQFPTMNDVFWVDWW
FT                   THCKLDTSSGEDVTLDLPLGNIGVHVRSGSALLLYDEPGYTVKETKDNGYAILVVLDGK
FT                   GYAEGDAKIDDGESLPVTEQTCLTFKSTDSCKLSSTAVGSYTIAGKLKTITIVGVWTEP
FT                   SEVTLNGSKVQDSQVEYDKSLGRIKITGLVQDLNSAWELMW"
FT   gene            complement(805381..811378)
FT                   /locus_tag="CNH01300"
FT   mRNA            complement(join(805381..805641,805691..805796,
FT                   805848..805872,805929..806007,806071..806210,
FT                   806260..806474,806539..806950,807009..807088,
FT                   807140..807222,807275..807311,807370..807730,
FT                   807782..807825,807878..807974,808030..808263,
FT                   808321..808394,808447..808508,808565..808585,
FT                   808639..808703,808758..808802,808862..809008,
FT                   809060..809121,809166..809244,809295..809710,
FT                   809765..809989,810035..810053,810105..810159,
FT                   810208..810356,810412..810431,810484..810692,
FT                   810740..810871,810922..811378))
FT                   /locus_tag="CNH01300"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(805515..805641,805691..805796,
FT                   805848..805872,805929..806007,806071..806210,
FT                   806260..806474,806539..806950,807009..807088,
FT                   807140..807222,807275..807311,807370..807730,
FT                   807782..807825,807878..807974,808030..808263,
FT                   808321..808394,808447..808508,808565..808585,
FT                   808639..808703,808758..808802,808862..809008,
FT                   809060..809121,809166..809244,809295..809710,
FT                   809765..809989,810035..810053,810105..810159,
FT                   810208..810356,810412..810431,810484..810692,
FT                   810740..810871,810922..811334))
FT                   /codon_start=1
FT                   /locus_tag="CNH01300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45244"
FT                   /db_xref="GOA:Q5KCK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK1"
FT                   /protein_id="AAW45244.2"
FT                   /translation="MGDQKLKDAGVEPSRLLTTDAASPEQGLSSMEECLGENDQQRRSS
FT                   EPLPDRESVQPSSNCNIVEDLELVPIQHTDIPPVTPSQINNPSTVVKLEEQERLHRENE
FT                   DWRKNALLNLPPPLPYDLVVEKLTIGVPNRKALRWVPSLFKVFAKRKEKDEEEPGKPKK
FT                   KWILQDVSCECQNGEVLAILGGSGSGKTTLLNAIANRVSGLPTANGEVAYFSVEPHAGV
FT                   RRGIKLEKGQMKKRIGFVRQQDFLVECLTVRETLTYAAKLRLPNHLSDEAISFIVEQTI
FT                   DELGLRDAADTVVGGPLRKGISGGEKRRLSIGCALVTLPSVLILDEPTSGLDAFTSYLL
FT                   LLTLSQLARRGRTIILSIHAPRSDAFEIFDRIALLSKGEIVYSGLRKDCLAWFYSLGHE
FT                   VERGVNPLDFLIDVSSVDNRTPENEEASIARVRSLVQAWNNRSPAHWADNLEKASMRSS
FT                   TSFISIDNLSPQGNNSDEVSSNGVGGDDASRDIGARDEQRPGLWKQTRVLTARAHRNVY
FT                   RNVPQLVGFAIQAVLLGVIIGVTYYQLPETPTGIQSLKNLSFQLIPGVFYLQQVFWIYK
FT                   FCTDLVIFDREREDRLYDVIPYVLSDFISYLVPSILSPTIYVVLVYFISKLRTDELAAN
FT                   LFISIASTILVQFTTQGLALLSASLLRSFSAASMLGNSLNLFQIMSSGFILTNVPVYVA
FT                   WIRWISPYFYSFRIIATTQFKDRVFDCPAESNANLNQCRGNNVLNGLNFDYTINIGVWF
FT                   GGLIGLAIIEYALACVVLWGLPAGGVKHASEIDSHHRGKETDVRESHITRDKIDVSVRN
FT                   LSLMWKRRGRGPLKDREKIILNDLSLDFPAGEVSAILGPSGAGKSTLLQLIAGRQLNPG
FT                   PLSHYTISGTLLFANQPISRTTQSNVAFVEQDDDWHLPSLTVRETLTYAAILRLPVKMP
FT                   KKQKVARAETVLRMLGLKDCADLPIGGALLKGISGGEKRRLSLAVQMINDPAVLVVDEP
FT                   TSGLDASIALGVMHVLRDIAATGRTVIATIHQPRSDIWKLTDNVTLLAKGGTIAYTGKR
FT                   SDAVQYFASINHAMPSEFFNPADHLLDLVSIDPRVSYHHQSLTRVNGLTSQWRIQSVGQ
FT                   ENGDEQDKNGADSAIIKHGEGTTPMKIALPVVLERHWKNLWRRKDVFFNRLAQTPLLGA
FT                   LFILFFQRLTYGPAGAQDRIGVTIESTSAIAFVGLLNAMSIFPADRNLYLHEAKSSARY
FT                   SPATFMITYSLVEVGFELLGGFGYGAIMNVAIGMQTSARIYFEYSISIWAMVNMGESFA
FT                   MIFGSWIQTEGLTVTVVSTFLSLIGQVSGVISLSVPAWLAAIAWGTCVKAATRIQIINE
FT                   AVGLEFHCTNEEISSGACVAQSGEQLLALFNWHDLDTGKFVGVMIAVCIAWRIMAWASL
FT                   AARVGGIR"
FT   gene            complement(811602..814625)
FT                   /locus_tag="CNH01290"
FT   mRNA            complement(join(811602..812969,813018..813402,
FT                   813452..813755,813807..813897,813947..814008,
FT                   814111..814203,814323..814625))
FT                   /locus_tag="CNH01290"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(811817..812969,813018..813402,
FT                   813452..813755,813807..813897,813947..814008,
FT                   814111..814203,814323..814457))
FT                   /codon_start=1
FT                   /locus_tag="CNH01290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45243"
FT                   /db_xref="GOA:Q5KCK0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004072"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCK0"
FT                   /protein_id="AAW45243.1"
FT                   /translation="MARRFVLYGVASTVFAFGVVSTALRTRANFYAAAVSIGKSSGSMM
FT                   ILGNFTLFNAILLGIGVKNLFFGQLRTIEYEHLWEKLWMFLTESLLALAIFRDDFSISF
FT                   MAMFSVLVFLKCFHWITADRVDYMDQIPPPGPPRQFHIRMVSIISLLMLLDFLFVSYSL
FT                   ETILLEGVSAMIIFASEFIILQATIAGSAARYAVGVIDLRRARGREDAPVWEAKSTYLF
FT                   YIDLSVDFVKLLTYLMFFTVIFLNYGLPLHILRDVYLTFMSFMGRIRDLMRYRRATRDM
FT                   DNLYPDATEEELERSGDRTCIICREEMISRNQREREGMQVNEGGPNETPKKLQCGHVFH
FT                   FHCLRSWLERQQKCPTCRRDVLTRQRPPGLVYNPPMPQEPLRPAPAARPGDHGRDAQLV
FT                   ELMRQNLNEYFPNDNNNRRDGAARISTTQGTNSRAGESSGSQEGTEQRIQRGIWGGPIV
FT                   PGRFTPAPLGAAPRISSPSTPFTLHRSGQATPTRTVPQIFANQQEDNDNLPSNPRIPQD
FT                   SPSYYNNSRVVSGNVTPFSSNPPFSFSNTGAARATREEAGQDDNDVRRQVADAALRRLG
FT                   GMTGSGESLPSVREDKGKEREHMQEENELDRWDAVPRVHAQLAPKQFHALDHDHLSRSN
FT                   KRPKLDSSAAYTPPFENWTQRIERTSDGTRRGLDERLKLLGQVDERIWGLVGELTRLRS
FT                   EWEAEDGAVSGTSSRSRSSPGEGAAAPIAASSVSDPPRGDDSGVEQ"
FT   gene            814842..816609
FT                   /locus_tag="CNH01280"
FT   mRNA            join(814842..815402,815455..815512,815568..815579,
FT                   815629..815712,815759..815873,815920..816188,
FT                   816248..816609)
FT                   /locus_tag="CNH01280"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase,
FT                   putative"
FT   CDS_pept        join(814877..815402,815455..815512,815568..815579,
FT                   815629..815712,815759..815873,815920..816188,
FT                   816248..816575)
FT                   /codon_start=1
FT                   /locus_tag="CNH01280"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45011"
FT                   /db_xref="GOA:Q5KCJ9"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ9"
FT                   /protein_id="AAW45011.1"
FT                   /translation="MARVITSATPKRERSASSPLTELEPEVPAPKAVKPKRAVRSTKPK
FT                   NEDTKENDNNEDAPAAAKKQRVSKAKAWPPAELEPMLHLPRQGYPAFKLPCSTASSNGG
FT                   IAPQNDKSQPMLLGAHVSAAGGPATALLRAGLAGANGLALFVKSQRQWKSKPYEDETVQ
FT                   RFKELMKSKEEGGMGYGPESILVHGSYLINLGNPDPAKWKVSYECFKDDIARCHQLGIK
FT                   LYNWHPGSTVGACTKEESFALIAKAINQVHKDVPEVITVIENMANAGSNIVGTAWSDLS
FT                   SIIKLVEDKSRVRVCIDTCHTFAAGYDIRTPETYAETMKRFDEVVGNKYLAGVHLNDSK
FT                   ANLGANKDLHENIGLGEIGLTAFRCIMRDPLMTGIPLVLETPAPDAPTPAEHLSIWTKE
FT                   IALLYEIQAIEDDEWDVKKGEIEKRWRKERDAINPPKEKKKPAAKGKAKKAKKVEDDGC
FT                   SHDED"
FT   gene            816734..817982
FT                   /locus_tag="CNH01277"
FT   mRNA            join(816734..816982,817042..817982)
FT                   /locus_tag="CNH01277"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(816811..816982,817042..817616)
FT                   /codon_start=1
FT                   /locus_tag="CNH01277"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X8"
FT                   /protein_id="ALO69535.1"
FT                   /translation="MSRISGYSDYLMSRYIRKLILRHGEQPRSKRRRKHKVLRKYDSLK
FT                   QIMSPQQNSRGSASSSGTYTIFPPKTANLAVSDGSFSPQALTTTPNSTTPLTTSDPRSN
FT                   SSSKPSDYFTTPTSSPQDIRHPSPSRVNTSDSISRMTGNDSQTSSSSLRRILETGILRP
FT                   FKRSKPFSKEENVMWRNILRSPICRPTMTSELPSIASLPISHKDLVKKADEETAGRGRV
FT                   SNESLVIPQNFDDDSTQSTYSSDRNE"
FT   gene            817995..820343
FT                   /locus_tag="CNH01275"
FT   mRNA            join(817995..818273,818342..818492,818547..818706,
FT                   818757..818987,819033..820114,820190..820343)
FT                   /locus_tag="CNH01275"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(818399..818492,818547..818706,818757..818987,
FT                   819033..820114,820190..820218)
FT                   /codon_start=1
FT                   /locus_tag="CNH01275"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X4"
FT                   /protein_id="ALO69536.1"
FT                   /translation="MNQHYNPHISSSRRSSRQSLESDRSTHSVATTPPFELSMGLPPNP
FT                   AAWRNRSHSAASSAGEIEPPTSASMGGRVSYRDETVPRISRLYASSSNGSTPRTGFVSP
FT                   TSPDSMELSTGSLLSGPSPLLTRRSTGKSGLSIRSLEQSRNASSVALTRINTALTGESS
FT                   FLDHSSDGEKNGKERTKQGRMRQRVSRTFTRVSRWSALALFISKRDSQSNASQKSAISY
FT                   PISPANTSMLPSSMSADDAASVIIPDRSFPYETKYDIVPPAEFEGNTSQVDLAFPRPNL
FT                   VSEQSNAVLWRLEEDKDEQTVPTGTSQSVRMYHEPSRRLFRLQEALAKMTGGTTGTGVE
FT                   TTDLPGPSAKAGLSRSPPAQQRPVSINSMDTEVTEIVDNESSDDEAPSFKPKVAAYPSS
FT                   RGILLGTSSEARLSPISGNIPIEFEGVKLNLRMDDDGKTSSGSEDMGRQSKELTTSGAS
FT                   ANLDITLGNASGDTLGNLGILDSVNNSDENQTLQTRGVSSTSTTLGERRGRIPERLNFV
FT                   TDADQIPDKQHLSR"
FT   gene            complement(820235..821148)
FT                   /locus_tag="CNH01273"
FT   mRNA            complement(join(820235..820764,820834..820935,
FT                   820991..821148))
FT                   /locus_tag="CNH01273"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(820365..820764,820834..820935,
FT                   820991..820992))
FT                   /codon_start=1
FT                   /locus_tag="CNH01273"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5X1"
FT                   /protein_id="ALO69537.1"
FT                   /translation="MPPKQGKKYAVAYGRRPGVYNTWQEAEQQVKGYPNAIHKKCKTEE
FT                   EAYQWIGRAHVAAQSGNNPTPQQVYRIAAQANPQNGQSKNSHEQNGYSRYPTGSFGQRS
FT                   TYPQTGYSYDRPETPTAHTAYALGAYMLPATHSQNLYTQSDPWSRRPQEYYYYIKDSDS
FT                   DDSF"
FT   gene            821355..822878
FT                   /locus_tag="CNH01270"
FT   mRNA            join(821355..821493,821557..821776,821835..821954,
FT                   822024..822099,822292..822557,822612..822878)
FT                   /locus_tag="CNH01270"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        join(821385..821493,821557..821776,821835..821954,
FT                   822024..822099,822292..822557,822612..822765)
FT                   /codon_start=1
FT                   /locus_tag="CNH01270"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45010"
FT                   /db_xref="GOA:Q5KCJ8"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ8"
FT                   /protein_id="AAW45010.1"
FT                   /translation="MAEHLMFKGNLAGHNGWVTAIATSSENPDMILTASRDKTVIAWQL
FT                   TREDNLYGFPKKILHGHNHFVSDVAISSDGQFALSSSWDHTLRLWDLNTGLTTKKFVGH
FT                   TGDVLSVSFSADNRQIVSASRDRSIKLWNTLGECKFDIVEDGHTEWVSCVRFSPNPALP
FT                   VIISAGWDKTVKVWELSNCKLKTTHHGHTGYLNTLAVSPDGSLAASGGKDGITMLWDLN
FT                   EGKHLYSLDAGDVINALVFSPNRYWLCAATASSIKIFDLESKSLVDDLQPDFDGLSDKA
FT                   RKPECTSLAWSADGQTLFAGFSDNLVRVWAVVA"
FT   gene            complement(822584..823567)
FT                   /locus_tag="CNH01260"
FT   mRNA            complement(join(822584..822949,823003..823083,
FT                   823135..823262,823360..823567))
FT                   /locus_tag="CNH01260"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(822902..822949,823003..823083,
FT                   823135..823262,823360..823540))
FT                   /codon_start=1
FT                   /locus_tag="CNH01260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45009"
FT                   /db_xref="GOA:Q5KCJ7"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ7"
FT                   /protein_id="AAW45009.1"
FT                   /translation="MSGMNLPPGLRPSSGPPQQGGQRGAPSPEEREAAEARARQQDEMK
FT                   RTMIAAMLEPAARERLSRISLTRPQLAAQVETLLVNMGQQGQIRGQVSDEALKGLLEQV
FT                   SNPAPAKSTSSVSQSSRTKTLGGGITIQRKRDDSDSDEYDL"
FT   gene            823688..825833
FT                   /locus_tag="CNH01250"
FT   mRNA            join(823688..823821,823887..824015,824074..824172,
FT                   824235..824481,824541..824818,824871..825480,
FT                   825536..825833)
FT                   /locus_tag="CNH01250"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(823732..823821,823887..824015,824074..824172,
FT                   824235..824481,824541..824818,824871..825480,
FT                   825536..825687)
FT                   /codon_start=1
FT                   /locus_tag="CNH01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01250"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ6"
FT                   /protein_id="AAW45008.1"
FT                   /translation="MSAEQPATKTSRGPAEEVVAKRLKALGKKLQRFKGYASQKPETLN
FT                   ADQRAGLASLPALEGTVKELEELSKQIEYVELEQAGKVRELKDQAKKDAEAHGLAQVEQ
FT                   FQSTISTPLSLFLRLYNLLHPARASDHDNLTFGRLELPRNMQEEIQATDVLRVGRWYED
FT                   LLAGDERAKTIIKCLATGPDGADDEDDRVHHLLKLLAESDSLPAEEEVSAVEEREQPAE
FT                   KTPAADEIVEEVPQEAAPEEAIAVTEPEPQSQSQVEKQQPKNMVFNFLQEDELAASQPQ
FT                   ISEPSTTQPTQTATPTETIPPEDPIPESEPQPTVRSAIPAFDWAAEDDEQPSDSPAPVE
FT                   NPCDAQPSQTTQAEAKTSIDETSDQIIEKNVLANAHVAQPFPQEAGVSAPPAVDNTAAA
FT                   PPAAKIMSGGRGRGRGGRGGRGGRGGGQQKGQQNQQQQRQQQAGQVGQKVDDDGFQFVG
FT                   KSPTAQHGPVPARGRGRGKAYSRGRSGGGGPRPTNDTRTPPQDGQSSPAQGQQRQQNQR
FT                   SPRPTRLSSQQAKPTPA"
FT   gene            826548..828258
FT                   /locus_tag="CNH01240"
FT   mRNA            join(826548..826691,826755..826812,826881..826912,
FT                   826972..827011,827079..827172,827233..827421,
FT                   827469..827535,827591..827822,827875..828258)
FT                   /locus_tag="CNH01240"
FT                   /product="cytochrome-b5 reductase, putative"
FT   CDS_pept        join(826638..826691,826755..826812,826881..826912,
FT                   826972..827011,827079..827172,827233..827421,
FT                   827469..827535,827591..827822,827875..828167)
FT                   /codon_start=1
FT                   /locus_tag="CNH01240"
FT                   /product="cytochrome-b5 reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01240"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45007"
FT                   /db_xref="GOA:Q5KCJ5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ5"
FT                   /protein_id="AAW45007.1"
FT                   /translation="MAAARFLSSARIARPSVISRTAAQYRGYSSAAPSGGANWPLLLSV
FT                   AGATGVGAYAYLQYNPSVKKEVEAKIKGAEAEKAAAERTAAGISAFVKDTWIPFTLEKV
FT                   GKYNHNTNIYHFSFGEEGKDKISGGEVASVVLLRSPEGPEQIKDEKDKPIIRPYTPISP
FT                   PDQKGSIEFMIKSYSGGKFTPFLSNLSPGQQVLFKGPLQKFKYQPNSFEKGLCIAGGSG
FT                   ITPMWQLINHSLSIPEDKTKWTLIYSNVSEADILLRKEFDALAQKYPGRLDIKYVLDKG
FT                   PWGWKGETGYVTADLIKKTFPKNEGENIRAFVCGPPGQMKAVSGEKDGMKQGELAGALK
FT                   ELGYTSDEVFKY"
FT   gene            complement(828239..830514)
FT                   /locus_tag="CNH01230"
FT   mRNA            complement(join(828239..828338,828390..828463,
FT                   828513..828651,828706..828793,828849..829390,
FT                   829440..829555,829607..829676,829735..829971,
FT                   830016..830213,830266..830514))
FT                   /locus_tag="CNH01230"
FT                   /product="cytochrome b2, mitochondrial precursor, putative"
FT   CDS_pept        complement(join(828270..828338,828390..828463,
FT                   828513..828651,828706..828793,828849..829390,
FT                   829440..829555,829607..829676,829735..829971,
FT                   830016..830213,830266..830514))
FT                   /codon_start=1
FT                   /locus_tag="CNH01230"
FT                   /product="cytochrome b2, mitochondrial precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45006"
FT                   /db_xref="GOA:Q5KCJ4"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="InterPro:IPR037458"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ4"
FT                   /protein_id="AAW45006.1"
FT                   /translation="MGEYVYAQRGWGDEKKLEITSAATMERTARTTIFRRGVQHAAIRS
FT                   RYPAVASRLPFARRGFSAVAIENKTSEGYRRALLLGGIAATLAATISYTLLRPLHLKDE
FT                   DLPDPSAPIDQATGRALIPYSEVNKHNKPDDCWVVIDGKVYDLTEFAESHPGGSSPIYR
FT                   AAGRDATAIFQPIHPPGTVEDGLDPKAMVGLVDPATLPKVVDKKKEDGEQRRVDLAEII
FT                   GLPDFDAAAKANLTSKAWAYMSSGATDQYTLDLNRKAFNSILFRPRVLVDVEIADTRTQ
FT                   MLGQDTSLPIFISPAGMAKLAHPEGECLLAKAAGQSNIIQMISTNASAPLPSIISSATS
FT                   PSQPFFMQLYVDRNRPKTESLLGKINSLGLKAIFVTVDAPAPGKREADERSRAEVEVAS
FT                   GISGGKIGSDNKGGGIGRSVGGFIDPKLSWKDIEWLRQHTKLPIGLKGVQTAEDAMKAA
FT                   KMGVDAIYLSNHGGRALDGSPPAMYTLLEMNKICPEIFKKCEVYIDGGCRRGTDVVKAL
FT                   CLGAKGVGMGRPFLYSLTYGEEGVVHAIEIMRDEIETTMRLLGVTKLDQLGPHLLNTKA
FT                   LDPLVFDQPMWGPGEKQ"
FT   gene            830474..832166
FT                   /locus_tag="CNH01220"
FT   mRNA            join(830474..830997,831054..831104,831160..831788,
FT                   831851..831915,831969..832166)
FT                   /locus_tag="CNH01220"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(830808..830997,831054..831104,831160..831788,
FT                   831851..831915,831969..832032)
FT                   /codon_start=1
FT                   /locus_tag="CNH01220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45005"
FT                   /db_xref="GOA:Q5KCJ3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ3"
FT                   /protein_id="AAW45005.2"
FT                   /translation="MSKPNVLLFGLGGIGGIYASILQLSGKCNVHVVARSNYQKVRNQG
FT                   FKIISPKFGNHDGMKFAGVWKSTDEAAASGAEFSYVLCANKALLDAKPSLPDHLRPIIS
FT                   PATSIVLLQNGVGAEVPLHEAFPNNTIISAVVWTGGKTLPDNEGVEQFNREGLTIGVDY
FT                   REGGDRKEEDEKLETLVGLLEAGGGDCIVTKDIQSERWVKVIWNCCWNTLTASTLLKTG
FT                   PFFQSSDLALPLCYSIMNEVVAVAKAKGLTVPDGTTEKLIKQCTDVPYPGLPSSMMADV
FT                   KAQRPTEVEVILGTPVREGIRLGVPVPTITTLYTLIKAIDYRNQNPDAANA"
FT   gene            complement(832072..834922)
FT                   /locus_tag="CNH01210"
FT   mRNA            complement(join(832072..832374,832437..833024,
FT                   833083..833838,833892..834003,834060..834922))
FT                   /locus_tag="CNH01210"
FT                   /product="Pi-transporter A-1, putative"
FT   CDS_pept        complement(join(832208..832374,832437..833024,
FT                   833083..833838,833892..834003,834060..834626))
FT                   /codon_start=1
FT                   /locus_tag="CNH01210"
FT                   /product="Pi-transporter A-1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45004"
FT                   /db_xref="GOA:Q5KCJ2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ2"
FT                   /protein_id="AAW45004.1"
FT                   /translation="MALSFILRGENDQTPMIAPGDVPSPTIISLTNTPAIPPTQPLNPS
FT                   NTSSDDDGAFPPSRFSLDPEKRDPRLSNREFDQSHPLFQDLAPEDSYHDGVYWADLPFN
FT                   ERRKWIDAQSNEETSRELKHIWQMFKKDPLSPLTTYCRTYVMGGFGLFTEGYALFSIGN
FT                   LSALYKAVWPLCWKTHEVCSSNWIAAVDYLQIIGIILGQILVGIEGDWIGRKFGLVQDA
FT                   LIMTLGLVMLTAAWGTNLEGWVICYGFSQFFYGIGVGGEYPMTSTTAMESKSVAGSQKN
FT                   DKLHRGRNVVLAFLMQGWGQLFNQAVLIILLLIFHHSGNPPYSEVSAQWTYRVSFAIMA
FT                   AMTLWLAYFRFYKKKYTSAALRRSKKNMRVNQSGYDLHSLKLVGTHFAGRLVGTTMGWL
FT                   FNDFLFYGNKLFASTFIEIISPNAAGNVIVTWNWNMVNIGVSLCGYYLAAFLIDHKFYG
FT                   RKRMQIIGFLGDAVLFMICAIWYTELSSPAHIKGFQTIYYLSSFFQQFGPNCTTFLLAA
FT                   EVFPVSVRATAHGLSAASGKLGALLPAVIYNYVDTRTRFWIVFPFGFAGVFVTLLFIPD
FT                   TTGLDLREQDRYWAYVRQGRAHEYHGIAVHPRHLSWWEKIVLKRHLAYDPEKDRMQRVR
FT                   ELRMMYEEKRQAMEEAREHEEHDEEMEEELSHSAYHHFNSEKASLEKHMANSAPSTSPN
FT                   SPRPFVGMNGNVPAAPLSPISPATLSRLTPSRMAL"
FT   gene            836352..838023
FT                   /locus_tag="CNH01200"
FT   mRNA            join(836352..836593,836658..836702,836776..837098,
FT                   837156..837501,837556..837675,837732..838023)
FT                   /locus_tag="CNH01200"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(836480..836593,836658..836702,836776..837098,
FT                   837156..837501,837556..837675,837732..837890)
FT                   /codon_start=1
FT                   /locus_tag="CNH01200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45003"
FT                   /db_xref="GOA:Q5KCJ1"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ1"
FT                   /protein_id="AAW45003.1"
FT                   /translation="MISSTAATVFGLVLASVGVQASTPLVRTYQGDSFFDRWTYYGNYD
FT                   NTTNGDAIFANKSVATSTPELTYVTSDGSAIIRVDNSSTVQYNYKRDTVKITSTDSYPV
FT                   GSIWVLDAVHLPYGCSVWPAFWSYGAGATWPEEGEIDVIEGVNMGFSNQMALHTEDGCS
FT                   LGSSGSSFTGIVNDTSCYYEDNDNSGCGVTETNNASYGAAFAAAGGGVFVTELAESGIS
FT                   IWFFSRSDIPDAISNADDEIDTSTLGTPSAYWGTDTCDITKFFGDQSLVFDITLCGDWA
FT                   GQSSILASTGCSALSGSDTCYTTYVLDASNYDTAYFEINSLKVYSNGSSSNSSSDSSSS
FT                   SAPSTHRFSALGWLLAGVMGVSALVGMM"
FT   gene            complement(838568..843526)
FT                   /locus_tag="CNH01190"
FT   mRNA            complement(join(838568..839505,839556..839653,
FT                   839705..842992,843049..843268,843316..843526))
FT                   /locus_tag="CNH01190"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(838734..839505,839556..839653,
FT                   839705..842992,843049..843268,843316..843332))
FT                   /codon_start=1
FT                   /locus_tag="CNH01190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01190"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45002"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCJ0"
FT                   /protein_id="AAW45002.1"
FT                   /translation="MFTKATSHLRPFIRLPSSHSPASPDHFTANPSLLHHLPQHGTSNS
FT                   VIVQGQHSAQAGGASGHAGRTGYGGGAGAGGGYTGHARAFLSLPQTASFDPSSTLSDER
FT                   KKDASSSSSSNTSLLLKHRLSKTPRIVHLNDSVRARRAIEERKGGKDFTVVELEDVPRI
FT                   HRRDSIAEYTSGRLPLTSTSTRSLSRSHTSFDIFQVGIPQPRSIGLRALSTTSNAPRAL
FT                   EAEDIEAVEELELMTPRAGREVRTIGQPNRVLMDLAGRDLPSTVTAGWQLGGIRRNSTA
FT                   AVERPSLDLPPADLSSIATHEQKEDKQREEAILQALRQAKQNGNAELVKNLITHYRSPR
FT                   SLPPFSPDSLPGVPELSKHYPLPSGYSIRIYNACLIAALAIRSPGQSIAPILEIYNELL
FT                   EKDMIPDSMTYGAVIRALAMRERDVRGSQEIWERQKTWGLWRSEISGNQTWDPEVAAEN
FT                   DANIEAYLAENNVLSAVRLFRAAALTGQAGRFVVSIHGTVLDALSKLEKPDVTVMEQLV
FT                   EHAESHEVPGIISLYKHLFLAYAKIKDASALSQVWNKYRGLAKTASREDWAAACGQREA
FT                   YDVRIEGAMREPWDIVISAFIEVGELSKAFEVFGEMAEVAEKKTKAEVPPATHRTCGVL
FT                   VTALARAGEFDLALEWFNSLQASAIVTQNSPHRLTLEHTIVLAEQLLLKGRWFDAADVV
FT                   IGLGGIRDELAQPSAQHSLRTVAWKTNFALIHHAARSTPEEAARTLARAQEVLAAVPIQ
FT                   LDLRTVVLHLTLLAQASDYTNMIRVVDLISARKLPANTIQRLNDACDQIAKEDIPFKYR
FT                   IELIKAFGRHHADLTPFVAEKLIQAYISEKSKPVDERDLSKESLYILLDAFTVVEQKQV
FT                   NEGEYDEALEQLMQDLAATDVSEDMKNATSNQAIGYLVKNVIFRFGAERARSMLGAVFG
FT                   EQEATNLVQPVSPTFIQSETVSGSERLSEAASPSQSHASSATSAPALSFSQTLTSSIER
FT                   FTYRNPTITPLEAYALLRDGLSVSQVPRLEIILSLMDHLARRNDEPKVRELYELAQVVL
FT                   NSLVRPDVQAQSWYSAENAMLIACCHLGYLEEAGLHRARIVQAGFTPSADAYATMIASS
FT                   KDTTDDALVARELWEEALGMGVKPHLFLYNTVISKLSKARKAESALDLFMRMKSERIRP
FT                   SSVTYGAVINACCRVGDALSAETLFEEMTSQPNFRPRVPPYNTMMQFYLQTQPNRERFL
FT                   YYYGALQRARVPPSAHTYKLLIDAYATLPPIDIPAMELVFAHLIADKSVRVQGTHWASL
FT                   ISAYGIHAGDAKRAKEVFDKIPEKGGDYEAVVWEAWLNVLSQQGTIEQLEEAHTRMLES
FT                   GVQPTAYVYNVLINGYARAGNIGRAREVFESMGDSITGVAAPNNHPVLLTSSGHAKPST
FT                   QAATTGVVYREPSTYESMIRAEITCGDQQRATEVLQRMEERGYPMAVYMRGKAALEGEP
FT                   PKF"
FT   gene            complement(843643..845280)
FT                   /locus_tag="CNH01180"
FT   mRNA            complement(join(843643..843948,844002..844398,
FT                   844450..844498,844548..845280))
FT                   /locus_tag="CNH01180"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(843847..843948,844002..844398,
FT                   844450..844498,844548..845247))
FT                   /codon_start=1
FT                   /locus_tag="CNH01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45001"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI9"
FT                   /protein_id="AAW45001.1"
FT                   /translation="MPPAASPPSPHASLRPRPTIADVPIAPRRRLRDGSRAGSVSSGRS
FT                   NGASRSGSRESSRSSSSRVALLVPAATVTTPSVVASGAPSRSQSRAAQEPIEISESESE
FT                   NGNGSGDSIVAISPQAVSRGQTLASVHSRRITRSAVTSRSGTHERRTNQSTPVLVHEDS
FT                   LSSSDEYGPRYTTQEKGKGRAVPSSIPIEISSDEEDELLGLQSVKAKSVETEKENEGTG
FT                   LDESSALGTGYHCPICFNAPNPAILTPCGHILCAGCLHSSLLAAIRRNPNPYPNPFASL
FT                   PHRGRSRGRTRGSTPTRRGHGFSRVKEEQPTHWTADMLRQAYMDQKIAEMEQGLLQQKW
FT                   PEEERDAAIAGMIEEMEDVQVKEVLNGLWSVDGKWVVEGECPVCRKALAGGYGPPNSGI
FT                   GGVIPLQVRLSTALQR"
FT   gene            845473..846517
FT                   /locus_tag="CNH01170"
FT   mRNA            join(845473..845577,845627..845638,845848..845926,
FT                   846000..846103,846167..846383,846441..846517)
FT                   /locus_tag="CNH01170"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(845569..845577,845627..845638,845848..845926,
FT                   846000..846103,846167..846383,846441..846442)
FT                   /codon_start=1
FT                   /locus_tag="CNH01170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45245"
FT                   /db_xref="GOA:Q5KCI8"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI8"
FT                   /protein_id="AAW45245.1"
FT                   /translation="MPKNKGKGGKNNRRGKKEDGENKRELIFKEDGQEYAQVVKMLGNG
FT                   RLEAKCQDGESRLAQIRGQMRKKVWIVVGDIILLSLRDFQDDRADVIHRYTPDEARNLK
FT                   TYGELKDFQLVENQEAGGEEDEEGGIEFEEADIDDI"
FT   gene            846696..850193
FT                   /locus_tag="CNH01165"
FT   mRNA            join(846696..847222,847274..847580,847653..847845,
FT                   847902..850193)
FT                   /locus_tag="CNH01165"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(846757..847222,847274..847506)
FT                   /codon_start=1
FT                   /locus_tag="CNH01165"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z1"
FT                   /protein_id="ALO69538.1"
FT                   /translation="MSSPFPIPQLTYPSPSNSTSNPATFAPSPLSQFVASALASTTLAP
FT                   GSNGGGTGNTPNLGTMGISPNFSFGLTPSNLSQGPTSNIPFSQLALLNSTEATNAALPA
FT                   ENDGTGLLRGLEQADGVLGRMEELLKEIDNVEKGVFGDGEGIGRLEGLYLEYTQLLLGL
FT                   LGSSQSQLFGALPILPANEQLEKKEPTAQDLAAWAEERASLEFSRKEALRAGGKAVLDV
FT                   LRASAAAGGK"
FT   gene            complement(848016..851322)
FT                   /locus_tag="CNH01160"
FT   mRNA            complement(join(848016..848355,848409..849142,
FT                   849202..849255,849307..850216,850270..851322))
FT                   /locus_tag="CNH01160"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(848261..848355,848409..849142,
FT                   849202..849255,849307..850216,850270..850858))
FT                   /codon_start=1
FT                   /locus_tag="CNH01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45000"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI7"
FT                   /protein_id="AAW45000.2"
FT                   /translation="MPRTQQPSTGLGIEDELSFGSDEDLIADVGEIALPATAPNPPSNA
FT                   KADKDRKSRFKLSGKKKSAEGSVLASAHPQHSTREMRDTSHKKEKKSKEGRSLASASIV
FT                   LDPQMESVLDLTSGGAYYNAGSASGGSTPSLPSLTSGSTTSSRKKGGFRNALKGLGMKK
FT                   ESEQSSLFATRQREKLDKLKQVHSIDSFSTGEYSMQPSIDLSLSTYSSRRTDTTMSSVY
FT                   HHLTPTNAPGTKSRTEREESLHSKHASVSSVTPSQPPSYANTDRQPAASNHKMILEKFP
FT                   EAPATKETIPLSSPSTLSSRAPSPFLSPALTSILLPSFPTTASSLENIQILSATVIRRT
FT                   DSSSIEKERSSSLRNLAGGLGNGSSPSSKRPVWISQQMILTSFKIGGNTPVGSPNPEAA
FT                   HVITSESETDAAKTTAHLHLFSIPTTTPRSSLKSSTSPIKPSPPQPQVELERMMLKADS
FT                   TAGFWEETNGERKFVMRIGFGYGKGEEREGEGVEWIVEMRNAEQLREWIQQIKSIAVVI
FT                   RAEKEGHGHAIREAFSTGSARGDDLALALNMQRLTPSHSIKSRPTSYQSGNTGTPVRNS
FT                   VSSPIGRPPRKESLPEAPTPSRAPASIVEEDKQEAAKEESPMLLPEEIRGRLDRLDLGL
FT                   YTPPTRGSNLRQASETSLSPARLNQPIPAKLPPPTVAPPSIPKFAIPAPQEKEKKMLTE
FT                   AEKVRLEAQASTPVPVAPVSVLAGSSTTLHAPEQAADAQSIHSIPSVSSKTSTTTSRRR
FT                   AAKKMALDIMSEFNESGMGDFEVEEEVPINEDRARAVRFA"
FT   gene            852815..855319
FT                   /locus_tag="CNH01150"
FT   mRNA            join(852815..852937,852996..853531,853587..854089,
FT                   854149..854456,854506..854704,854759..855319)
FT                   /locus_tag="CNH01150"
FT                   /product="hypothetical protein"
FT   mRNA            join(852961..853531,853587..854089,854149..854456,
FT                   854506..854704,854759..855319)
FT                   /locus_tag="CNH01150"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(853072..853531,853587..854089,854149..854456,
FT                   854506..854704,854759..855076)
FT                   /codon_start=1
FT                   /locus_tag="CNH01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44999"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI6"
FT                   /protein_id="AAW44999.2"
FT                   /translation="MFAPSDQQITDPIQVIGPSLLLQVFYSLPLRDLLNCSLVSTTWYT
FT                   LIDNHSTSIFRDLASDIVSDKRRLQFLKSLGQDEVRDPTLYNASFIRAGTLGSDKKISW
FT                   RGICRDAVVTERNWKYGRAKPGWLTPGRNTVWRMKVDPEENVLYTVSRLDGIQCSSADV
FT                   EGNSNLLFEYTDVAPYSHMEFVSGFVVFNIGLANALEVHITPSAMRRLTPEQRQAIPPP
FT                   SISETYGSDYSFTQEDDDAYRSTQASTDIPYRGHLTYYKTLRPATECWAFRARMDNEGQ
FT                   EGERPVLGTAGREAIYLFGLADDRVETIRIRHQHVDRDISYIEFDDHYVFICGPVAMHV
FT                   YSRQTKQLLNSFPTSYLRDLDAQVQAVYELSESNEIQRLPSAFEGATRVSEIVVKGLWR
FT                   QDSAFENAERLISERMLLANGGFSACHFTSSDLFCANKYSVLFVVRDYKSVFSIVDKRE
FT                   RSEALSRNLLAIRFKSPINQLYTNGERVVFNTTSEVYLLDASSLPPPPYNLSSSYFADG
FT                   VWPSIRILSLLDVHTNGLKHSSCLQMDGTKIYLVYWALGEQDGGGIVYDDGQAHLPPAH
FT                   ATADFGMCIKTWDFGHVDY"
FT   CDS_pept        join(853072..853531,853587..854089,854149..854456,
FT                   854506..854704,854759..855076)
FT                   /codon_start=1
FT                   /locus_tag="CNH01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI6"
FT                   /protein_id="ALO69539.1"
FT                   /translation="MFAPSDQQITDPIQVIGPSLLLQVFYSLPLRDLLNCSLVSTTWYT
FT                   LIDNHSTSIFRDLASDIVSDKRRLQFLKSLGQDEVRDPTLYNASFIRAGTLGSDKKISW
FT                   RGICRDAVVTERNWKYGRAKPGWLTPGRNTVWRMKVDPEENVLYTVSRLDGIQCSSADV
FT                   EGNSNLLFEYTDVAPYSHMEFVSGFVVFNIGLANALEVHITPSAMRRLTPEQRQAIPPP
FT                   SISETYGSDYSFTQEDDDAYRSTQASTDIPYRGHLTYYKTLRPATECWAFRARMDNEGQ
FT                   EGERPVLGTAGREAIYLFGLADDRVETIRIRHQHVDRDISYIEFDDHYVFICGPVAMHV
FT                   YSRQTKQLLNSFPTSYLRDLDAQVQAVYELSESNEIQRLPSAFEGATRVSEIVVKGLWR
FT                   QDSAFENAERLISERMLLANGGFSACHFTSSDLFCANKYSVLFVVRDYKSVFSIVDKRE
FT                   RSEALSRNLLAIRFKSPINQLYTNGERVVFNTTSEVYLLDASSLPPPPYNLSSSYFADG
FT                   VWPSIRILSLLDVHTNGLKHSSCLQMDGTKIYLVYWALGEQDGGGIVYDDGQAHLPPAH
FT                   ATADFGMCIKTWDFGHVDY"
FT   gene            complement(855367..856481)
FT                   /locus_tag="CNH01140"
FT   mRNA            complement(join(855367..855507,855569..855664,
FT                   855836..855928,855988..856020,856077..856175,
FT                   856238..856276,856344..856481))
FT                   /locus_tag="CNH01140"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(855483..855507,855569..855664,
FT                   855836..855928,855988..856020,856077..856175,
FT                   856238..856276,856344..856348))
FT                   /codon_start=1
FT                   /locus_tag="CNH01140"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44998"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI5"
FT                   /protein_id="AAW44998.1"
FT                   /translation="MACNCSLEKNIACCSTSEAQDKCTCQKGKCECEACPNSTKTSESG
FT                   ACNCGDKEKVSTCGCNGSGEACTCPPGQCACDKCSKKAKSVSTCGCGGSGAACSCPPGE
FT                   CACDSCPNQAKEKVSSCDCSGSGTA"
FT   gene            857884..859715
FT                   /locus_tag="CNH01135"
FT   mRNA            join(857884..858625,858682..859005,859056..859254,
FT                   859304..859462,859515..859715)
FT                   /locus_tag="CNH01135"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(858932..859005,859056..859254,859304..859462,
FT                   859515..859571)
FT                   /codon_start=1
FT                   /locus_tag="CNH01135"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Y5"
FT                   /protein_id="ALO69540.1"
FT                   /translation="MGSPPAANCQIGCWTKGGCMWLGKQSPHCIKGLTFRPDAEYLQLP
FT                   SNQTLVSSFPGAMSRAVALNHLATALMGLAIVFMFFCLKPDEGWSYWSKKLESWANFIA
FT                   WLAFWFDLAYIVVLRDRISNNDTGFDFHLGNAFWLMLYTVLHRSFLSYQVQTNSVAKT"
FT   gene            complement(863396..865722)
FT                   /locus_tag="CNH01130"
FT   mRNA            complement(join(863396..864527,864578..864755,
FT                   864810..864935,864995..865113,865169..865722))
FT                   /locus_tag="CNH01130"
FT                   /product="pof4 protein, putative"
FT   CDS_pept        complement(join(863878..864527,864578..864755,
FT                   864810..864935,864995..865113,865169..865490))
FT                   /codon_start=1
FT                   /locus_tag="CNH01130"
FT                   /product="pof4 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44997"
FT                   /db_xref="GOA:Q5KCI4"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI4"
FT                   /protein_id="AAW44997.1"
FT                   /translation="MPDPLEYAEEEDLFGSEGEYDTTDPFTLENVNPSVPIATPTTLPI
FT                   ASISRPATQRTRQQVYPHISRSAVSGRNDGEARLQELRNLKKKGKEEPPKFGVRSLKNI
FT                   AMGVVQANSGRIWDIGDLEYSLVKPFIDEVPMEQLAEIEANSPHIKKDTDWLYELFMLQ
FT                   DYRLFHERCRERQGEPRTTGWRKMYKKAKEDAAERQLQAADRVAARYKQLEEEKKSKSI
FT                   VVLDRVVPDKRRSRGRGRGGSSIGSSSSSRTAGAASAIAKARAEAQRARIALTHASGRY
FT                   VPPAQTQTHAQRVASSQLFKNPFLPSGSTSTSSTGYPPAPSPPQSRLPPPKSLRNSLDR
FT                   ISSIPKSRKQLQHPLSSPISGSFPTSQHSQMRAALPAHLSGRTGTSSPQPSERFRIDGD
FT                   RKKKEFKEIRKPQVKNFEAPKLENEKSKEKVDFFGGAGADGGGIFRVKKRKLGTEAGAG
FT                   GAKRQQ"
FT   gene            complement(865908..868979)
FT                   /locus_tag="CNH01120"
FT   mRNA            complement(join(865908..866927,866980..867436,
FT                   867484..867703,867751..868284,868337..868979))
FT                   /locus_tag="CNH01120"
FT                   /product="Kex protein, putative"
FT   CDS_pept        complement(join(866000..866927,866980..867436,
FT                   867484..867703,867751..868284,868337..868951))
FT                   /codon_start=1
FT                   /locus_tag="CNH01120"
FT                   /product="Kex protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44996"
FT                   /db_xref="GOA:Q5KCI3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034182"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI3"
FT                   /protein_id="AAW44996.1"
FT                   /translation="MRTLLSLWGILLALIVPPSLALQRPQPRSYDTHAYYALELDPSIS
FT                   PAAALQLSKSLGVELVERIGELDGHWLVRTEGWTPEHASITKRSVSHDPILKRWEALPS
FT                   SLGKKSLTPLSLKQRAKRHKSYSPRSRHSRDDRTELLYAQNELHLADPMLDQQWHLINT
FT                   QMKDIELNVTGLWGRGITGEGVHVVIIDDGLDVESKDLKDNFFAEGSYDFNDHTELPIP
FT                   RLKDDQHGTRCAGEIAAVPNDVCGVGVAYDSKIAGVRILSAPISDADEAAALNYAYQLN
FT                   DIYSCSWGPPDDGRSMEAPDGLILKAMVNGVQKGRDGKGSVFVFAAGNGGGSDDQCNFD
FT                   GYTNSIFSVTVGAVDRKGLHPYYSEMCAAMMVVAPSSGSGDHIHTTDVGKDKCSHSHGG
FT                   TSAAAPLAVGVFALALSVRPDLTWRDIQHLAVRHAVFFNPDDPAWELTAAGRHFSYKYG
FT                   YGKLDAGLFVEAAEKWQLVKPQTWYDSPSVYLPTTSPADVTRRQDEAADGPTSSDEETS
FT                   NPPPVVEPSGSFITEDGVISTYEVTQSMLFDANFERLEHVTVRVWIDHQRRGDVEVELT
FT                   SPNGVVSVLCRQRRFDNADSGFPGWKFMSLKHWDENPVGTWTIKVKDQVNPDKTGRFVA
FT                   WSLQLWGESVDPALAKLWAPAEEGQPDEEQTGSNPSTTVSQKPKPTALLPGDHGEASGE
FT                   ATQPGLGSATAHPQPTSTTGDAGNVAEPTGPTDADADEGFFSGISNLASSSTWLAGAGA
FT                   IIILSGAAIGAFFFIRARRQKRNLFGLSNNGQGARGAYEPVDDVQMSLLERGRRKFGKS
FT                   KSESQGTKDLYDAFGDGPSDEEEEDLDERTALRYHDGFLEDDEPNEVGPKTEYKDEPES
FT                   EPETFKDGEETVGTKDKGKGKGPSEGESGSGSSSSWQDAADEEARV"
FT   gene            869166..872046
FT                   /locus_tag="CNH01110"
FT   mRNA            join(869166..871564,871614..872046)
FT                   /locus_tag="CNH01110"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(869212..871564,871614..871624)
FT                   /codon_start=1
FT                   /locus_tag="CNH01110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44995"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024660"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI2"
FT                   /protein_id="AAW44995.1"
FT                   /translation="MGVQIDGEALGTLLKRLSSSSYLSIDDIALLADALVPSSPRLARA
FT                   TAYLCLSKACSDLDSKQTDGKAIYDAIFPFINSIFHKSVPKIQEIENDEDAVEIMAPEI
FT                   CVPAVYLLTALFPIAPSASASLLTGKIGDEGDSLGILLELAELPSPLQPALAELFVAAA
FT                   DSKQGRDLVLTRGMEWLKGGVKYEEGSGDVTALCAAALSKLSGSSDADQGKPPSEGQGI
FT                   ESITASNADREELAKKMMAFVEDSSSNYPALQSIIEGLAVLSLRPRVKVLLSSSPKFLK
FT                   SLIDLSPVPGRKGGSLPVTPRGMIDADNDAKLFESVETSFCYGLASILVNITSPKPILS
FT                   EQDQEMEKLRKMAISADKSKLNEQDEDAELDSNLEVLKRVKAVLAAGCVNALSGLIRAD
FT                   SRLVKEAIGRLCRNLVDSPDEEKDRKEWMRRRVLFVKDGGFKVLSIVLRDLLAMATVKP
FT                   STKASDTTLSPANPATIDIIPACQALAKLVVTTDPATLFPPPYQVTALNALTPLYHLLI
FT                   HPDSLLIQRFEALMALTNITSIDPTISAKLIKASIKPLKVESLFRTSYSSEEVRVITKV
FT                   EEMMLDDNELVRRAAVQLVCNLTSSQTGYDYFSGEDSTTTPSRARSLLNILVVLTCIDD
FT                   VPTQSAAGGALAMLTESPIACKYILMGDIHSSSSADQTPPRSPWSRICGLLETAPEVEY
FT                   DERTEPIPIISSTPSQPNAELVHRGVIILYNLLEYVVGLPGKEREAEKKRIEADGVQNV
FT                   LFGVLKVVKDMGDEMIQPVVFSLKMMRENLKCAH"
FT   gene            complement(872708..874610)
FT                   /locus_tag="CNH01100"
FT   mRNA            complement(join(872708..872798,872859..873073,
FT                   873127..873174,873233..873677,873743..873947,
FT                   874005..874113,874171..874610))
FT                   /locus_tag="CNH01100"
FT                   /product="NADPH dehydrogenase, putative"
FT   CDS_pept        complement(join(872762..872798,872859..873073,
FT                   873127..873174,873233..873677,873743..873947,
FT                   874005..874113,874171..874395))
FT                   /codon_start=1
FT                   /locus_tag="CNH01100"
FT                   /product="NADPH dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44994"
FT                   /db_xref="GOA:Q5KCI1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI1"
FT                   /protein_id="AAW44994.1"
FT                   /translation="MPIAEATDILFSPITLGAMKLQHRVALAPMTRNRAVPSNLNPGTY
FT                   VPCPLMAEYYTQRTTEGGLVISEALPISLQAADARAVPGIFTEEQIEAWKPIVDAVHQA
FT                   GGIFVAQLWHQGRTRMVENEYAIISSSAVPIVKSFTGLPGLKPRPMTLEDIERVKKEYA
FT                   QAAVNCIKAGFDGVEIHGANGYLPEQFLHSNINRRDDKYGGSPENRNRFVLEICQAVTR
FT                   VIGPDRFGLRLSPYGFFNEARGDNRVEQWTMLCRDIKGLGWAYVHFMEPRYDEIRSGAD
FT                   KLAELGENNEDVTLDPFVNALENCIPVIVAGGYDADNVRKSRVLEDKKADVVAFGRYFT
FT                   SNPDLVYRLKHDKPFVQYIRPRFYGPFPDPEVGYTDFPFCHELSGTPERKALLSSGTAK
FT                   VLKVAEPGWQLSKSGIQLGGLFAAVTQD"
FT   gene            877179..878775
FT                   /locus_tag="CNH01090"
FT   mRNA            join(877179..877578,877853..877940,877991..878263,
FT                   878312..878453,878509..878775)
FT                   /locus_tag="CNH01090"
FT                   /product="general RNA polymerase II transcription factor,
FT                   putative"
FT   CDS_pept        join(877403..877578,877853..877940,877991..878263,
FT                   878312..878453,878509..878528)
FT                   /codon_start=1
FT                   /locus_tag="CNH01090"
FT                   /product="general RNA polymerase II transcription factor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44993"
FT                   /db_xref="GOA:Q5KCI0"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCI0"
FT                   /protein_id="AAW44993.1"
FT                   /translation="MSGLALPKASNAGPSSSSSKPEGIQTLDGEGSLATRPPQKAIASV
FT                   PEITAVDGLVPTLQNIVATVNLDCRLDLKTIALHARNAEYNPRRFAAVVMRIRDPRTTA
FT                   LIFASGKMVVTGAKSEDDSRLASRKYARIIQKLGFEAKFAEFKIQNMVGSCDVKFPIRL
FT                   EGLAFSHGAFSSYEPELFPGLIYRMLKPKVVILIFVSGKIVLTGAKVREEIYMAFNQIY
FT                   SVLLEFRKTT"
FT   gene            879050..881257
FT                   /locus_tag="CNH01080"
FT   mRNA            join(879050..879347,879410..879469,879536..879557,
FT                   879620..879714,879765..879918,879981..880038,
FT                   880105..880429,880485..880534,880593..880625,
FT                   880675..881007,881063..881257)
FT                   /locus_tag="CNH01080"
FT                   /product="lipid particle protein, putative"
FT   CDS_pept        join(879075..879347,879410..879469,879536..879557,
FT                   879620..879714,879765..879918,879981..880038,
FT                   880105..880429,880485..880534,880593..880625,
FT                   880675..881007,881063..881195)
FT                   /codon_start=1
FT                   /locus_tag="CNH01080"
FT                   /product="lipid particle protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44992"
FT                   /db_xref="GOA:Q5KCH9"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH9"
FT                   /protein_id="AAW44992.1"
FT                   /translation="MQATHLIVLIHGLYGDVHNLDAVKSELLALADPETSNISDKGASG
FT                   AEKHNRCIHNERPKKRMETVVYLPKSIKGAHTWDGIDVCAHRVAEELDYEIERLQDEGK
FT                   DIVGFSVMGYSLGGLIGRYLIGLLHARQPSFFARHRPVSFSTAATPHLGVLKYGTKTNT
FT                   FVHSIGRKLFSHTGRQLYCMDHETEWGGRNLLEVMADPDGIFINALRLFPRSMLVANGT
FT                   RDLTVPYPTASISPVDPFDDSTYLDIEIDENNIIQSYRHIPLDDDSVSNFGSISTSTTQ
FT                   RIEKDEEEVEVLVTTIYKKPGRIMKVKKRSPPPFPPVLILPLRWPFNYSLLPFIPVLLP
FT                   LFILYMTIMITWITFHSRRRVQSLRHNQIERQPLLSSSSSMSSTPSSSLSDMTSSVKQT
FT                   LYEPIKALEDGTSTPPMADPLPTGSAPQPLLTPHQKMMVKALNEAMPNAKRVIAWFPWA
FT                   YNAHAMLICRSMARFPWQKDGLGVVQAWAKFAFEAGEAECHAKATGAVAHGNT"
FT   gene            881940..883521
FT                   /locus_tag="CNH01070"
FT   mRNA            join(881940..882660,882712..882884,882940..883521)
FT                   /locus_tag="CNH01070"
FT                   /product="pyridoxamine-phosphate oxidase, putative"
FT   CDS_pept        join(881963..882660,882712..882820)
FT                   /codon_start=1
FT                   /locus_tag="CNH01070"
FT                   /product="pyridoxamine-phosphate oxidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45246"
FT                   /db_xref="GOA:Q5KCH8"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH8"
FT                   /protein_id="AAW45246.1"
FT                   /translation="MAFPRSIIKTLDKLILNSTIRTMSTQHVFGTPSTSSDPALPSSAP
FT                   ETVKLTTHNQYLTPRLLASDLSPNPLLQFNSWFASALQPSQGEVAAGRKVNEPEAMTLS
FT                   TATAQGIPSSRVVLLKTVDKTGFVFFTNYTSRKSEELLANPYAALTFYWREVSKQVRVV
FT                   GKVEKVSREESVEYFNTRPRGSRIGAWASKQSQPVEEGQLEERVKNEEKHWEGKEVECP
FT                   EFWGGWRVVPFEVEFWSGQPSRLHDRFRYTRPEGSEGEWEIKKLSP"
FT   gene            884526..887121
FT                   /locus_tag="CNH01060"
FT   mRNA            join(884526..884582,884635..885286,885343..885564,
FT                   885623..885871,885952..886082,886147..886223,
FT                   886280..886372,886432..887121)
FT                   /locus_tag="CNH01060"
FT                   /product="calmodulin-dependent protein kinase I, putative"
FT   CDS_pept        join(885099..885286,885343..885564,885623..885871,
FT                   885952..886082,886147..886223,886280..886372,
FT                   886432..886929)
FT                   /codon_start=1
FT                   /locus_tag="CNH01060"
FT                   /product="calmodulin-dependent protein kinase I, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44991"
FT                   /db_xref="GOA:Q5KCH7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH7"
FT                   /protein_id="AAW44991.1"
FT                   /translation="MMHASKHKMGFSDFRDAILIQPPSFKKKKEYVLEELLGRGGFGKV
FT                   VKALWAPPEREPKEVALKIINKKLVKGNEQAVLDEISVLKHLDHPNIVHVWDDFESRDK
FT                   YYIAFELAVGGELFDRISERGKFTERDAVECIRQVLQATAYLHEHNVAHRDLKPENILY
FT                   KTRDADSPLVIADFGIAKHLETPDQECSEAAGSFGYAAPEVLLGKPHGMKVDCWSIGII
FT                   AYTLLCGYPPFRSDDRNGLLQEMTRGRIMFHDRYWSKVSRTAKDFVKDMLETDPKKRST
FT                   AADALNHPWLTSGQATETDLSAAIRDNFDAKRKWKSALRIIQASNRIRSASRSRSPSLS
FT                   TSPPSTANTANPSPNSALFVPEVPHVLTPLSMTDEDPMSDEHYYFSADDQGHTEEEEEA
FT                   KVMTRGGKKKAGSMPVGSGSGVTTGTVTPYTTGNEGSNTPKPTIKVIDGNGELRPEETD
FT                   MQTPPATAPVGAGMMGSIRGMMGKLSL"
FT   gene            887291..888600
FT                   /locus_tag="CNH01050"
FT   mRNA            join(887291..887383,887448..887487,887590..888600)
FT                   /locus_tag="CNH01050"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(887371..887383,887448..887487,887590..888367)
FT                   /codon_start=1
FT                   /locus_tag="CNH01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01050"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44990"
FT                   /db_xref="InterPro:IPR038871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH6"
FT                   /protein_id="AAW44990.1"
FT                   /translation="MPHKRAKRSVREAETAKKGKNLPPSSDGNPYDDTPRSAARILNSF
FT                   AVQQKFHESGRKTSEDTGTPRNSATPGVNGKGKGKEKEGLPKILPQETLAEYNRRIESL
FT                   LRPSVSQAIQKAESIRAAEAADLKRTKKENKRRARLEKLVKEGKVDKKVLEDFEKGVKE
FT                   KKRKREMGDEGDSEEEKDEEEAGAKSKQAKETKTFAPMPQPRRLNDIVQAPPTLPTLRK
FT                   AKDQKEGKGVYGAVGNGGKMPLNAGQKRILEEERERVVRMYREMKAAREAKNKK"
FT   gene            complement(888408..889414)
FT                   /locus_tag="CNH01040"
FT   mRNA            complement(join(888408..888836,888993..889169,
FT                   889298..889414))
FT                   /locus_tag="CNH01040"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(888532..888836,888993..889169,
FT                   889298..889343))
FT                   /codon_start=1
FT                   /locus_tag="CNH01040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44989"
FT                   /db_xref="GOA:P0CP08"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CP08"
FT                   /protein_id="AAW44989.1"
FT                   /translation="MDKEKLAKLQSQVRIGGKGTPRRKVVKKSVTSSQGDDRKLQAALK
FT                   KLGVQPITGVEEVNMFKEDGNVLHFGAPRVQVHAALPSNTLAIYGPGQTKELTELVPGI
FT                   LNQLGPDSLANLRRLAESYQSLTARQAAAAAGSGGEGAGEAKEGEGDDEIPDLVDNFDE
FT                   AEVKKSDLEELE"
FT   gene            889963..891356
FT                   /locus_tag="CNH01035"
FT   mRNA            join(889963..890244,890303..890725,890780..890935,
FT                   890990..891356)
FT                   /locus_tag="CNH01035"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(889995..890244,890303..890725,890780..890935,
FT                   890990..891042)
FT                   /codon_start=1
FT                   /locus_tag="CNH01035"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M676"
FT                   /protein_id="ALO69541.1"
FT                   /translation="MLAPRTTRIHRTYIHPTTSKGNVNKENAHALPSKTPSRIGGKQLI
FT                   GPATGMRMALGAKTEGRDRNVLRQQGEGKGKGREVDDIEPKRLFVNSSKDSIPPSKSLS
FT                   SMPPIPSLPTRTPAPRRIAPSQSQTLRTPAPTFKFVEPQPTPLPSATRTGRRSRQSLSS
FT                   TPGKGDLGLDKQKGQQFVTPAPVRWEEDLSLGSVEVEHLEGLEELEEEEDGEPEYMPPP
FT                   VQELPYDPGWDVPDLKEIFGKIATMPLLFGIGNEMPEPPELIFEEEEVGPLRLCKDDDL
FT                   EEDWLKPNIADH"
FT   gene            complement(891748..892333)
FT                   /locus_tag="CNH01030"
FT   mRNA            complement(join(891748..891916,891994..892100,
FT                   892236..892333))
FT                   /locus_tag="CNH01030"
FT                   /product="NADH dehydrogenase 10.5K chain, putative"
FT   CDS_pept        complement(join(891810..891916,891994..892100,
FT                   892236..892324))
FT                   /codon_start=1
FT                   /locus_tag="CNH01030"
FT                   /product="NADH dehydrogenase 10.5K chain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44988"
FT                   /db_xref="GOA:Q5KCH4"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR016464"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH4"
FT                   /protein_id="AAW44988.1"
FT                   /translation="MSSFAKQIPKAVKEIRLHFCQTSAASAGVRQFVQSSYPAVKSANP
FT                   DLKFLIREASNISPRAFVRFERGVESEAQLANLSEPDVGKVLTHLVNQQSGAGVA"
FT   gene            894073..896875
FT                   /locus_tag="CNH01020"
FT   mRNA            join(894073..894834,894887..895633,895686..896875)
FT                   /locus_tag="CNH01020"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(894420..894834,894887..895633,895686..896527)
FT                   /codon_start=1
FT                   /locus_tag="CNH01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH01020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH3"
FT                   /protein_id="AAW44987.1"
FT                   /translation="MKDVVPAVSSTPKAAKFIEYLKTTSTPENQENANSSNNEDLSATA
FT                   RRGPKPAVWNYLPPPIEEEVKPRSKKSGWVDKDGNPLPDAPPRKKSIINIIEEKEAQEE
FT                   KRAKKAAQAKEKRKRTIEAKKKKKTEEKIEFGLLPKGAGPTEEYPILLALDKQKSLPTK
FT                   SQAKLKNGEVTRSPRPKHNIVEDINDLVYGPAKTRNGKGNTATDPIDLDHSSEISDRKS
FT                   RSDGSTSTLIGSSKANKSGVNAQIGRFSASKASTQRRLPFKESYPSSSNRERSQLGSPP
FT                   SLKQPQGLGTPHTDDTAVGCDSMEHPSTMTRIPSSVTQAGDKSTTTASGLPYSSPLAGR
FT                   GKILGHIRGGKLKGKGKLIEYLPESDLEPNLEDFKSLDVERLERAAETYQSKEIHNPPS
FT                   PIIARPVPRQFQRLVPINRFQPPSRSPSPMWSTLPVPSKRKISSPSSSSKDSKAFTSNK
FT                   FRVPSLFPTTRKRSPAQSPSSPRKLTRLTLFTPTSKEEDACRPIPERSLYTINTIRGTT
FT                   YAPSVVHNDMPGGKSHRLVGIKGRLTLPPGRSGYPSRTNTNGLMTTWKNKNDQQTQISQ
FT                   NGYSGDPAYDYRDYQIRAGPSGTGNDYDEGYEDEAEGDKEDWQSAWKRRNSGGTGVAPG
FT                   QMMGRRRLERTSIEADEMDAAEQYIFQPHERY"
FT   gene            complement(896790..898128)
FT                   /pseudo
FT                   /locus_tag="CNH01010"
FT   gene            complement(898130..899591)
FT                   /locus_tag="CNH01005"
FT   mRNA            complement(join(898130..898418,898485..899591))
FT                   /locus_tag="CNH01005"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(898355..898418,898485..899050))
FT                   /codon_start=1
FT                   /locus_tag="CNH01005"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M620"
FT                   /protein_id="ALO69542.1"
FT                   /translation="MALYSQTRPHPIPVGVDSGATQHMFKGQHAFSDIRVLPEPIAVMT
FT                   AQKGTTTFATEIGSVTMIMDAGGTQISLLDLLYVPQLGRNLFSVSAMCHSEYTWRFDQK
FT                   RAYLQPNNDHSVTIASAPRVPPGQDLSAETWVSLPRRRVCSPATSPRLGDLFPRRSAAL
FT                   EPRIDRTGVDALYNLLSLPQRRCLKQLGHLCWNVQKGDPTAEDEED"
FT   gene            899761..901906
FT                   /pseudo
FT                   /locus_tag="CNH01000"
FT   gene            complement(902701..905320)
FT                   /locus_tag="CNH00990"
FT   mRNA            complement(join(902701..903008,903062..903394,
FT                   903446..903482,903539..904023,904073..904158,
FT                   904212..904376,904428..904645,904697..904765,
FT                   904817..905320))
FT                   /locus_tag="CNH00990"
FT                   /product="myo-inositol transporter 2, putative"
FT   CDS_pept        complement(join(902764..903008,903062..903394,
FT                   903446..903482,903539..904023,904073..904158,
FT                   904212..904376,904428..904645,904697..904765,
FT                   904817..904951))
FT                   /codon_start=1
FT                   /locus_tag="CNH00990"
FT                   /product="myo-inositol transporter 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00990"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44986"
FT                   /db_xref="GOA:Q5KCH2"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH2"
FT                   /protein_id="AAW44986.1"
FT                   /translation="MSSTPSQLDKDTGLSKFVENANEIETIEDTGVPPIKPSGFGGHLI
FT                   DENLVKVEGEDKVTPYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSVLSSSQQ
FT                   EIITAGTTIGAIFGSAILGGWGDRLGRKVAILIADFFFTVGAVLIAASYSVPQMIVGRI
FT                   VLGVGVGGAAAIAPLFITETAPTAVRGRCIGVNAFFIPFGQVVSEAIGAGVQDMKNGWR
FT                   LLFALGAVPSLVQLVLFHYLPESPRILILRGQTDRARHVFSSIYPNATPEMIDYKFRVA
FT                   QEYVAATTALQSGTTYWQRAKTLFTKGSYRRSIVTVSLIQMAGQLSGFNTLLYYAGTLF
FT                   GLLGLTNPALGGLIPAGTNAFFVLVGMTLVDKVGRRGLLMFGVPIMLAGLVWNIVAFHY
FT                   LCIPTGGLLDTSYTYDTKLVGIVIGGIVFFTTGFGLTYSHLAWYQSEFLALEVRSVGSG
FT                   IATTANWVANLVVSVSYLTELETLTPSGTYGLYLGFSVVFFIFAIFCYPETKQLSIDET
FT                   SLLFEEDWGVKRSRQMRRERREAQRRLADSEMTEVVTAHVQAQKQKDSAVTRSELDNFM
FT                   ARLKNGGRRLSVPQ"
FT   gene            complement(906523..908692)
FT                   /locus_tag="CNH00980"
FT   mRNA            complement(join(906523..906744,906801..907517,
FT                   907565..907582,907638..907710,907762..908035,
FT                   908094..908438,908494..908692))
FT                   /locus_tag="CNH00980"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(907786..908035,908094..908230))
FT                   /codon_start=1
FT                   /locus_tag="CNH00980"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00980"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45242"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCH1"
FT                   /protein_id="AAW45242.1"
FT                   /translation="MISMIPGKLSTNEDLRKATIALGSSHSGCRYIRGALEAKQGFIVG
FT                   QRRICSSLQSLYPHDERNNFGKKIISRFPIISRGSNGQWSCDGHDKLSAWGFQFCGIRD
FT                   VWSGYLILISCYPIIEWERISSGY"
FT   gene            909343..912612
FT                   /locus_tag="CNH00970"
FT   mRNA            join(909343..909913,909965..910528,910578..912612)
FT                   /locus_tag="CNH00970"
FT                   /product="transcription factor PacC, putative"
FT   CDS_pept        join(909538..909913,909965..910528,910578..912391)
FT                   /codon_start=1
FT                   /locus_tag="CNH00970"
FT                   /product="transcription factor PacC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00970"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44985"
FT                   /db_xref="GOA:P0CS62"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CS62"
FT                   /protein_id="AAW44985.1"
FT                   /translation="MAYPTLPPNLLSTPNTYSDSVSPTDPEPITPELVSREPEKPAQKA
FT                   AKTAMNNTSTASKPSESKGETLPCKWTGCSHISDSPDELYDHLCTVHVGRKSTNNLCLT
FT                   CGWENCGTKCVKRDHITSHLRVHTPLKPHPCAVCGKTFKRPQDLKKHERIHTAEHHQLH
FT                   KLSKAPTTADPEFNSRVSLSSATRIDRPRSPLSTSLSPTSTSSHSLHSSSSPFDHLLAT
FT                   GFHTDKSVSPTPSALALLHKKQHEELAAYQQKEMLVLQQLAFNQQQSQAYAARLAAEPF
FT                   GTGAGAKRGQADAFHDLLSDVKKRKVEPVYDQDMIHRLNALVPPSLPTSFPTLPSLGGY
FT                   NQYQTFPSFNGYPSLPSLHTSIYPTTAPQAQYSNQSPLPIPEIKTEADLAMFNEFMISL
FT                   GRDAAANKAGPHPMTQSASGSGASNGYSASNSGTPLSETSGGVEDLFNAEELASLGLAG
FT                   MPGISIHSGGSHNSNDESTHSLSDASPPAVSFGGLYPSLDAMRNRTNSAPDVSALSGAA
FT                   RRPIAGLPRTSMGNAHNTSTNQSTKPSYLSGMFGHSSSQQYDGTTHNYLHGLSNEHHND
FT                   YSHSANNGATNAYASFDSLARNKQSFPAATLAPKMFHNKVYRDVAPLGTAVSKRARESA
FT                   ERTNVEDSDREELYADQESNHGYAVSNERAREERTPKIPVRSLIASIRTLSPSTAADGE
FT                   DDLKLPAISPSHVEPGTDLPPLYSIQRGGHSSGQYRRASSLSSNSTSTSGSSSFNSSLA
FT                   PSNVASGTTTPRGSTPPRGVPTKRHTEDEIVRGVKRLELGPAEPLRSTTPELPDSGTTE
FT                   QALERDQKPDISALSLSSSPTPPSNNPPPSVSTANEEGKDMTIEEMRRRHAALIKSWLV
FT                   AVNLQWRRKKMEEMQRQQREEMEELEEGGEAMNVDERERERVEVVA"
FT   gene            complement(912754..914328)
FT                   /locus_tag="CNH00960"
FT   mRNA            complement(join(912754..912962,913046..913096,
FT                   913166..913227,913314..914328))
FT                   /locus_tag="CNH00960"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(912860..912962,913046..913096,
FT                   913166..913227,913314..914189))
FT                   /codon_start=1
FT                   /locus_tag="CNH00960"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00960"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44983"
FT                   /db_xref="GOA:Q5KCG9"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG9"
FT                   /protein_id="AAW44983.1"
FT                   /translation="MSTKPRAQTKPTISSPTPLLPLSLPSSPSKRQRTRVPRTVLKLVV
FT                   GVGVLVYLVWLGAFLWERAVLSPGDAGGFALGSGSFVYTQEKEGVRGEGEGIMSDKPEA
FT                   YVTFLSSITDPWYFLSTRLLLYQLHHHPHTSDPLRPLVVLTTPQIPAEVETQLEHQGAE
FT                   VKRVELLVDGFPIPEGMGDNHHWKDQYTKLHIFNLTDYSRLLYLDNDILLLQSLAPLWE
FT                   TNLPTVKTGGVAGVGERNKLNMVENDKRTRPEEGEVKDYLNAGFMMITPDEKRFGELRK
FT                   VRGYKPFYMEQALLNHYFDWEGAHPWEELDPLSVSHFPQKEDLARGYYALHAKMWKDEI
FT                   DKEVVDYWEESVKDMELFWGSSR"
FT   gene            914352..916262
FT                   /locus_tag="CNH00950"
FT   mRNA            join(914352..914578,914629..916262)
FT                   /locus_tag="CNH00950"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(914562..914578,914629..916189)
FT                   /codon_start=1
FT                   /locus_tag="CNH00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00950"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44982"
FT                   /db_xref="GOA:Q5KCG7"
FT                   /db_xref="InterPro:IPR013178"
FT                   /db_xref="InterPro:IPR016849"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG7"
FT                   /protein_id="AAW44982.2"
FT                   /translation="MLVPSHLRDHLLHSLSPLPNTQPLGLTVLASQPKRTRELFPHAVH
FT                   PPKCTQQEWLVVFDSEMETDKVSIKDAGDGKSAKHPRVLIAAISAHLYTFSPSVPSVLY
FT                   ISKVDSSGYSSSATPLPLTRHLIRSFILFFLAHCPALRVQLFARAQRQYLFANSADWKG
FT                   KKVLGGAGLCKWWKGVYEDVVSSWASSSPSPGPAGSTGLKLKVEKQAMKLRFILPGYDE
FT                   QEAKALLGAGRPLPEGVEWTYTPPFTSPLIPSASGSGSGSDPKISLATLIPSLPDDPKT
FT                   RFLQELVSEHPRPPTSSATAKDEQGGQEISNDGSGPGTGRGGREGGKEGKTRKLHEAEE
FT                   DAAQRKFAENILHSVGIAEFWERMGFRQECASGDVTGFFTLESVTEVESKRKSEESSPD
FT                   ATTPIATAAAAATPAIAKNALLPQAITERLLTALTNLDFASPSLAIEGSTIWLEQTRSI
FT                   VVGEVGKVGWDLCVGRIEAKAGQAGQTGQANMGVGDGGAREGAGEGVRKREEVVTMLQP
FT                   RKKKKVVQ"
FT   gene            complement(916239..919261)
FT                   /locus_tag="CNH00940"
FT   mRNA            complement(join(916239..916472,916558..917006,
FT                   917078..918030,918082..918248,918302..918425,
FT                   918469..918547,918605..919261))
FT                   /locus_tag="CNH00940"
FT                   /product="transcription initiation factor tfiid 90 kda
FT                   subunit (tafii-90), putative"
FT   CDS_pept        complement(join(916337..916472,916558..917006,
FT                   917078..918030,918082..918248,918302..918425,
FT                   918469..918547,918605..919210))
FT                   /codon_start=1
FT                   /locus_tag="CNH00940"
FT                   /product="transcription initiation factor tfiid 90 kda
FT                   subunit (tafii-90), putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00940"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44981"
FT                   /db_xref="GOA:Q5KCG6"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037264"
FT                   /db_xref="InterPro:IPR037783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG6"
FT                   /protein_id="AAW44981.2"
FT                   /translation="MSQSPDPSSVKGGAQGQLAPKSSTPTQQPPLTDSKLLRQFVMEYL
FT                   QSHGFDKALEKLTEQVEDANLSTTASAAVLGDADVSKEVADGKATAGEQGGEKEAIFRA
FT                   PGPVPLESNIKRNIPQAQAVSASTMSDRITPEFEAQAKYIIEQLQKKVEAVQEEGGDEK
FT                   EKELRDGIPVDGAMVDVSDKVAGYEAYRRWVDGGLDVWKAELDNLSFPLFVLSFLDMIH
FT                   SGFLKTAREFFEKHSAHHRELHSQDLSSLSSVSTEEHIKRNPFCARILSEKYVVPLSRN
FT                   AYDLLLQWLSGASLDDEWEAGLHSAPGRQKEAIKLIVVSHLNITVTNDSAPLDKVTIAS
FT                   KSGLISSSLPPNTNIDAFNTATQLKLGPPPMTEKLKEQVTRTLQDEGEAQGANGDANGD
FT                   IDMTSPFPTNEPVIKLEPETERDPSVISPDESETLPPIPAVFRIADLKREVEAIKDKRK
FT                   MIRLGPSGSGASAGSGVLPSVVAFTLFDHGENANSVEFSRDSSLMAVGSSESCVRLWSL
FT                   KGDKLKKKKVDIEGNLVEDEGLPMRKLVGHSGPVYSLSFDPLYGSAGPPSTLLSSSQDG
FT                   SIRLWSMDTYSNLVVYRGHGKDPVWDVEWGPMGVYFASASRDRTARLWSSDRVAPLRMY
FT                   TGHLSDVNCVKFHPNSLYLATASTDTSCRLWDVQRGACVRLFLGHTDSVTTLSISPDGK
FT                   TLASAGLDSSIWLWDLGSARPIKKMEGHTGAVTSLTFSAESSVLVSGGLDGTVRCWDVK
FT                   SAGGERSVDGMFGGGDARRGEERGGLPMNPGDVWDTAPHTPDLLATWPTKRTPILKTHY
FT                   TPRNLCMVAGSFVPPSNHRTSGGEK"
FT   gene            919407..921319
FT                   /pseudo
FT                   /locus_tag="CNH00930"
FT   gene            complement(919499..920239)
FT                   /locus_tag="CNH00935"
FT   mRNA            complement(join(919499..919684,919758..919833,
FT                   919889..919925,920051..920239))
FT                   /locus_tag="CNH00935"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(919677..919684,919758..919833,
FT                   919889..919925,920051..920175))
FT                   /codon_start=1
FT                   /locus_tag="CNH00935"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Z0"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR036284"
FT                   /db_xref="InterPro:IPR041848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z0"
FT                   /protein_id="ALO69543.1"
FT                   /translation="MSMRTTKATMTELKLRRLIEHNHRLREELARPRVTVSVASMNLIN
FT                   YCRATKDPLIPSVWGPLPKSDDPYAPLEQAVCCSVM"
FT   gene            complement(920244..921383)
FT                   /locus_tag="CNH00933"
FT   mRNA            complement(920244..921383)
FT                   /locus_tag="CNH00933"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(920390..921223)
FT                   /codon_start=1
FT                   /locus_tag="CNH00933"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Y7"
FT                   /protein_id="ALO69544.1"
FT                   /translation="MSSTSPYSAATQHTLTKSLALIAPSILEGATKYITNPTARDKMTE
FT                   DTIQQLKSGIPEVATSIGSQSPRHMILHVKTPTYHSKLRDSGLQTTVTYSWSTRHPTKA
FT                   GRSAQTVLARFVPEVWFGASSIGSRPVLSATPSSGPSREEYSEELESIAAGMLTECLED
FT                   IIDEDGDDLGASFETALELMAHKCKQGSAAICQSMGASVIDGLDGEGDPYTFFFETDNC
FT                   SLTPGDGGSLSFTGHVTGEGWRNADDEKPEKFNLRPADWNFAVSAEEVRSAKNLL"
FT   gene            923615..926032
FT                   /locus_tag="CNH00920"
FT   mRNA            join(923615..923905,924129..924280,924340..925165,
FT                   925234..925606,925675..926032)
FT                   /locus_tag="CNH00920"
FT                   /product="asparagine synthase (glutamine-hydrolyzing),
FT                   putative"
FT   CDS_pept        join(923737..923905,924129..924280,924340..925165,
FT                   925234..925606,925675..925933)
FT                   /codon_start=1
FT                   /locus_tag="CNH00920"
FT                   /product="asparagine synthase (glutamine-hydrolyzing),
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00920"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44980"
FT                   /db_xref="GOA:Q5KCG5"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG5"
FT                   /protein_id="AAW44980.1"
FT                   /translation="MCGIFCCFNRAGDISQYRARAIACSKRQRHRGPDWSGCYMTNNTV
FT                   LVHERLAIVGVDTGAQPLTNEDESLVLAVNGEIYNHVALRKSLKNKDAVFKTHSDCEVI
FT                   MHLYKEHDTGLCNMLDGMFSFVLVDKSVSPPRLIAARDPIGITTLYMGWNSQSPDTLYF
FT                   ASELKCIHEECDNLQAFPPGHFYDSKEKKLTRYFNPSWWDSDKGVVPHNDIDYKLLRET
FT                   LEAAVKKRLMSEVPYGVLLSGGLDSSLIASIAARETDKLAEEQEKLRQERKQAIASGKW
FT                   VGDEQPLASWPQLHSFAIGLPGAPDLIAARKAADFLGTIHHEYNFTVQEGLDAIPEVIH
FT                   HLETYDVTTVRASTPMYLLSRKIKAMGVKMVLSGEGSDEIFGGYLYFHAAPTAKDFHEE
FT                   CVKRVKNLHTADCLRANKSTMAWGLEARVPFLDKTFLEVSMNVDAKYKMFSKGTHQEVD
FT                   EDGRPKMEKYILRKAFDCSPEGKAYLPDSILWRQKEQFSDGVGYSWIDGMKDHAAAIVS
FT                   DEKFANRATRWPLDTPDTKEAYWIREIFEHHFPTEAAAKTAVRWVPKQEWGVSSDPSGR
FT                   AVSIHTAAYADGEAKA"
FT   gene            complement(926641..928198)
FT                   /locus_tag="CNH00910"
FT   mRNA            complement(join(926641..927142,927190..927475,
FT                   927528..927628,927784..927829,927967..927985,
FT                   928066..928198))
FT                   /locus_tag="CNH00910"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(926986..927142,927190..927475,
FT                   927528..927628,927784..927829,927967..927985,
FT                   928066..928137))
FT                   /codon_start=1
FT                   /locus_tag="CNH00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00910"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44978"
FT                   /db_xref="GOA:Q5KCG4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG4"
FT                   /protein_id="AAW44978.1"
FT                   /translation="MHVSNLVALAALAGSAAALTINTPASIVECQPASITFSDGTSPYI
FT                   LAAIPGGQVSAAAIETINDSLTTSPYTWTVNLAAGTNITLKITDATGTIAYSSPIVVQA
FT                   GSSQSCINATASTSGLSTAAVTTTASDTSAAGGGAATTSASESSSSSSAAQSSSEASSA
FT                   AASSSSSASSAASTTAASSTGAASSATSAAATSASGTSGAFANAVVGVPALVAGLFAGV
FT                   AALL"
FT   gene            928381..929885
FT                   /locus_tag="CNH00900"
FT   mRNA            join(928381..928535,928591..928831,928956..929091,
FT                   929200..929569,929630..929885)
FT                   /locus_tag="CNH00900"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(928446..928535,928591..928831,928956..929091,
FT                   929200..929569,929630..929815)
FT                   /codon_start=1
FT                   /locus_tag="CNH00900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00900"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45280"
FT                   /db_xref="GOA:Q5KCG2"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR007728"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG2"
FT                   /protein_id="AAW45280.2"
FT                   /translation="MLPIQKDVSMGAEPLPIPISHLSTPIRHFTYITDSELGHGAPLSI
FT                   THPLLPDCDHLKQPPSSPISSTGSGSSSDAEDVWTCTCTSYYESEKQTYLCSAECGDLC
FT                   DCVAQFGNFYSSTNPQTLKLDALPDNWPLVECSPSCLCGLSCSNRVTQQGVRTPLTIRP
FT                   TPPKGYGLFYTPSTPQFLPRGAFISLYAGEYILPSEIRSRWSPRSTTDLASDKEGYGEE
FT                   GQGNYVLSLRLPDQTIHIDPRWKGNVGRFLNHSCGANCVVHYVKWGRGRGWPRAAIFTN
FT                   RDIHPEEELTFDYANASGEPQRAIQLIQESKTKEDTKGRTRCLCGAEQCRGWIPFDETL
FT                   "
FT   gene            930005..933287
FT                   /locus_tag="CNH00890"
FT   mRNA            join(930005..930158,930232..930343,930401..931113,
FT                   931168..931273,931335..933287)
FT                   /locus_tag="CNH00890"
FT                   /product="expressed protein"
FT   CDS_pept        join(930245..930343,930401..931113,931168..931273,
FT                   931335..933215)
FT                   /codon_start=1
FT                   /locus_tag="CNH00890"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00890"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44976"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCG1"
FT                   /protein_id="AAW44976.2"
FT                   /translation="MKETPAPLSGHIVYLAPKQFQKCVVPYIARKVENMGGSVGSKPNE
FT                   ATIILVNPSHPKSKDGSVKPLKDQLVRPYHWLTYCATRSILVKLEDMKYQEPIFTYPSQ
FT                   KQDWRPLRAYVSRNLNPLNFGEDRATAQLSCMIQLELGGALVVDKRCDADLIILDYNSG
FT                   FAKTAMEEKKRFRRFEQRLRDRDWMENCWRTRKLSWEEDDNEKEQKSLEKEKSPKGGKK
FT                   KNAKKNEDVRVDEASDAGEKAEREAREDSFADEEADHMMRKKIGRPIGKPRIDYTHEDD
FT                   DFLCRYLAAYHPGGSWASRKTYQMLMHSGFDIASRHSYQSWHERFKKNSSSFSARVERY
FT                   IKAGIARETLKTEKELKNFRRPNQEDAAADSQGESSVSPLKSNKRKLVSEDDLDNEDAD
FT                   DNVPLRSTRTVKKAKKEGKSPIDPNTNVPSAVKDKGKARAPTPSQTPSISSTKGSSQQS
FT                   QLEITKVFTEFTDLNPRGGPSDTRYSSRNPQSTSQSEHRLSLLSQSHARRKSGSEDSGR
FT                   TPDLGAADEPEPAGVYEDPPVFIETVVQKLPDEEEQRLLQTKQQFGKGQAEKDDMAMDA
FT                   EEVNDLLITALTEDEEEPKRGEVDGEANKQGVAEAMVEMTEVDVEKSEGTSAAKRSEVR
FT                   VEISASPRVRVGKQADEPHQPTFPRSVSPPMDIQPATELVRRKTASESPAKMSAQGYSQ
FT                   SDEAVDLPQPVEEKESSSADTAPVQAQPALLKLIPSPVHTAIDSDADHHTNHTSSTSFH
FT                   TPQSSKHRLGRPRPSLLREQILASSTKRRRTQDRLSLSTSSVAGTGAFHKSPVQVVEYD
FT                   TVYADNAIPPRPPRPSLDTASPITPSVQAENGTAERRPAPPPKPLTWEERSAKVAAGAD
FT                   LAAHMRKQYREKIVDLSNKYGLTVSEVVTRISKLKAGGAKGEHYWDDVEKGFEQALGRK
FT                   VN"
FT   gene            933417..935498
FT                   /locus_tag="CNH00875"
FT   mRNA            join(933417..934524,934588..934644,934726..935498)
FT                   /locus_tag="CNH00875"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(933516..934524,934588..934644,934726..935414)
FT                   /codon_start=1
FT                   /locus_tag="CNH00875"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M6A0"
FT                   /protein_id="ALO69545.1"
FT                   /translation="MDRRRVTKPTYQPPHLRRPQIPSGVANKQGGWPSTHGNPYANGSV
FT                   SDAGVEVDSTYGGCPSTSTNPPRVRGASNTRFPTQTEASFTRNISRPGEGGGRPPRAGA
FT                   GLAAPGVSDLSSPVGPSRSEQRMSRPSMSRGSEPIPGSSKTSLIPSQSTSRSAICARPP
FT                   STPQILHDRYTSRPSRRDWSAPSPSAPFIPSSSTTASVPAPSRTFLQQRDRSALESSAD
FT                   DIKPMRSRKEEKWTGNDKEGVMEMEMMQSVSRSGGDGAEGDALKNWRTQEKYRQYIAEK
FT                   VESHYRKYGTPLHTLPILPAGSAIGKDERKENRKGKELARAGEELESFGSLVLLFRKLR
FT                   EGVVASGRIDSFAIEVFESSARFAILSNNRPQLLSALSGLVPGLYKAYDATKIRSGEDS
FT                   LSDRISKLDLEDRGLRDNRVEFTSLLLLYHLVTSGQIAFNELWLELTAPVKRQLRGKFE
FT                   KNERVTPQEDTSFLRMEELSFAKVASTALSSNAFNPLVFFSLVSPASNAWSSRGSPYEK
FT                   IILSWAIPQVREEGWKRLVKCYMSVDIPWIASILGQSARNEEETVVMENWVQEKGKKVE
FT                   QGRVSLRN"
FT   gene            939956..943554
FT                   /locus_tag="CNH00870"
FT   mRNA            join(939956..940092,940227..940305,940429..940492,
FT                   940941..941630,941728..943554)
FT                   /locus_tag="CNH00870"
FT                   /product="RNA polymerase II transcription factor, putative"
FT   mRNA            join(939956..940092,940429..940492,940941..941630,
FT                   941728..943554)
FT                   /locus_tag="CNH00870"
FT                   /product="RNA polymerase II transcription factor, putative"
FT   CDS_pept        join(941131..941630,941728..943180)
FT                   /codon_start=1
FT                   /locus_tag="CNH00870"
FT                   /product="RNA polymerase II transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00870"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44973"
FT                   /db_xref="GOA:Q5KCF9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF9"
FT                   /protein_id="AAW44973.1"
FT                   /translation="MSFAAPDDRAYYNYSRAPGSAHGPGHESTSPDQRLPSSHGYNKGA
FT                   SAPNESPNQVYHPEMAGPPGSSHSYPPQPMTPLTGSSAYPPQHPPSGSYYLPPQQQQQQ
FT                   QSEQPIPSPPSSSNRPPSATGYTPDGQPIIPVGVSGGKMFRCRGYGDCDKVFTRSEHLA
FT                   RHVRKHTGERPFPCHCGKAFSRLDNLRQHAATVHAEQAQLNETMLASLAPIHAALSQRA
FT                   SREQRRRGEVVEVPKGAVERRRETRKAQAAQAAAAAQAAATNGHSQQNSPYAQYHESQW
FT                   NAPPHPRPRTNGGYDYPYVPEHSLNDDAGPSRRPSSSAGYGYQQGYYDSARPPTAPGSG
FT                   SSGESMSGLPYPYRPMSASGRELPVPAHYSESEPPAPAHGPPPQSPMYGNVPPAQQQPP
FT                   NWSSPPGHGTYPPHDTAAYPPPPEGYYPPAHAAHGSYPPREDVYEYHPPGWQGQYPPAA
FT                   ANGGPYAQGYGTGAPPTAPPPHESPFQYNVPNPGAEGYPYQNYDSRKRRAEDDFGKDDR
FT                   KHPRPSSSSNSQLPDSSTPAHANGAHGAPHPHPHPGAAPGNGAMDPPRPHDPNWLPATT
FT                   ERRGSLAISALLGSPPKAVRSRPSTADGGTAGAHGYESYHYDPHGQVSDDQQTDGDKER
FT                   EEKGEVKKHGDKKKL"
FT   CDS_pept        join(941131..941630,941728..943180)
FT                   /codon_start=1
FT                   /locus_tag="CNH00870"
FT                   /product="RNA polymerase II transcription factor, putative"
FT                   /db_xref="GOA:Q5KCF9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF9"
FT                   /protein_id="ALO69546.1"
FT                   /translation="MSFAAPDDRAYYNYSRAPGSAHGPGHESTSPDQRLPSSHGYNKGA
FT                   SAPNESPNQVYHPEMAGPPGSSHSYPPQPMTPLTGSSAYPPQHPPSGSYYLPPQQQQQQ
FT                   QSEQPIPSPPSSSNRPPSATGYTPDGQPIIPVGVSGGKMFRCRGYGDCDKVFTRSEHLA
FT                   RHVRKHTGERPFPCHCGKAFSRLDNLRQHAATVHAEQAQLNETMLASLAPIHAALSQRA
FT                   SREQRRRGEVVEVPKGAVERRRETRKAQAAQAAAAAQAAATNGHSQQNSPYAQYHESQW
FT                   NAPPHPRPRTNGGYDYPYVPEHSLNDDAGPSRRPSSSAGYGYQQGYYDSARPPTAPGSG
FT                   SSGESMSGLPYPYRPMSASGRELPVPAHYSESEPPAPAHGPPPQSPMYGNVPPAQQQPP
FT                   NWSSPPGHGTYPPHDTAAYPPPPEGYYPPAHAAHGSYPPREDVYEYHPPGWQGQYPPAA
FT                   ANGGPYAQGYGTGAPPTAPPPHESPFQYNVPNPGAEGYPYQNYDSRKRRAEDDFGKDDR
FT                   KHPRPSSSSNSQLPDSSTPAHANGAHGAPHPHPHPGAAPGNGAMDPPRPHDPNWLPATT
FT                   ERRGSLAISALLGSPPKAVRSRPSTADGGTAGAHGYESYHYDPHGQVSDDQQTDGDKER
FT                   EEKGEVKKHGDKKKL"
FT   gene            complement(943711..946509)
FT                   /locus_tag="CNH00860"
FT   mRNA            complement(join(943711..944154,944221..946003,
FT                   946050..946509))
FT                   /locus_tag="CNH00860"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(944046..944154,944221..946003,
FT                   946050..946200))
FT                   /codon_start=1
FT                   /locus_tag="CNH00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00860"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44972"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF8"
FT                   /protein_id="AAW44972.1"
FT                   /translation="MTLLSKPSRSYANVDHDAEGLSAVGSGPYSSTQQGKKLSKKGDGF
FT                   KTYRPPISETHLRRSLGYDPHPTSHFAPLPSAFQSHRIKKEQALAGQRAEADHLLQPGY
FT                   RSYHPSDEADSSVAPRRTAGGLGSLRPSPSTSSFNGSAAIGNGRRAAGVYMDSNGKLHD
FT                   TEYDPFAGVKDMTRAKSNRRSAFGSERHHRAGSSSSSSSDSGQASYRRPSHDMREEEEV
FT                   RRKLQIERQQMDDVSSYVARRKSLLSEREGSGRGSPSIRSSEDGPPTGGSFVTARTRSQ
FT                   QGYYYPSPLSPSFATQGASFANGYPSRTPTASAFPASAGEGTPPEKSTEMTRAKSPPPP
FT                   PKYEPPPVERPKPKSKVEVKDGTTKIIGFDGPVRPISPNPPPTEQFSSLRVRSPSLSSS
FT                   SHHLSPPGAPASAAEGLSAASRSSADLTRQMRSPRPIERRHQARDDIYPETPAQTKRRQ
FT                   EREQRRLVSGHGPPAHALPPSASHNTALAVDTALAENGGARILPEIEIVEDDDPRIVFP
FT                   KEGKTTRVQKTHDHVIKGPFSHALQARKGSHASSTALNTFASAGNGGFSSAIGHSSSIH
FT                   DFSSLTRPKSLTGSKPGSSVIDDAGGYLPSRWASGDKNLRVTEDEREKYRPREWGGKYG
FT                   DLGGRENEWRPTPKDQMKRNLKDIATSARFSLYRTKKKLLRKADL"
FT   gene            946706..951583
FT                   /locus_tag="CNH00850"
FT   mRNA            join(946706..947617,947654..948368,948407..948865,
FT                   948928..949337,949407..951583)
FT                   /locus_tag="CNH00850"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(946917..947617,947654..948368,948407..948865,
FT                   948928..949337,949407..951489)
FT                   /codon_start=1
FT                   /locus_tag="CNH00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00850"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44971"
FT                   /db_xref="GOA:Q5KCF7"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR035899"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF7"
FT                   /protein_id="AAW44971.2"
FT                   /translation="MKSLFSRLKHLNDKEKPNPSSRGKEKERLSILKPRSSSSVSGATP
FT                   PLQSREHIEEPPEEILVGDFENQVTDGFTSGPPDTTEETRNPIANVERKVTFKSPPPTP
FT                   AASVALNSRLESTSNPQEALPKRIDYRPDPISRASSSRQSFIHSFPRPSSSRKASLPSP
FT                   SLRGSSHTKLHSGVFSPSPSEMSLATGSTTSFLPVANSWSEMTDPDLVDNIGMQERTRQ
FT                   EVLWEIVSSEERYLNDLLAINEAFCKPLVHSSTSPRLDFFDPFHPLAHTRSATSPTSSS
FT                   YAPSIDGSSIHLPIASKFASTAPQFRSPSDSSTSSAAPLTPNEDLLGFGFCSAPSLGAG
FT                   LGFNSLNSNSARLTVSNTFTSAENRLLEKASTMSLKHQSLPPLPRAPSSAPSRAPSAVS
FT                   RKSFHKVSKHPRTSSSDIPSREDVELPEDLALVLKAINSGILEGHLKLTAALRRRYDEQ
FT                   YPLVRSLADIFIAHSYVLREYSIYVLHLEKALQQVTHALSHPNPPPPTSFSKAKRASFP
FT                   SARSSSARHPSALTAYLTHLESLALASGSPGLLISLSKPFQRLLKYPLMFQNLLYHTDP
FT                   SLKEYEKTAEMVEEIEGVMRALEDEKVGEEEREGTRDIWGRIAGLDGDKVLLVPKSNRL
FT                   LISETPVSEVSSSTANLRLSTDPPNSSDCAKPVRPKKSSRKLSDILKGQGGGKDELWVV
FT                   KFTDMSLLCAKTGTTTLPLSVSPKNGEKRSGNGAGRKGGGRERNMYKFVRVWAWHMDED
FT                   EGKEQGRKSAIAQNGSPRTSLSSRAHTLPTIPGTPHNHFASGRVQAQTHHCSGPSKLTP
FT                   SKVRSMGDLSPPQYDKSLGLDGLRGFARRSKSFGPTQKRLGEGGEGSEGEEKEDDDDEE
FT                   TVMSFVFGDGDILIPAEPRPRKKVVPKNARDRRVSGVAGSGLSRLDNTKGESDSRPVSR
FT                   MSGVALSSASGNANVKTATSVRPRPSALRSSTLPPATDSSASTSDPAIASTTTTAAITR
FT                   RHQPRAVSLATTTASANAKFANRLRSLPADRDAEGAYVSEGESVVRRGVGRGSMPPVMA
FT                   RAGSAASNVSAASRLSGPASVKGPPVMGSQPMNRAISHVTNRGNDNKKEGNETIRVRSS
FT                   SSARQRPWSTTLSSGDAIASGTSAAVSKRASTPASAVSMTIGRRSITPLSATSPTVTAH
FT                   PIKTAASVTAHATKTGAPVTASTISTRASSRMKPGVGRGRMSTPPSTVANANTDSAASG
FT                   NTGARAGISAATAARRARVSSLGPRTSTGTLTPSLKANPGAAAKAAVKPNTTASAESKP
FT                   ASAESKPAPASTLRLAPKPTITNGRATSATGVKPIIRAKGTPSPSPSPSVRTTASTCTR
FT                   TSTRTPQRKGIPTMSSMDTALVEVWKEYGNVDIDKLGSSTPGKAVPKEKAETPESVKAP
FT                   AGVRRVPAVGGGGRASGLDKSPVKTPGSVRNKAAPVRGRIGEMTKRRDVGKKI"
FT   gene            951738..953812
FT                   /locus_tag="CNH00830"
FT   mRNA            join(951738..951792,951853..952012,952083..952239,
FT                   952293..953193,953250..953812)
FT                   /locus_tag="CNH00830"
FT                   /product="cell cycle control protein cwf13, putative"
FT   CDS_pept        join(951776..951792,951853..952012,952083..952239,
FT                   952293..953193,953250..953739)
FT                   /codon_start=1
FT                   /locus_tag="CNH00830"
FT                   /product="cell cycle control protein cwf13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00830"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44969"
FT                   /db_xref="GOA:P0CR56"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CR56"
FT                   /protein_id="AAW44969.2"
FT                   /translation="MAALTRALPAPLHTSTTEYEEAPAPLPTTPGPQLPKYGQRKGWKP
FT                   KTAADFNGGGAYPECHVAQYPLDMGKKNKGQGSTLALQVDQDGLVRYDAIAQHGRAPGS
FT                   RVQSSFKDLVPLANRTDVTESERQMERPDDLSVAETAERTRLALERITHGKIKAAQPKH
FT                   VPKTNSDATYIRYTPANQSADEGKQRIIKMTEVQEDPLEPPRFKHKKIPRGPAEPPPPV
FT                   LQSPPRAATAQDQKDWMIPPCISNWKNNKGYTIPLDKRLAADGRGLQDVHINDNFAKFS
FT                   ESLYIADRHIREEVRARAQLQQLLAQKQKTSKEEELRLLAQRAREDRSGLSSSVSGSVA
FT                   AASASRLPAETGINLGGYGSESGSEEESDEEEEDEEAIRERNIVREEKRREREKEMRMS
FT                   NMGSEMRAKMLAKEANRDISEKIALGLAKPSASKETLLDSRLFNREALSTGFASEDSYN
FT                   LYDKPLFAGSSAAAAIYRPAGSSRNDESFGGGTEEGIKEEMSKDRFQLGNATRGFEGAE
FT                   GVEAREGPVQFEKDTIVALDGSADPFGVEQFMDAARRGGKRTAEDRDEERRKRARDE"
FT   gene            955041..957324
FT                   /locus_tag="CNH00820"
FT   mRNA            join(955041..955539,955785..955797,955876..955940,
FT                   955998..956028,956080..956092,956143..956472,
FT                   956533..956693,956739..957324)
FT                   /locus_tag="CNH00820"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(955533..955539,955785..955797,955876..955940,
FT                   955998..956028,956080..956092,956143..956472,
FT                   956533..956693,956739..957111)
FT                   /codon_start=1
FT                   /locus_tag="CNH00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00820"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF4"
FT                   /protein_id="AAW44968.1"
FT                   /translation="MSAIYTVFTSPHHAPMPNHLPTLIVTPHGQPNHILYTYLHTEENR
FT                   VNYLLTPSPQGDLCVAKLFPPPRPSAGHSSATLPTISHKQGPNAVRCEASRDLRWTIEN
FT                   TGVMSPIYKIVNQDDTPLYQISKPNPNAEFWTMFYFKYAGHQIPPKRIEFGKIAKNPPE
FT                   KGGGTRLSITGRTEDEKQVWQTLGVGNEDCVEWVVCCACLNLLDDEILRAAEKRANPNA
FT                   SGPSSSPASTLTSPASTAARPVPAPLQRVGPAPGPRSASAVLGPGIASSAPASTAPMQP
FT                   MGGHPAMNLAQTYRQNPPPMRAPPARPGQPVPQGYASAPPAGQPQRRRF"
FT   gene            complement(956864..958597)
FT                   /locus_tag="CNH00810"
FT   mRNA            complement(join(956864..957614,957681..957787,
FT                   957863..958597))
FT                   /locus_tag="CNH00810"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(957420..957614,957681..957787,
FT                   957863..958493))
FT                   /codon_start=1
FT                   /locus_tag="CNH00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00810"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44967"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017359"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF3"
FT                   /protein_id="AAW44967.2"
FT                   /translation="MPRLSSPFVQTQLSTLQILTSMYPSETTLTPSTAAFLEAFESGEG
FT                   EGIKRSEPLEAELSIKVDEEREEEVAIVISLPIIDVDLENRPPNTQAVGDAEPTPLTHI
FT                   RPKQPIWLPNSSYISVLSSLPSLSPEEEGSEYILTSIEHIRESLLPHLPKEGVEESDGQ
FT                   GKKQEIKRDEGPEQRVWFWFPTLSTKEKRNDIVQYAEEMGLTGFVLAGKPALLCVEGPG
FT                   LTVERYMSRIKSESWSDIPSYQKKVTERFRRPLIPPDHRAFSKMTEITHLIPKYGQYNH
FT                   RGEMSEVRRLMEEWGVGEDFGAAVLNSGA"
FT   gene            958743..961881
FT                   /locus_tag="CNH00800"
FT   mRNA            join(958743..958892,958942..959099,959157..959322,
FT                   959385..959589,959664..959772,959893..959920,
FT                   959984..960070,960124..960253,960328..960537,
FT                   960618..960757,960829..960943,960998..961092,
FT                   961143..961881)
FT                   /locus_tag="CNH00800"
FT                   /product="GPI anchor biosynthesis-related protein,
FT                   putative"
FT   CDS_pept        join(958773..958892,958942..959099,959157..959322,
FT                   959385..959589,959664..959772,959893..959920,
FT                   959984..960070,960124..960253,960328..960537,
FT                   960618..960757,960829..960943,960998..961092,
FT                   961143..961184)
FT                   /codon_start=1
FT                   /locus_tag="CNH00800"
FT                   /product="GPI anchor biosynthesis-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00800"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44966"
FT                   /db_xref="GOA:Q5KCF2"
FT                   /db_xref="InterPro:IPR007720"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF2"
FT                   /protein_id="AAW44966.2"
FT                   /translation="MDQQSIRVFWPITGVDMSEGKVVGWRLRDTLCVVGIVQDRLWNKV
FT                   LAQIGEEEDLVGLESIGRAVLDATKNTDVNEKQYIFWVNKERIPLSCSVPTILILYKPL
FT                   DSSRLQYLTPSSSSPDLHVSGQDRHDPRYQLTIGDDQLSAIVDLINKTRHVQQVLRSLQ
FT                   MESAAEGKKKRRKQASLPSAPRFLFALDTCAQITIFLFSISIPCSSSFRAISTSADQLC
FT                   TRMEQSIRGPIRYLTTRNDGGINDRAARYNVFWNTVWLVVNDLVLGYVAHNLIRRHSEW
FT                   ISTTTSTFFSSYVIDMPIHALKWLNDWPVGLKLNTPLSQFFCSTFTFLIQRWGDCVTPS
FT                   LHSLLPQLMYLLSILSLTGFTTLLAASHDILNLLTLHLLFGYNVMRAVCVWQIDSLGGL
FT                   WNLFRGKRWNVLRRRTDSYEYDIDQLFLGTLLFTVSAFLFPTVLSYTALFCLTRGMIFI
FT                   ICRVSEVTRQAMNRFPIFELILWIKEPSRVPGGLNITVQTVPLGDEGEKTEGRFIMRRA
FT                   LVLKSTPKALSDILFHQ"
FT   gene            complement(961196..962042)
FT                   /locus_tag="CNH00795"
FT   mRNA            complement(join(961196..961389,961459..961584,
FT                   961661..961704,961769..961837,961946..962042))
FT                   /locus_tag="CNH00795"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(961362..961389,961459..961584,
FT                   961661..961704,961769..961789))
FT                   /codon_start=1
FT                   /locus_tag="CNH00795"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Y8"
FT                   /protein_id="ALO69547.1"
FT                   /translation="MAVFSYTALNSACGSSSCSCSNGNSSDCSHGSSCGSCASNGRTLV
FT                   NECNSSGANGNCSTCGSPTCNCTSCAC"
FT   gene            963711..965921
FT                   /locus_tag="CNH00790"
FT   mRNA            join(963711..964113,964163..964282,964333..964397,
FT                   964449..965059,965104..965522,965586..965921)
FT                   /locus_tag="CNH00790"
FT                   /product="Endoglucanase E-4 precursor, putative"
FT   CDS_pept        join(963790..964113,964163..964282,964333..964397,
FT                   964449..965059,965104..965522,965586..965819)
FT                   /codon_start=1
FT                   /locus_tag="CNH00790"
FT                   /product="Endoglucanase E-4 precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00790"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44965"
FT                   /db_xref="GOA:Q5KCF1"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF1"
FT                   /protein_id="AAW44965.1"
FT                   /translation="MLIPFLALASLSRITTAQLTPSPTYSPPTSSAGLTASSETPNTQW
FT                   SNILGNSLWFYDAQRSGRLDEGTYGNRVDWRNDSALEDGSDWGLDLVGGWYDAGDYIKA
FT                   TFPLSFTLFALSWGALTHGQGYGLANQTAYLDGTLRWGFDWLMKAHPSDDVLFIQVGSG
FT                   DVDNNYWGGDQDIPSPRPGYPINSSYPGTDGWAAASAAFSLGSLLYTPGVSYRPTSSSS
FT                   PPTSPSLENSTYASQLLAHAESLYSVANSTTPRQTYYAALGDEVAAYASSDWRDNLCAS
FT                   ALALALATNNSAYYADAYNYYVQYGLSGTHEVWNWDSSQPAIYVMFAEIASAKPELAQG
FT                   AGLDVNLTGWQTEVENYFDGLIKEDFSNSYLTEGGLLYWDGDSDEASLNPAMAAAMLMF
FT                   KYAPMASSTDKTNSYNSFAQSQLNYLLGSNPMSVPYIVGQHPNSPSNPHSAPASGGFNI
FT                   NNIRDDPPTEAHVLYGAVVGGPLSSDQFWDWRDDWVQTEIALDYNAMIPTLASMQLMNN
FT                   TADPPYVDIAAGTYSIPSGQPCDAALPCRGGGGLSGGEIAGIVVGVIVGVVLLVIVGVW
FT                   WWWRKRGKRWGSKW"
FT   gene            966901..969092
FT                   /locus_tag="CNH00780"
FT   mRNA            join(966901..967785,967837..968656,968721..969092)
FT                   /locus_tag="CNH00780"
FT                   /product="conserved hypothetical protein"
FT   mRNA            join(966901..967785,967837..968544,968639..968656,
FT                   968721..969092)
FT                   /locus_tag="CNH00780"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(967114..967785,967837..968544,968639..968656,
FT                   968721..968795)
FT                   /codon_start=1
FT                   /locus_tag="CNH00780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00780"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44963"
FT                   /db_xref="GOA:Q5KCF0"
FT                   /db_xref="InterPro:IPR018618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF0"
FT                   /protein_id="AAW44963.1"
FT                   /translation="MPTESTTSEPPLPTSHTPAGVVKCSICGIGNLSQPMSIPVSDYFG
FT                   GSAVEFGERVCGRCALARGHGESDIQSQSQYENQSRDRERGWEKESEVRERGRGGVKQE
FT                   SGRTLDDVHEENETAERKGIVRDLKAPTFSQSLPSQLPQPWTTTKPVPSPPSNARGLAA
FT                   SPKPDAATRSKEKMNQPPNPLLDITRTRVRSIGRGPLYPGSVFKGTQTSGRSAYDVEVK
FT                   FLDVDFADSTLSGYLSISHLTDSHPHLTTFFTGEIIGPKYGFITGPRYAATEHDDLRHW
FT                   GRFEQFRRPSTRADLVGEELFLRDPLPDRSRGETKGKERDFVFLRIKEQFLVPDHKVKD
FT                   ISGASFAGFYYIMVDMAPTVTVPVSQPATPLSPTFKSPFVPGSPAISRRMSGTAMPALG
FT                   LGMGMGLGATIGAGVGPGMGMGGEQVSGIDRTRPARPSGTRKESGGRMREKEVRGEPTI
FT                   RGYYFHSLNQEPFQELFLSHVPQKSKYAFEFR"
FT   CDS_pept        join(967114..967785,967837..968544,968639..968656,
FT                   968721..968795)
FT                   /codon_start=1
FT                   /locus_tag="CNH00780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:Q5KCF0"
FT                   /db_xref="InterPro:IPR018618"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCF0"
FT                   /protein_id="ALO69548.1"
FT                   /translation="MPTESTTSEPPLPTSHTPAGVVKCSICGIGNLSQPMSIPVSDYFG
FT                   GSAVEFGERVCGRCALARGHGESDIQSQSQYENQSRDRERGWEKESEVRERGRGGVKQE
FT                   SGRTLDDVHEENETAERKGIVRDLKAPTFSQSLPSQLPQPWTTTKPVPSPPSNARGLAA
FT                   SPKPDAATRSKEKMNQPPNPLLDITRTRVRSIGRGPLYPGSVFKGTQTSGRSAYDVEVK
FT                   FLDVDFADSTLSGYLSISHLTDSHPHLTTFFTGEIIGPKYGFITGPRYAATEHDDLRHW
FT                   GRFEQFRRPSTRADLVGEELFLRDPLPDRSRGETKGKERDFVFLRIKEQFLVPDHKVKD
FT                   ISGASFAGFYYIMVDMAPTVTVPVSQPATPLSPTFKSPFVPGSPAISRRMSGTAMPALG
FT                   LGMGMGLGATIGAGVGPGMGMGGEQVSGIDRTRPARPSGTRKESGGRMREKEVRGEPTI
FT                   RGYYFHSLNQEPFQELFLSHVPQKSKYAFEFR"
FT   gene            969218..971481
FT                   /locus_tag="CNH00770"
FT   mRNA            join(969218..969341,969515..969593,969698..969777,
FT                   969875..970000,970089..970241,970365..970485,
FT                   970600..970720,970830..971005,971128..971339,
FT                   971392..971481)
FT                   /locus_tag="CNH00770"
FT                   /product="activator 1 41 kda subunit, putative"
FT   CDS_pept        join(969271..969341,969515..969593,969698..969777,
FT                   969875..970000,970089..970241,970365..970485,
FT                   970600..970720,970830..971005,971128..971292)
FT                   /codon_start=1
FT                   /locus_tag="CNH00770"
FT                   /product="activator 1 41 kda subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00770"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44962"
FT                   /db_xref="GOA:Q5KCE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE8"
FT                   /protein_id="AAW44962.1"
FT                   /translation="MSAFAPRPVVPIKDPKLQPWVEKYRPKTIDDVSSQDNTVAVLRKA
FT                   LASTNLPHMLFYGPPGTGKTSTILALARQLFGPDLFRARVLELNASDERGISVVREKIK
FT                   SFARETPRHAPAVSSDGKEYPCPPFKLIILDEADSMTQDAQSALRRIMETYSKITRFCL
FT                   VCNYVTRIIEPLASRCSKFRFKPLEQGSTRARMEMIAENEGVQTDPGVISLILELAGGD
FT                   LRKAITYLQTAQRLHSSIEPPMPVSALSIHEISGVVPEDLITDLLAAMGVDRQTGIDHS
FT                   LARGFDGVKIAVTRVEREGWSVGQVLEQIHDTLIPIPSIPAIQKSLAGIAIAECDKGLC
FT                   EGGDEELQLLDCMLRIKDIMGRQ"
FT   gene            971796..974413
FT                   /locus_tag="CNH00760"
FT   mRNA            join(971796..972634,972725..973258,973434..974413)
FT                   /locus_tag="CNH00760"
FT                   /product="expressed protein"
FT   CDS_pept        join(973070..973258,973434..974219)
FT                   /codon_start=1
FT                   /locus_tag="CNH00760"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00760"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44961"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE7"
FT                   /protein_id="AAW44961.1"
FT                   /translation="MLHPAKIHNTDFPTKRLRSCLSPTRTRHHSPSFLPSGEAAVAVTS
FT                   WKRVKTVRWQEENGCAVASFHDTYSHEEYDRTPLEPPTSAERDCVFPERGSRCLSGPRE
FT                   CFFGDFSDEEEDLPPSASDFSDSFIIHTPPPTETNSDDGEHSVRQGCDVDGEGEMQDGE
FT                   DGWDECMQRRRMMFARLCTRENGDRHPEFEGYRSLSATLAELLKSVGCDDEDGSIQEHG
FT                   DEQALEEDGDGEEVRQSRSRSLNIFGLPTLAQRSVTPTPTGTPSLVSTEESDTEYTIAS
FT                   PSMGTPADALSLNGFGFGNESMSLGQKALPIVMVERAQEVGMR"
FT   gene            974551..977038
FT                   /locus_tag="CNH00750"
FT   mRNA            join(974551..974934,975016..975185,975243..977038)
FT                   /locus_tag="CNH00750"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(974612..974934,975016..975185,975243..977038)
FT                   /codon_start=1
FT                   /locus_tag="CNH00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00750"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE6"
FT                   /protein_id="AAW44960.2"
FT                   /translation="MPAALSPSLTPSLSSEAHSPILRLPPELIDHLLTLVPASLLQLTA
FT                   LSLLKVFPEHNISKRHLWKHIVVYRAGQLMPLWKKLKENEAMRVGARTFALQSWQGDAD
FT                   ILNNVMRRLDNINTLMLNIGTNFAPEHLQEMFEGPRMKLERMELRFRPYVEQASYYQFL
FT                   AGSYFDTAIETLTRQWPVCPNFTHISIVQDLPPRSTAPNTARNSATSSLASSFADLRMA
FT                   NTAPASTAPSSDSEEASGVSTPPTSVDDPDLNPTDAGRSKAYTGHGPFGNPFLNEKLGI
FT                   TRPKHFAQPIVFFDIQCLANFGAAAVAANLTHLRLRVPSRDLARVLIMPPPRGSYNQAL
FT                   FPELRYLDISTTNVRLDTTLSALLKQYSKLEHLVLDRVNLFGFTAREKGLELCNDLGMV
FT                   IVNAGLTRSKEKERQIAAWEVAERVRMAEATAEAARQVEVGQREQDEHQGDRETEEDRR
FT                   AREAQEEIQRNLELMRSRRGHRSAAHSTFSLRERRRAGTSASTASSSANNLPLPPQDKL
FT                   YMVLPPLPTLKTICIGGEAHTLPANKVAQWEDQFHAGWMEGLERILGWATHLADKYDRG
FT                   KRKAEEWVVKERGKNGSGSNSTTGTGGSNAAKGRGKGKTSSSSSSAAAAKVLPKPPTDI
FT                   RLFRFPLPSETISRRNNEGEEENDETEHGKPGPFNLTSGLIEVVPSSPSDRSYLNPYRE
FT                   ALADAQLYKDRQEGVGAPCVFCTIPDCEGPARRGAEGEKVDGRGGMGGKHREECGHMVG
FT                   RRTWGWEGL"
FT   gene            complement(977141..978767)
FT                   /locus_tag="CNH00740"
FT   mRNA            complement(join(977141..977417,977507..977596,
FT                   977682..977739,977806..977896,977962..978146,
FT                   978198..978305,978371..978488,978543..978767))
FT                   /locus_tag="CNH00740"
FT                   /product="mitotic check point protein bub2, putative"
FT   CDS_pept        complement(join(977288..977417,977507..977596,
FT                   977682..977739,977806..977896,977962..978146,
FT                   978198..978305,978371..978488,978543..978686))
FT                   /codon_start=1
FT                   /locus_tag="CNH00740"
FT                   /product="mitotic check point protein bub2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00740"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44959"
FT                   /db_xref="GOA:Q5KCE5"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE5"
FT                   /protein_id="AAW44959.2"
FT                   /translation="MSTSTEIYGSLHSILSPALIPRHRSSSEISDGLKRIRRIILTEGI
FT                   PEVPGRPPLRPRIWKLLLKVDNLQAEDYLRWVSMGPSSDSHKIKNDTFRTLATDTQFKG
FT                   KVKEDMLIRLLEAFVWKITSAETEDESQPFKYVQGMNVLSAPFLFTMPSQLEAFQCFST
FT                   FIENGCPLYVQPSLKGVHKGLTLLDKCLEVVDPELYDRLASKNLKAEIYAFPSVMTLCA
FT                   CTPPLEEVLRLWDFLLAFGLHLNILCVIAQLLLIRQDLMDTPSPMKILRTFPPLEARPV
FT                   IGVTVALVKDIPEELYRELVAHPFSC"
FT   gene            978865..980576
FT                   /locus_tag="CNH00730"
FT   mRNA            join(978865..979023,979080..979115,979186..979309,
FT                   979456..979553,979639..979714,979770..980576)
FT                   /locus_tag="CNH00730"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(978994..979023,979080..979115,979186..979309,
FT                   979456..979553,979639..979714,979770..979900)
FT                   /codon_start=1
FT                   /locus_tag="CNH00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00730"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44958"
FT                   /db_xref="GOA:Q5KCE4"
FT                   /db_xref="InterPro:IPR021384"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE4"
FT                   /protein_id="AAW44958.2"
FT                   /translation="MLHEELSTDMDMITQLQDAILDLLTITSTSIEYITKRTQFEQTSI
FT                   SIPTTLSTPNAANRVEYKAAIETFVADIIRRSKDIQHLIDGLPRPGDSSERAQRLIELQ
FT                   DEIKIANEEYRQVLEQSKELVKELQLALDHTLGESPNDISIQSANYPAGTPYHNQNNEA
FT                   N"
FT   gene            complement(979922..986466)
FT                   /locus_tag="CNH00720"
FT   mRNA            complement(join(979922..980129,980219..980373,
FT                   980454..980523,980585..980655,980712..980726,
FT                   980780..980782,980862..980881,980944..981098,
FT                   981164..981348,981410..981491,981545..986024,
FT                   986077..986139,986191..986271,986371..986466))
FT                   /locus_tag="CNH00720"
FT                   /product="histone-lysine n-methyltransferase, h3 lysine-9
FT                   specific, putative"
FT   CDS_pept        complement(join(980084..980129,980219..980373,
FT                   980454..980523,980585..980655,980712..980726,
FT                   980780..980782,980862..980881,980944..981098,
FT                   981164..981348,981410..981491,981545..986024,
FT                   986077..986139,986191..986271,986371..986392))
FT                   /codon_start=1
FT                   /locus_tag="CNH00720"
FT                   /product="histone-lysine n-methyltransferase, h3 lysine-9
FT                   specific, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00720"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44957"
FT                   /db_xref="GOA:Q5KCE3"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR007728"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE3"
FT                   /protein_id="AAW44957.2"
FT                   /translation="MPGASSEVGAVDNPLVVDSSDSDDDLSVLPANGRVKPSDGKDRSY
FT                   KKSLTFMRESTVVDLTLSDSDDAVEFVNFPPGPNSTPDRVAQVGLPDKQPSPGRRPRPF
FT                   MSIANSSSSPEDQNITGLLENHSRETGELPSPPLVEDRAAPNGMKLDGENIVSQSNGIS
FT                   AAQAAVTTSRTSSLTSNLNRPQSVSGAQPAVASSSRSAINSPPRRYLLISQQSPSSRTT
FT                   PCRSAGTASPTSRPPTPPLPPTQSTPVTVSGLPAPLILSPVPAASSAISPTIPSIPLHA
FT                   SLPYPTLSLPPSATPALPNSFTLSASTILPADSSISALPSTSAAGLPVMPVFISPATSS
FT                   PAGPEPSTLQSASEATKSSNQKESPRKTDSKQAPSPSSTHGLWTNTRPFHASSNLSATS
FT                   GKSSAASSRSTSRTLLPSRVATSDNVAGPSKTTSVSSTHPPARAPSLSLPSEPERQVHP
FT                   RSPSHEGVGKREKKSKALSSGTGQSTPSRSSLSTYDVASNRKTKSTGLNALPQKPSSAG
FT                   KTSSIPQRTSTLATAMAIRPFVRSPTSPCRPSSFEASGPIQSSGGAVKAAQNQDKIHPL
FT                   STTSSISSHSRETTTKAATPSHVTISSPSPSQSTSASTTVHVTQDAQKSATTSPTREKI
FT                   HPSRRKSQTSDCVVAPTTSQTAASLSYPAGTSDGTGEADKKAAGTTVHAGPSSADFGTF
FT                   VVPPTTAIASTTVSPSVTPPEDAPFLKSGPTVHPLFRAASAIGGQDTLTETGAVGDVLS
FT                   QGSKGRASSPRITTTGAVSHLVLPIDVGSKIKPTAAPSLFASGVTIGNVDDQAAAQPQN
FT                   PAPLPSALSVLSKKNLGSSSKESSVKSAASSVSSSSTLGDSVSGLGRKSHHKSTQSIPQ
FT                   SPLPTTNTSNSSGIEVNSWLNPQPFGPSFAASHLNTHAKKKWKGKEREKEREKEKAREK
FT                   EKAKEENEQLRRRRMADLEKISANLEKYKGRMGVESRTRSIPRADGENRKRPPSPGISA
FT                   STDGEVRVVKRSKPAWAIAPENGHVAAAMEKETNDNKKTTDAIKINHQPAAFYTPQFAT
FT                   PTSAAKTTTTPLSVTAGLGPPVNSSSSSSTPSLLSRSINLDIPRETPEERMDDDDGNDS
FT                   TGGLLVRKTGKNDAVEEQVEQVRLDLDDVSIHGSSPVGPISTFTSRFRNVSITPSQTQK
FT                   ILEQPGEDVPIRRSAIKINGKQKAQRSKDKSDGSESEDDVPLNWPSRKGKGKAAPEPQD
FT                   NSETQRDDDGVNLGSSNGEEGSSDDHSNPVLPPFLFKDRPAHVRQPLQTLFKGGFVAKH
FT                   SYQRPLVKSSAVSPVPNANRTSSEPSAKAELLPQKRKRRPKKLTREQWHHIAQNHLSDV
FT                   DDLLDESSKKRLSPKSAEKLGADLSKLTSPRVFSIVSRSEPRSKGAPIEENDNEYFTDS
FT                   DSHTSDIALFLQHPDPPPPPERIREAKRNFGTRTIDPWNRQKHTFRSNPALHRAIFEAY
FT                   IMQSTSMEESGGDDIKVTNEVDADGGPPDFEFVYSDTMLYPDGIPPPELGLGCDCDGPC
FT                   DPDSETCTCVKRQELYFYDLGLKGFAYDENGKIRENSASIWECNELCGCPPECMNRVIQ
FT                   RGRAKDTGIEIFKTKEKGWGIRARSFIPSGTYIGSYTGELIREAESERRGVTYTAIGRT
FT                   YVFDLDGWQIRHPPKGLEKIDKRAAELAEAVKMRAKAAMRESQEDAYNAYSVDAFHYGN
FT                   FTRYFNHSCDPNLAITQAYVKDFHPERPLLVIFTRRDIKKHEELCISYKGIPDDDVPSP
FT                   EPVKKKKGNKGKKQMSKTSASAHPPEMIALNSDKGPVEVKDICRCGAKNCDGRMFNYGS
FT                   "
FT   gene            986548..987537
FT                   /locus_tag="CNH00715"
FT   mRNA            join(986548..986946,987000..987082,987138..987537)
FT                   /locus_tag="CNH00715"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(986588..986946,987000..987082,987138..987412)
FT                   /codon_start=1
FT                   /locus_tag="CNH00715"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Z2"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z2"
FT                   /protein_id="ALO69549.1"
FT                   /translation="MVNNGSNTSKSSQAKQPKQNSPKKQPQVPRQPDQPQILNKDLFQR
FT                   INYTYQAAIFLQDVGGGAGPSSSISVGDGDVHLVTDRKGKRRAVERAGDQGAFKKLARM
FT                   GMRETKTMVVHNQLKLDPSLKRSICRVCSTVLIPGLTSRIRNRPNRNTFNKTNQTCLTC
FT                   SAFLSIPSPPVAHHNNPTESSVAQDQDPLDGPVRAARRKKVTRSKPAFHEYERRDERTK
FT                   GHVLWKGEEKVGRWGV"
FT   gene            complement(987492..988549)
FT                   /locus_tag="CNH00713"
FT   mRNA            complement(join(987492..987791,987862..988068,
FT                   988161..988549))
FT                   /locus_tag="CNH00713"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(987590..987791,987862..988068,
FT                   988161..988207))
FT                   /codon_start=1
FT                   /locus_tag="CNH00713"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M668"
FT                   /protein_id="ALO69550.1"
FT                   /translation="MQSCPKMSTSSVQAGIGFPRAPLGSPPPAYIRSPPLPTQRMVTTS
FT                   QPFNKLQKAKQGRQGGGRRESYDVSSGGTVMGSETVLAVAHSGIDRSPEEASSAAGDKG
FT                   NCKYERWYPGDASHSGRPAWWNRVLCCGYGMGCLLCPCGGLTCRHVT"
FT   gene            complement(988551..989855)
FT                   /locus_tag="CNH00710"
FT   mRNA            complement(join(988551..988706,988763..988822,
FT                   988881..988989,989043..989408,989468..989855))
FT                   /locus_tag="CNH00710"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(988591..988706,988763..988822,
FT                   988881..988989,989043..989408,989468..989809))
FT                   /codon_start=1
FT                   /locus_tag="CNH00710"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00710"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44956"
FT                   /db_xref="InterPro:IPR032704"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE2"
FT                   /protein_id="AAW44956.1"
FT                   /translation="MVQEITEKTIKTGGDDLDDGLELDPDLLASSDIEDAASDVASEFD
FT                   GGEQRDQASEDESPLVLEGEETEIAMSPVPEMKKRKAEDVENEGEQDEEAAKAEKKRRK
FT                   KEKEKERRAKRRQGAELVPSTTAPTHLATTDLSSVLLRSIRESFPSSSAIEIEEVLIPP
FT                   ANLLEPPTYPAPKADPSNAFKPLQQRISELTKGKKEPKGNGAPAVIVLGISGLRCADIV
FT                   RGVRGVKGKGEVAKLFAKHFKLADQIKYLERTKVSIAVGTPARVGKLLAEGAIKISKDT
FT                   VLLLDIGHQDSKTRTLLTLPEVRDELWKSVFSGAARKALLDNGVKVGAF"
FT   gene            990016..992671
FT                   /locus_tag="CNH00700"
FT   mRNA            join(990016..990179,990242..990417,990475..990562,
FT                   990618..990852,990912..991312,991362..992102,
FT                   992158..992671)
FT                   /locus_tag="CNH00700"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(990036..990179,990242..990417,990475..990562,
FT                   990618..990852,990912..991312,991362..992102,
FT                   992158..992589)
FT                   /codon_start=1
FT                   /locus_tag="CNH00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00700"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44955"
FT                   /db_xref="GOA:Q5KCE1"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE1"
FT                   /protein_id="AAW44955.1"
FT                   /translation="MGKAQVKKKTQGWRHNPVRVPDSHLGSGKGEGKADPQKEKQMLPI
FT                   LNKLRSPEYADRTWACAAISNLIQNDAATRRLFQGKNVVGELIERLSDSVDEVVVEASG
FT                   ALRNLAIDGGRELCGEMANKGIMSHLGVLISKISTTITSVLSGETMDSDDNLQARKHLL
FT                   SLSENVILLLWSLAEAGPKTLANVNAMGCEGLLIMILEGRDKLGLGVSLAAAQTLFALS
FT                   QDNFPFRKSLVIHPTALESLITIAQEDHLPAENAQKAKEASRKSKSKKAAAEPASEADD
FT                   LPDGRALLRRMLACGILRNIIRAGSRADEKVGINALTASTILPLVNGLLDVKLEDVCTR
FT                   VNKLVKDSPPDVKILDKNAKTDHKSTSEVALERIERNLSTVVAALEVLTNVCAGLEDEE
FT                   DIAAETLEEGGAAAEVVEIEEDDDAAMDEDEMDDEGLISMGREPGAELDIETFDSGVKI
FT                   NPGATLSHLLTNLHLPERLSLLSRPVSLSFPPASTVPSIHPPTTSILSILHLHALEALN
FT                   NLLLTAVASISAAERSAAAQIVASVPVQGLWDSLFSIIQLIGSEPQALQMKGQEMRMEV
FT                   LEMTLGCVWGTIKVNPSAVNVQQPQVQILMDSINVIKDEITKTRVVETLSSIAMRESIS
FT                   NAENQSITQNLIQRLTSTSPTPSAEMLVSLLNAIIDIYSDETRSFNSVFVENDYLQVLS
FT                   GIVGKVRAEVKKIDKRRERNLRVRGDEVYENLVAFIKYRRSLQK"
FT   gene            complement(992247..994350)
FT                   /locus_tag="CNH00690"
FT   mRNA            complement(join(992247..993021,993085..993430,
FT                   993481..993695,993751..993838,993895..993926,
FT                   993971..994184,994245..994350))
FT                   /locus_tag="CNH00690"
FT                   /product="minor histocompatibility antigen h13, putative"
FT   CDS_pept        complement(join(992705..993021,993085..993430,
FT                   993481..993695,993751..993838,993895..993926,
FT                   993971..994184,994245..994337))
FT                   /codon_start=1
FT                   /locus_tag="CNH00690"
FT                   /product="minor histocompatibility antigen h13, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00690"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44954"
FT                   /db_xref="GOA:Q5KCE0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCE0"
FT                   /protein_id="AAW44954.1"
FT                   /translation="MPQYNTIWATYVSLGVQALIPIAIGSFKSLKTPEDTRRRLRESKK
FT                   GQISEEYDDEDEEPAGETLTWKESAMFPIMGSVMLLGLWAVLKYFGKKWITIILGVYFG
FT                   LAGMLAVQSTFSSIIGYLLRVFGISMTTYHVRISAGFRQIFHLPTTLPTMCLIPVSIVL
FT                   PLLYVYFDRHYILSNILALAFSIETLALLKLDSFFTAFLMLGLLLVYDIFWVFATPVMV
FT                   TVAKGIDAPIKILAPKTSPFASPTDFAMLGLGDIIVPGLVIALCLRYDLHRYAAFYKGQ
FT                   NVTPRSKFGKPYFWCGVVSYVLGLGVTIGVMHHFQRAQPALLYLSPACTLGPVLLAFSR
FT                   GEIKNLWTYDESPEEENKQVLDDTIEAASEAAIRARAEAKAAAEETVSKGEDTVDEAQD
FT                   AGEQKEQMDDDSWMNNTGVIAPEGKPRKKKGGKKK"
FT   gene            995349..995438
FT                   /locus_tag="CNH00680"
FT   tRNA            995349..995438
FT                   /locus_tag="CNH00680"
FT                   /product="tRNA-Val"
FT   gene            complement(995520..997000)
FT                   /locus_tag="CNH00670"
FT   mRNA            complement(join(995520..995701,995750..996727,
FT                   996783..997000))
FT                   /locus_tag="CNH00670"
FT                   /product="phosphoserine transaminase, putative"
FT   CDS_pept        complement(join(995616..995701,995750..996727,
FT                   996783..996954))
FT                   /codon_start=1
FT                   /locus_tag="CNH00670"
FT                   /product="phosphoserine transaminase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00670"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44953"
FT                   /db_xref="GOA:Q5KCD9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD9"
FT                   /protein_id="AAW44953.1"
FT                   /translation="MPDRKDVHNFAAGPSPLPTTVLEDAAKGLLNYADTGMGICELSHR
FT                   GKEFKAVIEGAEANLRNLLAIPDNYTILFSQGGGTGQFSAVLLNLLSAHRLAHPVPAEE
FT                   FKPPTIDYVLTGSWSSKAYAEAQRLVLPPFPNCPGFATPRIAASTKATGWTRLPKREEY
FT                   DFSKDAAYVYYCENETINGVEFPPASAQDSAYAFPFDLVPEGVNVVADYSSSFISRPIP
FT                   NIERHAIIYAGAQKNLGPSGVTVLIVRNDLLVDTTAAAKLGCVPATPITYEYKILAENA
FT                   SLYNTPPTFPIYVSALVLQHLIDAKGGLTGLEATNREKAKLLYATLDAAESRGKVRTVV
FT                   REKDARSWMNVTFEIVGEGKEKAFLEGAEKKGFKQLKGHRSVGGIRASIYNAVTVDSVK
FT                   ALCQYINEFGEQ"
FT   gene            997151..998802
FT                   /locus_tag="CNH00660"
FT   mRNA            join(997151..997441,997493..998802)
FT                   /locus_tag="CNH00660"
FT                   /product="expressed protein"
FT   CDS_pept        join(997180..997441,997493..998697)
FT                   /codon_start=1
FT                   /locus_tag="CNH00660"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00660"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44952"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD8"
FT                   /protein_id="AAW44952.1"
FT                   /translation="MSVVVYPQEDEDCPSFSSTALQILTQDVSSLLSLSLETTASVLHD
FT                   WFRSSLGMVGFGGDFAPRDRQKPDSEEESGRGLAVVIVGAGEATGQSLTLHLAKSGYTV
FT                   FPFIPLPSSSPSISTYNDTSSAPTDALSNILLTWSATRKRLCARMPNHPGAVVPIIVDP
FT                   EGVSGEGEVGELADVEKDRKEGEEFICGRFAHAGETVRAYIRENELTLVSIICISPSPL
FT                   PSPATPHLSLSPPSPLSTHPPSLTTTATDLLLPRDSLVNTPESTLHSIYRTNVLDPVSV
FT                   VRELSDVLVSPLGFGPEYWGRGRGKQSQGRVIFINPSPILSPSLQAGSSAGGHVDSMNR
FT                   HHHRLFQTTNLSSVNSVNSLTTSLRSATARILRDELSVLGVGVCEVVVGPMWEKPRLAR
FT                   CWGGGEEGRKMDMPPTPGPTPTRLLILSRLWAVDDALLFASVRRALEDRYPRYRHYAGL
FT                   GPLVDDLAGAIPGGGVMTGLGRWVVGKVLG"
FT   gene            complement(997967..999932)
FT                   /locus_tag="CNH00650"
FT   mRNA            complement(join(997967..998976,999038..999111,
FT                   999173..999335,999381..999536,999593..999932))
FT                   /locus_tag="CNH00650"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(998866..998976,999038..999111,
FT                   999173..999335,999381..999536,999593..999847))
FT                   /codon_start=1
FT                   /locus_tag="CNH00650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00650"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44951"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD7"
FT                   /protein_id="AAW44951.1"
FT                   /translation="MISDGDLQSSLKIRSRYNGHYSCMTLPRLASRLAKTMTPADIPTL
FT                   SQLYRHDHTNALNPTKPKYEFTKQLNDRVSIWRGDITELEADMIVNAANSSLLGGGGVD
FT                   GAIHRAAGKHLLEECKKLGGAQTGETKFTAGYNLSSKKIAHTVGPVYHSHPPQRAAQLL
FT                   KSCYQSSLEGCRDSGGGVIGFSSISTGVYGYPIKDATHIALETTRQFLEQDDSITRVIY
FT                   VVFSKRDEDVYREIIPQYFPPDPEHGHGSV"
FT   gene            complement(999945..1000426)
FT                   /locus_tag="CNH00640"
FT   mRNA            complement(join(999945..1000182,1000227..1000426))
FT                   /locus_tag="CNH00640"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(1000062..1000175)
FT                   /codon_start=1
FT                   /locus_tag="CNH00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00640"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44950"
FT                   /db_xref="GOA:Q5KCD6"
FT                   /db_xref="InterPro:IPR018943"
FT                   /db_xref="InterPro:IPR036330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD6"
FT                   /protein_id="AAW44950.1"
FT                   /translation="MISDHALADLANGLGIAAMACIVLYHFVAVNGKRMEA"
FT   gene            1001226..1004446
FT                   /locus_tag="CNH00630"
FT   mRNA            join(1001226..1001526,1001573..1002391,1002432..1002769,
FT                   1002834..1002904,1002959..1003100,1003160..1003451,
FT                   1003516..1003618,1003680..1004072,1004136..1004192,
FT                   1004250..1004446)
FT                   /locus_tag="CNH00630"
FT                   /product="Rab guanyl-nucleotide exchange factor, putative"
FT   CDS_pept        join(1002142..1002391,1002432..1002769,1002834..1002904,
FT                   1002959..1003100,1003160..1003451,1003516..1003618,
FT                   1003680..1004072,1004136..1004192,1004250..1004316)
FT                   /codon_start=1
FT                   /locus_tag="CNH00630"
FT                   /product="Rab guanyl-nucleotide exchange factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00630"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44949"
FT                   /db_xref="GOA:Q5KCD5"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR019452"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="InterPro:IPR032914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD5"
FT                   /protein_id="AAW44949.2"
FT                   /translation="MEVFVLYNVNPALVLSLFPGKSISEKLGVRKEGWMELFGAPRGAS
FT                   LGAGEQTQSVHVNEEKGGDASSVKSTNTSVKASQGDDEPPKAALEALMYFLSDRRQKLT
FT                   GAISALPPSSPLPAESSLPAFSSLPAPALHSLPSIIPFAEMSPEELVRMAQVVYTGLMR
FT                   VYLKARPVLVGSLCRIENWCDVKEVEGLLKEERKFSDLIDLYQGKKMHRKALTMLRELA
FT                   KEEDDKLDRYPPTISYLHKLGAADLDLILESSKWILEEDPGMGLTIFTADEPEIESLPR
FT                   DRITSFLSSIDRGACEGYLEYIIWTLGEKGGEFHDTLAELYMVDSRVKVESGAEAGAYD
FT                   KLLAFLNDSTHYRPYRVMNKLSGKEMPEARAILLGRMGKHEEALKIYVYRLQDYAAAES
FT                   YCVKAYQSTNNVFLLLLQLYLRPPPPLSPSPTPKPKPTPKSTPASTHLPPALSLISKHS
FT                   TSLPPSSVLDLLPPLVSIADIHPFFIKTLREEHRRKLEGRVMRQLGKGRKDEVEEMLMG
FT                   LEVKRVRVTDQRICPQCHKRLGMSAIAVHAPRGEVTHLHCKDRFSAKLAASRE"
FT   gene            complement(1004409..1007742)
FT                   /locus_tag="CNH00620"
FT   mRNA            complement(join(1004409..1004788,1004859..1005062,
FT                   1005118..1005291,1005344..1005499,1005556..1005654,
FT                   1005702..1005858,1005910..1006096,1006146..1006356,
FT                   1006403..1006705,1006767..1006942,1006998..1007067,
FT                   1007118..1007181,1007231..1007310,1007360..1007742))
FT                   /locus_tag="CNH00620"
FT                   /product="cation:cation antiporter, putative"
FT   CDS_pept        complement(join(1004474..1004788,1004859..1005062,
FT                   1005118..1005291,1005344..1005499,1005556..1005654,
FT                   1005702..1005858,1005910..1006096,1006146..1006356,
FT                   1006403..1006705,1006767..1006942,1006998..1007067,
FT                   1007118..1007181,1007231..1007310,1007360..1007683))
FT                   /codon_start=1
FT                   /locus_tag="CNH00620"
FT                   /product="cation:cation antiporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00620"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44947"
FT                   /db_xref="GOA:Q5KCD4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD4"
FT                   /protein_id="AAW44947.2"
FT                   /translation="MQPPTTPTSNRRSHFPSSRQSFSAGSAAKPRRYQSRQNSFLRLFI
FT                   GALAITASKTWVIDNHGGEGGGAGWLVLAYWASRVFVEGKQVWDGRRRKAFRLDATSNG
FT                   IGVKDYILSSFNYVLQSLAFFMSLGSLGPFKTSIIGMTGSLLATAQPTTIRSFGPLLPL
FT                   ILASGYAFAQQLLLKDFQAVIVILVFALTTSVIQGRFLEPKTAGSRETIDGRHSLYRTI
FT                   LSALVATVSVIALYFMGFIPIPVPVSSTASQRFGSFVAAFLVSNIPLSFGQNSPSSAGL
FT                   RLKTWRDKATFLTCIPILQFFALHPIPTTVDVVILLPISVFSIWAESIFKAQPELAPSW
FT                   TFSNHNLSTANHSWSFLSLVPSRWRPHFQTIISTPTSSRIFYFLLLNLAYMGVQMGYGV
FT                   FTNSLGLISDAIHMLFDCLGLGVGLWASVAAMWKPDGRYTFGYSRVETLSGFANGCFLI
FT                   LISVFIIFEAIQRVYNPPEMETHQLLLVSGIGLAINLWGMWATGGHHHHGHSHGHDHAQ
FT                   VHAAPKVEVHKQGVSQNDAHKYEDHHLDLHSHDHHHKPSASSKVSPRPASKLQKRKSSG
FT                   QLKDSGPSATTPQKTNNGHNHDEHCSHDGEKHSHSHNHHKLTHESSTHNDAHAHEDDYD
FT                   HAHAHGHGHDHDRGHDHAHSHNMRGVFLHVLADTLGSVGVIISTILIRFTGWTGFDPIA
FT                   SLFIAALIMASVIPLVVDSGRILCLDVGEEKESEIRSALTELSSVDGLASYAAPRFWPR
FT                   CEGELVGSIHIQLAPSPSSFDPTRLSTPPSSSRPRKGDAIYANSEKVVGRVEKVLKKRI
FT                   KGLTELVVQVEGSEERSFCTCMTGGDQ"
FT   gene            complement(1007953..1010739)
FT                   /locus_tag="CNH00610"
FT   mRNA            complement(join(1007953..1008288,1008345..1008482,
FT                   1008538..1008600,1008665..1008827,1008880..1009353,
FT                   1009406..1009528,1009586..1009618,1009668..1009733,
FT                   1009784..1009846,1009905..1010054,1010120..1010525,
FT                   1010604..1010739))
FT                   /locus_tag="CNH00610"
FT                   /product="helicase, putative"
FT   CDS_pept        complement(join(1008100..1008288,1008345..1008482,
FT                   1008538..1008600,1008665..1008827,1008880..1009353,
FT                   1009406..1009528,1009586..1009618,1009668..1009733,
FT                   1009784..1009846,1009905..1010054,1010120..1010525,
FT                   1010604..1010616))
FT                   /codon_start=1
FT                   /locus_tag="CNH00610"
FT                   /product="helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00610"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44946"
FT                   /db_xref="GOA:Q5KCD2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD2"
FT                   /protein_id="AAW44946.2"
FT                   /translation="MSNKVNCPICNISVPEGDINLHLDLKCKGAPPAELSTPQQVFDFT
FT                   SSLHPKTQPSTSQTSPSTHPGSSQRARASQANLDERRASVGADGKKNIAPVFQTQGAVT
FT                   KRKAEGKETKVIGGDGFGGGKGAKQRRVNPLAAAQPLAERSRPSEISQYIGQSDIVGLG
FT                   SLLRVQIEAGKLVGSCILWGPPGCGKTTLARLIAKSSGADFKELSATSSGTQDVRQVFE
FT                   KAKNGLQMTGRRTVLMIDEIHRFNRAQQDLLLPYVEKGWIQLIGATTENPSFKVNGALL
FT                   SRCQVFTLHAHSPESLQIILRNAVQTISESEPIPYLPSGLIPFLADVADGDARQALNGL
FT                   ELALRTCQTMDETASAEKAQRVNSASGEKMEKEGQKDEFDAAVEEAEEDYQKKKRDEEI
FT                   MDAVRRGLQKGYNRTGEERYDMISALHKCLRGSDGSAAMYWLARMITGGEDPLYIARRL
FT                   IVVASEDVGLADNHALPLAMATYQACQTIGLPECRINLAHCVAYLAEAPKSTRSYKAYA
FT                   AAEQLATMPPLPGVPLQIRNAPTQLMKKLGYGKEYAYNPDYGHPVHNDYLPESLLQHSS
FT                   HSHDPSQHILKTADQFEADKKWDEEHLDEWERVVNDGVAWEGRYERFGEI"
FT   gene            1012388..1015417
FT                   /locus_tag="CNH00600"
FT   mRNA            join(1012388..1013161,1013231..1014620,1014683..1014753,
FT                   1014808..1014854,1014911..1014944,1015008..1015417)
FT                   /locus_tag="CNH00600"
FT                   /product="specific RNA polymerase II transcription factor,
FT                   putative"
FT   CDS_pept        join(1012706..1013161,1013231..1014620,1014683..1014753,
FT                   1014808..1014854,1014911..1014944,1015008..1015160)
FT                   /codon_start=1
FT                   /locus_tag="CNH00600"
FT                   /product="specific RNA polymerase II transcription factor,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00600"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44945"
FT                   /db_xref="GOA:Q5KCD1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD1"
FT                   /protein_id="AAW44945.1"
FT                   /translation="MYQQQTMASHPFFSHNNPWARSAICCDQHHGESTSAAMARLAGNI
FT                   PFSHDENLHDHHLGYHDSSGCTSDCPLDTYCCSGDYCCDKHGSCSSGDECCDDPRCEEA
FT                   HRPDSRASHQSHHNRSKPEQSRNHNHQQPMSLEEWAGTQEGCNAIQQLIECCNQPDCHI
FT                   PVCPTDNSEVHPLPADPLSALFASLDAQQQPQPISTAQQPMAPVSSVEASHTCHWGNCH
FT                   LVFGSMPDLLAHVAADHLNAAGTAHQSDQLLQQAQSAQSAQSTPLALLTERALSSISTN
FT                   TTGLQSHLPTNSSLQATSLAVNDALLSCMWDDCFPVPEVPAASSTSHSTFHHYNSDNCQ
FT                   APHNHQHDHSYAAGEPFNPGTMLRHVLEEHLGIPPDIIGWPNEAELQAQAQAILEKHHH
FT                   HHHIDPREALVNHSENCNHVHPHPHSHSHGNSAGTGANDSHPHGHALAHSQFHPNLHPH
FT                   PHSLPHERSYAHSHSLSHSRPLSHEPLPTPPSTVKTEACTSPAASNDSVASTVLTASQS
FT                   SKDLICLWPGCTIHTPFASTASLMDHLSEMHIPKGKDCYTCHWGGCGGEEGRVFKSRQK
FT                   VLRHLQSHIGHKPFVCGVCNQAFSEAAPLTAHMRRHAQEKPFKCEHPGCGKSFAISSSL
FT                   TIHMRTHNGEKPFVCPYCQKGFVEASNLTKHIRTHTGERPFACSHPGCGKKFSRPDQLK
FT                   RHMTIHNKPPGEKRRGSGVPAK"
FT   gene            1016920..1017028
FT                   /locus_tag="CNH00590"
FT   tRNA            1016920..1017028
FT                   /locus_tag="CNH00590"
FT                   /product="tRNA-Leu"
FT   gene            1017851..1020503
FT                   /locus_tag="CNH00580"
FT   mRNA            join(1017851..1017961,1018031..1018308,1018370..1019467,
FT                   1019517..1019677,1019736..1020347,1020445..1020503)
FT                   /locus_tag="CNH00580"
FT                   /product="centromeric DNA binding protein, putative"
FT   CDS_pept        join(1017885..1017961,1018031..1018308,1018370..1019467,
FT                   1019517..1019677,1019736..1020146)
FT                   /codon_start=1
FT                   /locus_tag="CNH00580"
FT                   /product="centromeric DNA binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00580"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45240"
FT                   /db_xref="GOA:Q5KCD0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR025974"
FT                   /db_xref="InterPro:IPR028386"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCD0"
FT                   /protein_id="AAW45240.2"
FT                   /translation="MSHITPSRRKEERYIPFNNDPRNIGTRTGLPMPQNVPRDSNGFEI
FT                   PALFFGSSPENGANRTISSIKSKVAQTPGGRSTYSRADSTPGTARRLTRRLSDLDMDDG
FT                   LRGGDDLLMDEDDLAIATPGSLFANSEPPPSIILPSRSRLPISSPANASFDSVPSPSVR
FT                   PSPRKSHYSAASRVSSSLAKTVTKVHELSGDEEEPFLTPGDGLNQEGEPEESPVKSKKK
FT                   TPRAASSDDDGSPAKDKEAAFPPEGRSASMSGNKPANDYDAGYEGNHTVDFDDLPPMGP
FT                   IDDYDVETVLRTEREEDDEDAQNVDNNVVEEERTMEEEEMQVSESEDGEERRPVVAKRK
FT                   KSPKKQEKGKDRARSARSGSTAAQRKRTRPSELGPGDDGYHGNFVTRRSGRQHYKPLEF
FT                   WRGEKVEYMRGPGCAVIKEIITIPEDPPVPLALRKSRKNGRARSGSVAVGKRKREDSVE
FT                   DEEGWDHKTEPTGLVQDYPFGEECYRKIACPKALLDPKLVSGGNFKYQKVFGEGHFMAA
FT                   GIVYIPVGQIKNTKPSKDNTYVFYVIQGAVQVTIYRTSFVMAPGSQFLVPRGNDYCIEN
FT                   ISPDKEAQLFFAQARKIRANEIDADGVSESQAGEAGLPSRKSISASQTQGGKKSNRLPS
FT                   VREESRDISQSEREDEEEDEEEEEITVKKRRKSKGKSRR"
FT   gene            1020553..1021867
FT                   /locus_tag="CNH00570"
FT   mRNA            join(1020553..1020648,1020704..1020750,1020811..1021073,
FT                   1021142..1021336,1021392..1021460,1021530..1021593,
FT                   1021655..1021867)
FT                   /locus_tag="CNH00570"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1020614..1020648,1020704..1020750,1020811..1021073,
FT                   1021142..1021336,1021392..1021460,1021530..1021593,
FT                   1021655..1021716)
FT                   /codon_start=1
FT                   /locus_tag="CNH00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00570"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44944"
FT                   /db_xref="GOA:Q5KCC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC9"
FT                   /protein_id="AAW44944.2"
FT                   /translation="MTREDHKQDSGLRALRAHLNTRPDLLLAIAMRHATNPLLHPAPDP
FT                   LTKSPTQTPPSLRLSVPHGSPTYDALGIKLRTKAREVDVDIPLQSTAKTASEVKQAIDK
FT                   MGEDALKYYKVPKDPQVNVFVPPKFTHTLVLLPLALLIYLAAAPSTSNAANAGRALVSK
FT                   YLSDYMIPASLIFSFACHIIVEPLLLIIKIDKHQVPIIPALCYMFTVVLIGFGGLNALD
FT                   RAVVQERIRLVRSQSADTKKSQ"
FT   gene            complement(1021862..1024308)
FT                   /locus_tag="CNH00560"
FT   mRNA            complement(join(1021862..1022052,1022145..1022253,
FT                   1022343..1022571,1022654..1022707,1022773..1022881,
FT                   1022949..1023144,1023185..1023368,1023419..1023509,
FT                   1023556..1023584,1023637..1023767,1023822..1024308))
FT                   /locus_tag="CNH00560"
FT                   /product="sphinganine-1-phosphate aldolase, putative"
FT   CDS_pept        complement(join(1021976..1022052,1022145..1022253,
FT                   1022343..1022571,1022654..1022707,1022773..1022881,
FT                   1022949..1023144,1023185..1023368,1023419..1023509,
FT                   1023556..1023584,1023637..1023767,1023822..1024253))
FT                   /codon_start=1
FT                   /locus_tag="CNH00560"
FT                   /product="sphinganine-1-phosphate aldolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00560"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44943"
FT                   /db_xref="GOA:Q5KCC8"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC8"
FT                   /protein_id="AAW44943.1"
FT                   /translation="MPVFSTLINSTESYQRRFDQMARAVLVYWVLKYVLLDGFRHIKAR
FT                   GLCGTANEIRNKIKSLVVRIMLAFPSNRAKLNSELAKTRAELKEKLAPSQYPDGVRLTT
FT                   VRTLPETGRGREWLESEWENLKKLEKADVDNGRVSGAVYHGGDELNAVINEAMAKFVVT
FT                   NPLHPDVFPGVRKMESEIVSMCLNLFNGPNGAGTTTSGGTESILMSVKTHRDWARVTKG
FT                   ITRPEMVIPSSAHAAFWKASEYFNIKLHVIPVNQKTRKAEVAAMKRAINPNTIMIVGSA
FT                   PNFPDGAIDPIPELGALAKRRNVGLHVDCCLGSFIMPFLEKAGFSEGIDPFDFRVPGVT
FT                   SISCDTHKYAFCPKGTSVIMYRSSELRRFQYYVITDWAGGVYASPSMAGSRPGSVLAGA
FT                   WAVLNHIGADGYTSSCRQIISAARYLTSSLRTLFPDDLYVLGDPKGPVVAFNSKTINIY
FT                   AVGDVMSKKGWHLSALGGDGGLHMAFTRLSAKSVDKLIEDLGDALKEVKASPQGAGGDM
FT                   VALYGLGQTSAGPHVVGKLAETFLDTLYE"
FT   gene            1024738..1026939
FT                   /locus_tag="CNH00550"
FT   mRNA            join(1024738..1024812,1024857..1025025,1025083..1025221,
FT                   1025269..1025279,1025326..1025393,1025441..1025628,
FT                   1025679..1025692,1025736..1026021,1026079..1026249,
FT                   1026304..1026543,1026701..1026939)
FT                   /locus_tag="CNH00550"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1024797..1024812,1024857..1025025,1025083..1025221,
FT                   1025269..1025279,1025326..1025393,1025441..1025628,
FT                   1025679..1025692,1025736..1026021,1026079..1026249,
FT                   1026304..1026543,1026701..1026826)
FT                   /codon_start=1
FT                   /locus_tag="CNH00550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00550"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44942"
FT                   /db_xref="GOA:Q5KCC7"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC7"
FT                   /protein_id="AAW44942.1"
FT                   /translation="MPELPEVERARKLIEDSCKGYKIASVDAQEDSIIFTGGTDHNEFA
FT                   KEIAGRSITGCERKGKTFWMTLSGEGRYPVMHFGMTGMIQLKGQEPTWYRRRPKESADV
FT                   WPPRFYKFVLKLEPQEGSIADEPRELAFIDGRRLGRLRLVSDPVSSHPPVSELGFDPIL
FT                   NHPTLEEFTKLLVNKKGTVKGVIMDQAFSAGVGNWVADEVLYQARIHPSCPIPALSEQN
FT                   IRDLHHQLRAVPLTAISVNADSKLFPSDWLFRWRWSKGTTQKKQMEKDKKSKGKKVVDG
FT                   EGGEDVEPEDKEFLELPDGSPATIKFIEVGGRTTALVEELQKMPEGVEIKPKISKGGKR
FT                   AGAKRKKVAKEEESDEGSELSDQSDLEEQKPKRPLTARQKAAAEKKGINSNLASQTKTE
FT                   DNKPSAAKRRAIGARTGGSKNHPDSEVKKEKGSTECRKSKKQVEAVGEKLAKIKPQKGR
FT                   KKAASTPESSELSDLVE"
FT   gene            1029135..1031607
FT                   /locus_tag="CNH00540"
FT   mRNA            join(1029135..1029446,1029503..1029559,1029614..1029718,
FT                   1029769..1029853,1029912..1030079,1030130..1030264,
FT                   1030323..1030732,1030790..1030924,1030983..1031108,
FT                   1031161..1031607)
FT                   /locus_tag="CNH00540"
FT                   /product="galactose transporter, putative"
FT   CDS_pept        join(1029297..1029446,1029503..1029559,1029614..1029718,
FT                   1029769..1029853,1029912..1030079,1030130..1030264,
FT                   1030323..1030732,1030790..1030924,1030983..1031108,
FT                   1031161..1031442)
FT                   /codon_start=1
FT                   /locus_tag="CNH00540"
FT                   /product="galactose transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00540"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44939"
FT                   /db_xref="GOA:Q5KCC5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC5"
FT                   /protein_id="AAW44939.1"
FT                   /translation="MGGGAPAGGDFEALLTQRQNEGWRGLFKNGRALGLACFASLGGVL
FT                   YGYNQGVFGQVQVMYNFEQRYTATLTNPDTKGLLTSILELAAFVGALMAGPLSDRYSRK
FT                   YSISAWCVVFMMGTAIQTGANSNVACIYAGRWFAGMGVGALSMLVPMFNAELAPPGIRG
FT                   SLVALQQLAITFGILISYWIGYGTNYIGGTGAGQTTAAWRIPLGLQLIPGVVLCVGACF
FT                   LPFSPRWLMLRGREEECLTNLARLRSSTEEAPEIQYEFRALQAERLVEREAAKERYGQE
FT                   DVNFRVTMLEYKRLFTTRPLLHRLMLGAGAQALQQWTGINAIIYYAPTIFAQIGLTGSG
FT                   ASGTISLLATGIVGVVNFVFTIPAVLFVDNFGRRPLLAWGEANMAISHAIIAAIVAEFG
FT                   DSFDSNKKAGNAAVFFIYWYIANFAVTWGPLAWVVSAEVFPLDMRAKGMSISSGVNWLM
FT                   NFTVAMVTPHMIDNIGYKTYIVFMCFCVVGFLYSIFILPELKGLSLEEVDRVFHDESGA
FT                   EDRARRERVAAQIGLDKVAEQIQHKEKVNDSEA"
FT   gene            1032876..1035069
FT                   /locus_tag="CNH00530"
FT   mRNA            join(1032876..1032983,1033046..1033088,1033137..1033327,
FT                   1033396..1033506,1033555..1033650,1033699..1033793,
FT                   1033841..1033920,1033972..1034212,1034263..1034865,
FT                   1034914..1035069)
FT                   /locus_tag="CNH00530"
FT                   /product="glutamate 5-kinase, putative"
FT   CDS_pept        join(1032978..1032983,1033046..1033088,1033137..1033327,
FT                   1033396..1033506,1033555..1033650,1033699..1033793,
FT                   1033841..1033920,1033972..1034212,1034263..1034865,
FT                   1034914..1034983)
FT                   /codon_start=1
FT                   /locus_tag="CNH00530"
FT                   /product="glutamate 5-kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00530"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44938"
FT                   /db_xref="GOA:Q5KCC3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC3"
FT                   /protein_id="AAW44938.1"
FT                   /translation="MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVKL
FT                   RTQGHRVVLVSSGAIGVGLRRMDLKERGKGLHQKQALAAVGQGRLIALWDNLFSQLDQP
FT                   IAQILLTRMDISDRTRYLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLSAIS
FT                   SAICHADYLFLLTDVDCLYTDNPRTNPDAKPVRVVRDIEKVKQQVSTSTLGTSLGTGGM
FT                   STKLIAAELATAAGTTTVVMHSINVTDIFKVIENGPSPCREVAETPELFEGPLCTRFLR
FT                   RESALKDRKWWIAHGLHAAGTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPFASHQAV
FT                   RLVVRRRRHDDIAALSSVDESTPGSPTPDLSQVPQPATFASPALRHLTIGTTNPITVMS
FT                   DANNTEPDTPQLQPSMSLSSSIASLDPLSRSVPPSPAITALAERLGTTSLTSIGRGVAE
FT                   GESDEWEEVEVAKGLAQYNSVEIDRMKGRKSSEIEKLIGYVESEHVVDSITFL"
FT   gene            complement(1035688..1038566)
FT                   /locus_tag="CNH00520"
FT   mRNA            complement(join(1035688..1036189,1036258..1036326,
FT                   1036368..1036460,1036514..1036774,1036827..1036902,
FT                   1036942..1037078,1037126..1037447,1037529..1037696,
FT                   1037753..1037950,1037992..1038122,1038163..1038566))
FT                   /locus_tag="CNH00520"
FT                   /product="intra-Golgi transport-related protein, putative"
FT   CDS_pept        complement(join(1035755..1036189,1036258..1036326,
FT                   1036368..1036460,1036514..1036774,1036827..1036902,
FT                   1036942..1037078,1037126..1037447,1037529..1037696,
FT                   1037753..1037950,1037992..1038122,1038163..1038501))
FT                   /codon_start=1
FT                   /locus_tag="CNH00520"
FT                   /product="intra-Golgi transport-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00520"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44937"
FT                   /db_xref="GOA:P0CM80"
FT                   /db_xref="InterPro:IPR010490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CM80"
FT                   /protein_id="AAW44937.1"
FT                   /translation="MSTNPNTPAPPASRTNPISLRIYKAIGTSFDDVSSREALEIASGM
FT                   YGPEDPKAKVKAQPEYEELEEDDDTLPKRRTLKGQSAAIARKYLKQDIETCLATGSTKF
FT                   LEAFAEVDQKLNVLREHMQEMQVRCDQVQSELDQANSGTKFLLERADVLRSQRDSAQLR
FT                   AHLITLFLSRFTLSNSELTALTSREVTIGQPLFDALDHVEKIRTDCEVLLSGEEGKAQA
FT                   GLDIMSLTSEQLESGYSKIHRYCQFEFRQFTREAQLEASSVMRQAICRLRDRPALLADA
FT                   IQTLTSTRQSSILHQFLDALTRGGPGGLPRPIEIHAHDPTRYVGDMLAWVHQTTATEHE
FT                   FLEGMFGVKEKKRWVGQERGGEEGEEERMASEVLDKDLEGLSRPLKLRIQETIKSQEGI
FT                   IMTYKIANLLHFYLVTMRKTIGGKAMLVQTLQEIHDQAYIAFYETLDAQGRGLLRFLHP
FT                   PDATLTPPITLRDAAQILRELLFVYSTSLIDPAERESDADLAKLLDKAVGPCVEMCERM
FT                   AEMRRGKSGGGEWERDIFMVNSLGYLEHTLEMYDFTTKTLHMLDEKIKTHVESMTFEHH
FT                   GKLLESCGLAAVMRTIRTRPEDTPLSRLHATSPKSLTSALSKFSTWISTVDPSTSPRLA
FT                   LLTSPRLAVEIHRKALRKIYDAYGEICERVLDKAEGYEFGETMLRRGRDEVGVALGVGE
FT                   DWELEEDTEEKSMKQKEQQDEDTEDQGEKGIMQEEHKAQDAGNTEDKA"
FT   gene            1038710..1040480
FT                   /locus_tag="CNH00510"
FT   mRNA            join(1038710..1038906,1038994..1039008,1039124..1039132,
FT                   1039187..1039402,1039483..1039596,1039656..1039737,
FT                   1039801..1040073,1040158..1040480)
FT                   /locus_tag="CNH00510"
FT                   /product="CDP-diacylglycerol-inositol
FT                   3-phosphatidyltransferase, putative"
FT   CDS_pept        join(1038737..1038906,1038994..1039008,1039124..1039132,
FT                   1039187..1039402,1039483..1039596,1039656..1039737,
FT                   1039801..1040073,1040158..1040232)
FT                   /codon_start=1
FT                   /locus_tag="CNH00510"
FT                   /product="CDP-diacylglycerol-inositol
FT                   3-phosphatidyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00510"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44936"
FT                   /db_xref="GOA:Q5KCC1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC1"
FT                   /protein_id="AAW44936.2"
FT                   /translation="MMAPTTRSKQSTPVLEPEESTSTSTATSLGPGEGELKQRAREGSR
FT                   SRTRDEVWDPKYAVDLATTTVDENVFLFVPNLIGYTRVITAAASLFFMPYHPKACTMLY
FT                   SVSCMLDVVDGQAARALGQTSRFGAVLDMVTDRCTTACLLCFLSSVYPTYSMLFMFLIT
FT                   LDFSSHYIHMYSSLTTGSSSHKTVTSDVSRILWYYYNDSRTLFVFCFANELFFVCLYLN
FT                   HYWTTPLMANFPIPTAILTSELTAAHPKLVGGVINVLRNLNWPQVVAAMTFPICAGKQI
FT                   INVVQFWKASKILVGVDLAERRAAREQKLAAQLRGR"
FT   gene            1040822..1042790
FT                   /locus_tag="CNH00500"
FT   mRNA            join(1040822..1041135,1041213..1041471,1041542..1041721,
FT                   1041801..1042200,1042293..1042790)
FT                   /locus_tag="CNH00500"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1040960..1041135,1041213..1041471,1041542..1041721,
FT                   1041801..1042200,1042293..1042423)
FT                   /codon_start=1
FT                   /locus_tag="CNH00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00500"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44935"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCC0"
FT                   /protein_id="AAW44935.1"
FT                   /translation="MTDQLRDQLHFGIASASLGLNPIHTFENKFQALQKAGFKFCEVDF
FT                   GSYMTWVRDQKPDLPESTCPPEWSEANEPDPSDEEIWQALYSLAPDFVRLARKYGVKVV
FT                   VLQPLNQFDGWPAGTERAMWVRRKAERWLPLCSKLGVEFLQVGSNDWAEACAPDAKTAG
FT                   DMRWIAELGARQDPPVKIAYEPWCFSDLRGEWEECYKTVQQANHPNLGLCLDTAQLALA
FT                   KPYGWNPTTGQGWDRVSYEGMISRLASLPPEKIFYVELSDVLNPKATKPLYQGSPFDEF
FT                   GKNDKSGKNERFIWVRCARPVPLVGPNGGMDERPEGMEEDGARVVETLKAIMSTGWRGY
FT                   TFFEVFECLKMEPEDEDIPDRYASACKKSSEMILHVVADLK"
FT   gene            1043053..1044752
FT                   /locus_tag="CNH00495"
FT   mRNA            join(1043053..1043557,1043624..1044752)
FT                   /locus_tag="CNH00495"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1043190..1043557,1043624..1044293)
FT                   /codon_start=1
FT                   /locus_tag="CNH00495"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M5Z8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z8"
FT                   /protein_id="ALO69551.1"
FT                   /translation="MRGRGHPWCIITVTPLLSISRRQLSFVQPILELKPIKKHALSIIP
FT                   PQNAARAKSITNKEQKKRKMFPSQYTASHFSIHSQGDEGSGSIVSPNTTISSRRKRTAQ
FT                   ACTTCRRRKGKCVPPPSIDGPCAFCSSRPGTTCEFVLATNNNEGYSSVPVVFIGDKHIM
FT                   ADPSQTTAFSSTVSGTHGYPYDNPLYPPNPISTQLSWEDAAILQNPTNYLGSQKTGASS
FT                   DTAGQLRLQPFTPNNSHTARDDASTGNWYFQDTYTDYPHTAPLTLPQQQSSMVFQQQFL
FT                   GAPPKYNAVSYSDDQRSYYFEQRHSIDPTLEDNGGMYGVYGDPSSLATVLTSSRNTPYP
FT                   PTSEH"
FT   gene            complement(1045325..1048073)
FT                   /locus_tag="CNH00490"
FT   mRNA            complement(join(1045325..1045823,1045876..1046393,
FT                   1046447..1046715,1046766..1046862,1046913..1047128,
FT                   1047179..1047257,1047313..1047475,1047526..1048073))
FT                   /locus_tag="CNH00490"
FT                   /product="sugar transporter, putative"
FT   CDS_pept        complement(join(1045567..1045823,1045876..1046393,
FT                   1046447..1046715,1046766..1046862,1046913..1047128,
FT                   1047179..1047257,1047313..1047475,1047526..1047705))
FT                   /codon_start=1
FT                   /locus_tag="CNH00490"
FT                   /product="sugar transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00490"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44934"
FT                   /db_xref="GOA:Q5KCB9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB9"
FT                   /protein_id="AAW44934.1"
FT                   /translation="MSTVDPTNVVHEKHARPEHLSDADNATILSSNGFRLSEEDIQAAR
FT                   DVSPSRVSGKGLTWMVTFVAGTGFTLFGYDQGVMSGLLTLPSFEAQFPNTAGGFEGSRT
FT                   ATLQSFMVAIYEIGCMMGAISSIWIGDRLGRRHTISLGGLIMLVGAILQTAAVDYAMML
FT                   VARVVTGVGNGLLTSTVPAYQSECSKPHRRGQLVLVEGSLIAFGIMVSYWMDLAFYFTS
FT                   GSVSWRFPIAFQIVFILVMIICMYTFRLPESPRWLAAKGRNAESLAVLAALSNTTVDDQ
FT                   EVMNTFHGITDTLAAENSGSFKFSEIFTHGKSQHFRRTLLGMAAQCFQQICGINLITYY
FT                   LTSVLTGLGLGAVMSRIISGVNGTCYFLTSLIAIAIVERAGRRPLMLWMAGFQAATMAI
FT                   LAGLYDLSTDEENPNKTAQVFSVLMLFLFNTWFSVGYLGMTWLYPAEVTPLRVRAPANA
FT                   LSTASNWVFNFMVVMATGPMFANIGWGTYAFFAAINAVVILPSVYLFFPETKRYSLEDL
FT                   DIIFAKANTEGRSPVRVSLHPEEIPPAGSRQAEEILGRAPAPHLKSKTSHVNMITRALS
FT                   RTSESGKHRDQHHETV"
FT   gene            complement(1049666..1053880)
FT                   /locus_tag="CNH00480"
FT   mRNA            complement(join(1049666..1049827,1049878..1049958,
FT                   1050014..1050541,1050597..1050668,1050716..1050859,
FT                   1050911..1051052,1051101..1051169,1051226..1051363,
FT                   1051420..1051479,1051536..1051597,1051648..1051743,
FT                   1051795..1052047,1052098..1053067,1053384..1053419,
FT                   1053473..1053880))
FT                   /locus_tag="CNH00480"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1049768..1049827,1049878..1049958,
FT                   1050014..1050541,1050597..1050668,1050716..1050859,
FT                   1050911..1051052,1051101..1051169,1051226..1051363,
FT                   1051420..1051479,1051536..1051597,1051648..1051743,
FT                   1051795..1052047,1052098..1053067,1053384..1053419,
FT                   1053473..1053602))
FT                   /codon_start=1
FT                   /locus_tag="CNH00480"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00480"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44933"
FT                   /db_xref="GOA:Q5KCB8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB8"
FT                   /protein_id="AAW44933.2"
FT                   /translation="MSSRDPKENPTDDSTLEPDNRDNNTQNPPPKKKRRQRQLYSCAEC
FT                   RRLKLKCDRQVPCSNCTRRGCQELCPNGSKQTVKGNSEDSVELRKRLEAVESLLTQHGV
FT                   SLPASTSNDNNSNDNEMANRPRSKSDTIEEDAINRRSSVQMTSPPHDQNEAQKERTASV
FT                   NVRRSRSPASQPIPGNQPIAAAINSSQIQSQTSHLAEDVHPIPANPISNPTPTYGSMTM
FT                   VSPPELSRVHFDFNTSADDYRQTWAAGPHPSLSHHHISTVSSVRSDPAQQEQSFGTLVL
FT                   SHGGGSKYLGPTAASEWLKDQEIQEAQDLSDTPGASRAPSPSQRQCPVRAPVMLDQGGI
FT                   FPFDVISPSVSTQTILNHLPPRHEASVLAESYYRYFAWHYNVVPRQTFQPIFDRAYKRE
FT                   MSVNRNVGAQELALLYILLAMGALHNLELPPNDPIAEEYSTLSKICLAKGEFMVHCTTT
FT                   GVMALHVMAHFHLETEKGRNGDSAWPLWGLAMRLIQGMGLHRDGARWNLTPEIVEERRR
FT                   VFWESHAADVLQANCFSRPSSIPPDYIDTCFPSEDPEFIIPRQEVQNQEKGFWTLKFEL
FT                   VKISGAILDLAMKVNPPSYDTVTTLHEHLCDFEHQVPYHLRCRTALLALPSIYPDPTQA
FT                   VRDSPEISKRDLHRTFQQFTLYINISETILFLHRPYFAKALHERLSDPTRSIYGQSYLS
FT                   VVERCNCIIQLVSTIYALHPYISARHWFLWYHAFNSAVCMGTLILQTPHNPMATFALSQ
FT                   IDACITLYTSVVQSHASTRLAKNLQWLLRLRHRAHTKMNQNPPDAATEAMASMHTGNEG
FT                   DEDIELLGWRTRLIHRATRGTQKATTISPMASSQANHTPSPGTSVTQTITQALQQHFGG
FT                   DGSGGGGGIAMDHLSSSSNNPINASTDVLLHQFWDPRMLHETFAGQQPVMGNVEPSSVN
FT                   WWDWDALAGEGSSGNR"
FT   gene            complement(1054062..1055476)
FT                   /locus_tag="CNH00470"
FT   mRNA            complement(join(1054062..1054269,1054322..1054526,
FT                   1054576..1054627,1054681..1054997,1055049..1055200,
FT                   1055256..1055476))
FT                   /locus_tag="CNH00470"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1054109..1054269,1054322..1054526,
FT                   1054576..1054627,1054681..1054997,1055049..1055200,
FT                   1055256..1055316))
FT                   /codon_start=1
FT                   /locus_tag="CNH00470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00470"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44932"
FT                   /db_xref="GOA:Q5KCB7"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB7"
FT                   /protein_id="AAW44932.1"
FT                   /translation="MFKKFVVDKPLLQLNGTLGEGCVWDTRTQRLYFVDIDQYKLYTYE
FT                   PSSGKYGYESFDKKVTALASLENGEGLIAAVEDGFAYISFDSLPFPPTSSKQSLIPISS
FT                   GASLNCREKRFNDGAVDPAGRFLAGTLGFEHGSKNGKMYSLQAEKDGSYSAPLILDGIT
FT                   CTNGMGWTEDAKTFYFTDSWIKEIAKFDYDITTGKLSNRRVFSNFDGYGEPDGMCMDSE
FT                   GGIWTCRWASGKVLRLTPDGEIDVEIDFPTAWHITCCIFGGENLDELYVTSAASDYIGD
FT                   NLPDRKNGGDLFVVKGLGFRGIERGRFKGTIPNK"
FT   gene            1055622..1057041
FT                   /locus_tag="CNH00460"
FT   mRNA            join(1055622..1055678,1055734..1055879,1055933..1056012,
FT                   1056062..1056286,1056346..1056547,1056602..1056717,
FT                   1056772..1057041)
FT                   /locus_tag="CNH00460"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1055861..1055879,1055933..1056012,1056062..1056286,
FT                   1056346..1056547,1056602..1056717,1056772..1056975)
FT                   /codon_start=1
FT                   /locus_tag="CNH00460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00460"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44931"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB6"
FT                   /protein_id="AAW44931.1"
FT                   /translation="MKLEGKAFVVTGGCGSIGGTAAKHIIARGGIALIFDVLPEEAGQA
FT                   KVKEYHAERAFYFKADITNVEVFSACIDAALKVIPKGSLFGGVHCAAIAPGRPWDQKLK
FT                   NSIAHFQKVMHVNSYGTFLVDACIADAINSQYPDEGPFGPRVKEERGCIVNIASVVAKP
FT                   VPARCLTYGVSKATVLGISSGIADFLGPYGIRVNSVSPAVVASSLMGPDRIPYFESELE
FT                   AAAIYPRRLSQPDEVAQGIVYLLENSMMNDFELRVDGGWRGSSNWGGPHDPRSNAPSLE
FT                   "
FT   gene            1058249..1060704
FT                   /locus_tag="CNH00450"
FT   mRNA            join(1058249..1058423,1058479..1058547,1058604..1058821,
FT                   1058874..1059038,1059090..1059175,1059226..1059710,
FT                   1059769..1059805,1059859..1060191,1060264..1060704)
FT                   /locus_tag="CNH00450"
FT                   /product="myo-inositol transporter 1, putative"
FT   CDS_pept        join(1058289..1058423,1058479..1058547,1058604..1058821,
FT                   1058874..1059038,1059090..1059175,1059226..1059710,
FT                   1059769..1059805,1059859..1060191,1060264..1060496)
FT                   /codon_start=1
FT                   /locus_tag="CNH00450"
FT                   /product="myo-inositol transporter 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00450"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44930"
FT                   /db_xref="GOA:Q5KCB5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB5"
FT                   /protein_id="AAW44930.1"
FT                   /translation="MRATHIENRDNNSLENKHIDHIEGVENGKGSQEPPSPSGFGGHLI
FT                   DENLVHVEGEDKVTWYLCFLISASAIAGFLFGYDTGVVGVALPLVGTDLGGSELNSSQQ
FT                   EIITAGTTIGAIFGSAILGGWGDRLGRKMAILISDVFFTAGAVIIASSYSVPQIIVGRI
FT                   ILGIGVGGAAVIAPLFITETAPTAVRGRCIGVNAFFIPFGQVVADSIGAGVQNMRGGWR
FT                   LLFAMGAVPSLLQLLLFHYLPESPRILIVKGDIDRARSVFQRIYPTATREMVDYKLRVA
FT                   QEYVAATTALQSGTTFWERMKKVWKTGSYRRSIIAVSVLQAAGQFCGFNTLLYYAGTLF
FT                   GLLGLSNPALGGLIPAGTNAVFVLIGMSTVDKVGRRGLLLIGVPVLLLGLVWNIVGFYY
FT                   MCKPTGGFLDTSYSYDTTNVGIVIGGIVFYVAGFGLTYSHLVWYQAEYLALEVRSMGSG
FT                   VATTVCWIANLIVSVSYLSELETMTPSGTYGFYLSLSVIAFVFIVFCFPETKQLSIDET
FT                   SLLFENDWGVKRSVQMRKERHETRKRFKDAELAEAATAHFEARKQKSTSISPAELSKFM
FT                   AGLKGGKRKP"
FT   gene            complement(1061331..1063099)
FT                   /locus_tag="CNH00440"
FT   mRNA            complement(join(1061331..1061519,1061585..1061975,
FT                   1062041..1062220,1062280..1062538,1062591..1063099))
FT                   /locus_tag="CNH00440"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        complement(join(1061395..1061519,1061585..1061975,
FT                   1062041..1062220,1062280..1062538,1062591..1062763))
FT                   /codon_start=1
FT                   /locus_tag="CNH00440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00440"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44929"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB4"
FT                   /protein_id="AAW44929.1"
FT                   /translation="MSIDFSGLRFGVATASLGMNSIHDIYKKFEALQKAGFKYVEVGFG
FT                   AYMEWVRSELPDLPPSTCPPEWSEADEPDPSDDAIWKALYAKAEDFKKLVAKYGMTCLV
FT                   LQPLNQFDGWPEGSKRAEWVRRKAEKWLPLCSKLAVEQLQVGSNDYAEANAPDEKTAED
FT                   MRWLAELGAKQNPPVKIAYESWCFSKRVSDWEHTWKIVQLGNHPNLGLCIDTAHPPLAP
FT                   AYGWDPTTGEGWTDEQYASFLERLRAVPKEKIFYVELSEVLKPVVPLGKGSPFDEWREK
FT                   AQSPRGDGFVWAVCGRPVPLVGRDAGRGVKGPNDMGAARALETFKAVLSTGWRGICMFE
FT                   FFEALHMEPADPEIPFKYADACALSNKRILEALKA"
FT   gene            complement(1063622..1066360)
FT                   /locus_tag="CNH00430"
FT   mRNA            complement(join(1063622..1063884,1063949..1065428,
FT                   1066160..1066360))
FT                   /locus_tag="CNH00430"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1063801..1063884,1063949..1065127))
FT                   /codon_start=1
FT                   /locus_tag="CNH00430"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00430"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44928"
FT                   /db_xref="GOA:Q5KCB3"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB3"
FT                   /protein_id="AAW44928.1"
FT                   /translation="MSTQLQHIMATLSPVSSSSVTATSPVLGTSPSAPATALAGTTITP
FT                   LINTGKPKTSKPRKRVNTAEKRSQHNAIERARRETLNSKFLDLARLLPSLASSRRPSKS
FT                   AIVNGSISHLTYQRKQRLLAAKLLKQVRIERDELLREVNEWRSVSGCALKECSAWTEEM
FT                   DEVTAVEKEIFGNFVSVDGEEDGDGEMEDGPVLATPIEDNKFMPLNNGMWNEFGYGMNP
FT                   ANGFVNSASDTLSQTSPVGSQAHTTVLTPPMSATEPQTVYNHTPSPSSSQGAASIVEAP
FT                   KDGMPTVPSQTNHFNQQLLNWSQQFFQHPMQQPDTATALPRPPQQVSPQSQNQRFNPML
FT                   PEAFNGMFNPLQMGHGVVPGQEQNVSADAFTQQLMASMFPGKYAAQPSISDLQKAVRAG
FT                   MGLGLGMMGNQWPQENAVEGF"
FT   gene            complement(1070149..1073626)
FT                   /locus_tag="CNH00420"
FT   mRNA            complement(join(1070149..1070404,1070483..1070531,
FT                   1070585..1070716,1070774..1070864,1070923..1071053,
FT                   1071111..1071260,1071307..1071759,1071812..1072492,
FT                   1072543..1072660,1072715..1072824,1072882..1073078,
FT                   1073129..1073626))
FT                   /locus_tag="CNH00420"
FT                   /product="sister chromatid cohesion-related protein,
FT                   putative"
FT   CDS_pept        complement(join(1070283..1070404,1070483..1070531,
FT                   1070585..1070716,1070774..1070864,1070923..1071053,
FT                   1071111..1071260,1071307..1071759,1071812..1072492,
FT                   1072543..1072660,1072715..1072824,1072882..1073078,
FT                   1073129..1073576))
FT                   /codon_start=1
FT                   /locus_tag="CNH00420"
FT                   /product="sister chromatid cohesion-related protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00420"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44927"
FT                   /db_xref="GOA:Q5KCB2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB2"
FT                   /protein_id="AAW44927.2"
FT                   /translation="MLEASPETLVFEPTDIFDFDFGLQPQPQLTRQDQDASPTSSAPAV
FT                   STNNDVSNSTATLLMEREGISRPTAPRIPTPPPDFEPDENWEDEMAVMEMEREFAELQD
FT                   EPSGRDDGNDEQTQSRISGKGKDKETTGYEFLSNGIFDFDVPVASSSRVTLTPPLDIPA
FT                   ISLDQLPKEKEPQSGLVKQTRPCTLPSLMAATADGDMITFQRRWKPQAISPLELQQRGG
FT                   KGKAGELLTVPLHKLLDQVNELKSREKALKLQRQIDEEFEGQTKKIQMGTTMWVDKYRP
FT                   KKFTDLLGEDRVHREVMSWLKEWDKCVFKRQQPQAKKRPFDASDSKPFAVDPLGRPHER
FT                   VLLLSGPPGYGKTTLASIVARHAGYRILEINASDDRSYQTVQTRIRNAVDAGTSLGAEG
FT                   KPTCVVIDEIDGAGGGESGFIKALIKLIQDVPAKKKSNTPAKPLRRPIICICNDLYAPA
FT                   LRPLRSYARIIRFRKPQAQSLVVRLRDICKREGLQSDTRSLNTLVEMTSGDVRSCLNTL
FT                   QFIKSRSSVVTEEAIRATSLGLKDTSTTLQTAWNAIFIPLAAKKRRAQGSIDDTRYLPR
FT                   IIPIINSCGEYDKLLLGAFEHYPNLKPLDGTMKNLTKVHEWLAFSDRLQARVTSEQEWE
FT                   LLGYMPWGVGAWYPHLASQGNSSKPTEYPKIDYEAYQTRASNEEVATAFKNVLPPILRS
FT                   MFTTSTTLTELIPFLMRIISPPLKPVNANIVKPAEKAVLERLVELMIPLGLTFYKEKAE
FT                   NGQPMMRLEPAIDVFVHYDGKRAEDILASRFMIRQLISQAMDAELAQKRGGADTEASDT
FT                   GADGFAKAYGLMGNIAKKPEEKALLPVTDFFGRTVAVIEEDVTADGVRPQAPPKKKFRP
FT                   IYKFNEGSLSAVRRSVKMSALM"
FT   gene            complement(1073733..1075560)
FT                   /locus_tag="CNH00410"
FT   mRNA            complement(join(1073733..1074500,1074550..1074721,
FT                   1074784..1075028,1075105..1075560))
FT                   /locus_tag="CNH00410"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1073881..1074500,1074550..1074721,
FT                   1074784..1075028,1075105..1075519))
FT                   /codon_start=1
FT                   /locus_tag="CNH00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00410"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44926"
FT                   /db_xref="GOA:Q5KCB1"
FT                   /db_xref="InterPro:IPR008728"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB1"
FT                   /protein_id="AAW44926.2"
FT                   /translation="MPSFTRRIPVANPPPPGTTPSPIHSLPLLPTGLPSMDDLLGGGLP
FT                   LHSILLVLAPDTQSAWGRLLERYWIAQGLASGQAGVLVGEKEEGEAVVKGCMWTEGGVS
FT                   GDGSESEGEGGVEGGERKIAWRYEKMGKFQTTVKGNGSNLSLMTTIPPEALSLMQESGQ
FT                   MSYVAINSDEPSTSRSCVLDEVLKGVWEKLQHADKGRATRLAVHELGSLDWGHISMSEI
FT                   HRFIHSLRELLKTKPASALITLPASLILSMGNERESIVRRLSWGVDACVELKGFADDPT
FT                   LPPLFPTHGLLTLHSYPTTHALLPSTLKHSTLLGVSQSSTSASSSGGGGGAGENNLGFR
FT                   LKRKRFVVETVHLGVEGGVGERRTGGDVREALDGADATHSHAHSHPTMTIPSSGIEPSQ
FT                   PVLASTPQTGVDDKPRGADQDKKPSKPRARVRFGGEEEVIIVGKGGDGSKHDHAHSHTH
FT                   DHGPRGKDQPQKIALRHDRPDLYEF"
FT   gene            complement(1075771..1077566)
FT                   /locus_tag="CNH00400"
FT   mRNA            complement(join(1075771..1076686,1076747..1076859,
FT                   1076908..1076982,1077077..1077566))
FT                   /locus_tag="CNH00400"
FT                   /product="B2-aldehyde-forming enzyme, putative"
FT   CDS_pept        complement(join(1076135..1076686,1076747..1076859,
FT                   1076908..1076982,1077077..1077416))
FT                   /codon_start=1
FT                   /locus_tag="CNH00400"
FT                   /product="B2-aldehyde-forming enzyme, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00400"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44925"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCB0"
FT                   /protein_id="AAW44925.1"
FT                   /translation="MLALLALFQLLPILALAAHNPPHRRAHERARKNYEHIHGRDAEES
FT                   PSIVERDNHYDNRTIVERDHFDNRTLTPRGTTYTGVGTFYYTGLGACGLNSQDSDYMVA
FT                   LNSAQYGSGYPGPQCFKYITIQMGSTTVSGVEILDECPTCDYGSLDLSPGLFTRFADYD
FT                   AGTIQITWWFDDDAPAATTTSETPTSTYVPPTSTWVAPSSSSTSTYVWIPPSSSSTPEW
FT                   VEPSTSPTPSSTTQWYSSPAETSTSTTPTSTWVAPSSTSTSVWVESSTYSSSAPSSTIT
FT                   SSAYSSASAAVNSTNPFAIVSNASNSSVSATISSDTGVSGSANSGSSEVSVEVTGNLEM
FT                   INALAAQYGQLVVEAALQS"
FT   gene            complement(1078198..1081012)
FT                   /locus_tag="CNH00390"
FT   mRNA            complement(join(1078198..1080762,1080812..1081012))
FT                   /locus_tag="CNH00390"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1078256..1080762,1080812..1080950))
FT                   /codon_start=1
FT                   /locus_tag="CNH00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00390"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44924"
FT                   /db_xref="GOA:Q5KCA9"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034138"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA9"
FT                   /protein_id="AAW44924.1"
FT                   /translation="MASAEIITKRLHIGGLKPEITTIHLKDRFSIFGTVKDVEELQPDA
FT                   LGNPRPFTFLTLETTPAQLRRCLNIMSGSHWRGALLRIAEAKPRFDVAINAANNSDPGL
FT                   KAKQIERKRKRVMLSRGEDVGKEAQDMIIVDVKRAEKKKFWVALNIENGDTKATRLVRP
FT                   VCMRAERPIGVVERKENSRRRARLPPARSFRKVINPIQWGSQMVLFSTEEQVARPNQQE
FT                   GEWEYEEFEEDDEKETAEDGKVPIGVWKKTVNGEVVQEEVVRGKRRRVEADGYDIEVDL
FT                   DLGSDDLPVAGSAASSPLFGTRHLAADREGSPLFPVHKNHLGSPVPTSSQESDDEPQQP
FT                   SSPLFSTRPAEGLEQEELSVSSSSFTSASGSPLQAPSPLFPTRTVPEEDQFLTSPSPTP
FT                   SSASPPIPDAIPVPAPKCLPAPPIPAVPAPLIQQVRTEKSAALNVLGSLLGGLEGPAST
FT                   RMEKLTINEWKGFLEDDSDDDSDGEDVEIGRGKKKEREKAPAEAEVIGEENFKVHEPMI
FT                   EVFMVEGSGKPQDDAENPSSNEERSSSSDESSSNDDKMDVDPPTGNGDEKQSSQEASSS
FT                   SESGSSSSSGDDDEQDDDNGDSNGDSDDSDDSDDSDDSDDSDDSDSGNSDSDSDSDSND
FT                   SDSDSDSDSDSDPSSDSESDDSDKSPSALYAKPQSSKPTTLKDLFAPTAPSTSLFSGPS
FT                   TSAAQSATGFSLLANLAEDLELDDELDIPLPVPGAIAAQKEEDELQPLSMMEGGRGKVK
FT                   LDLENAAETPMFFAIPMDKETAERTKGKKGESRNPFNELYFGVPKPLTKEMEEYDYDQE
FT                   GYGPNGYGQEQGREEQEFPLMGFHRQPREGEAAMKGLWEKERGELTQAWKRRHREAKKQ
FT                   RRRKGGEDID"
FT   gene            1081164..1082816
FT                   /locus_tag="CNH00380"
FT   mRNA            join(1081164..1081281,1081385..1081642,1081692..1081709,
FT                   1081766..1082016,1082059..1082149,1082197..1082231,
FT                   1082281..1082471,1082528..1082816)
FT                   /locus_tag="CNH00380"
FT                   /product="integral to membrane protein, putative"
FT   CDS_pept        join(1081405..1081642,1081692..1081709,1081766..1082016,
FT                   1082059..1082149,1082197..1082231,1082281..1082471,
FT                   1082528..1082711)
FT                   /codon_start=1
FT                   /locus_tag="CNH00380"
FT                   /product="integral to membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00380"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44923"
FT                   /db_xref="GOA:Q5KCA8"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA8"
FT                   /protein_id="AAW44923.2"
FT                   /translation="MVLTRRQAVSASSTPPPNMPETTPLLPKPGETCEDGERKTISYEE
FT                   SLMLLPWQTDNDYIRHGYRRATPSIRKCLWSAVSYLHNETVNIHSHSVGAVFFLSLLPL
FT                   HLIPTHFPTLNQSCSPLPTPPTLHDKVALALYLICAVLCLSLSSWFHTVSCHSKEVCDA
FT                   AHRGDYIGIVVLIVGSITPGMYYAFYENAFLQVFYMAGIIIAGIVSAYIVLSPHHRSHR
FT                   WHRTLTFIVLGLSAVVPITHILFTQGLVHAREKMSLDLIVAGGASYIFGALLYAARIPE
FT                   KLSPGTFDYFGSSHQIFHCFVLAGAGFQYAALRGMVWGRAMAVGKTIAESEGLL"
FT   gene            complement(1082777..1085792)
FT                   /locus_tag="CNH00370"
FT   mRNA            complement(join(1082777..1082984,1083036..1083894,
FT                   1083954..1085329,1085380..1085435,1085486..1085518,
FT                   1085578..1085792))
FT                   /locus_tag="CNH00370"
FT                   /product="beta-glucosidase, putative"
FT   CDS_pept        complement(join(1082836..1082984,1083036..1083894,
FT                   1083954..1085329,1085380..1085435,1085486..1085518,
FT                   1085578..1085696))
FT                   /codon_start=1
FT                   /locus_tag="CNH00370"
FT                   /product="beta-glucosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00370"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44922"
FT                   /db_xref="GOA:Q5KCA7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA7"
FT                   /protein_id="AAW44922.2"
FT                   /translation="MPTNNTNLDRSFLTANIDDLLKQLTTEEKISLLAGKDWWTTVPIP
FT                   RLNIPSIKMTDGPGGARGDSFYHMTPACALPSATSLASTFSPDLIHSAGNLLALETLAR
FT                   NAVCLLAPTINIQRSPLGGRAFESFSEDPTLSGLIAAAYVAGLQEGGVSAAIKHFVGND
FT                   QEHERMGEDSVIAPRALREIYLRPFQIALKKSKPQAFMTAYNKLNGTHCSENEWLLEEL
FT                   LRKEWGFDGLVMSDWYGTYSISESINAGLNLEMPGATRWRPNGLVTHLIKAHKIDPRQL
FT                   DKVAGGVLRWVQKLVKKNEELVYSPPGKEKTRTEDQAEDAKLLRRLAGESIVLLKNELN
FT                   VLPIREPKKIAVIGPNAKAKVLTGGGSAQLRSAWSSTPWQGLSDNAPQGVELSYSLGCH
FT                   SDKFLPILDDSFTCPDGSPGFQLSHFPITSSGDKAEEPVHVETWDSSDMFLADFTAPGL
FT                   TKEYFTQLDAVWTPVEDGEYEFGVVVTGKGWFWINGELVIDASREDERSTSFFNLGTKE
FT                   IKGRTRATKNKRYDIRFLHDTRPYSVNNINTPIASAGMRLGYIQVIPASTLLSNAVSLA
FT                   ASSDVALLVIGLNSGWESEGYDRPDLSLPMDTDKLVNAVAEANPNTIVVIQAGSAVSMP
FT                   WLDKVKGVVFAWYLGNETGNAIADIIYGYTNPSGRLPMTFPKRELDIPANLNYKSARTR
FT                   VYYDEGIWVGYKHFNARGIDPLFPFGHGLSYTTFAYSGLHISQVPESPKNVGADGWRVE
FT                   VGVQVENIGMEEGAHTVMFWLSPPPESPNGLKHPKWTLQGFQKVYGLKPGAKREIKVTF
FT                   DKYAVSHWDELWNTWRAELGEWTVRVGLDAQNISGEKATFKIEDDLEWRGL"
FT   gene            1088719..1090933
FT                   /locus_tag="CNH00360"
FT   mRNA            join(1088719..1089489,1089722..1089829,1089876..1090238,
FT                   1090287..1090933)
FT                   /locus_tag="CNH00360"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1088747..1089489,1089722..1089829,1089876..1090238,
FT                   1090287..1090695)
FT                   /codon_start=1
FT                   /locus_tag="CNH00360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00360"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44921"
FT                   /db_xref="GOA:Q5KCA6"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA6"
FT                   /protein_id="AAW44921.1"
FT                   /translation="MASKSSSIHPYSPLAYPRRRTSLSVALNSHPLQPPYPYSYPSHRR
FT                   RAGTMPSQRTRRSRDTSTSLTRKTVIAFLVILSLVLLGTVIVLSTVSYYLAIPSWAYLT
FT                   ETEVAWRAEDVIKPLLEQPRPKLSKRVQWGELDSDVLSYSSTGAAASASTISVDSATMT
FT                   AETWDEFKEEMEELDAAEEVDEDNATQPESEAVDTDPTATSSIEEDNGQWGIDGMGTGS
FT                   YWMRNDWDGRVRDTDSWERLYNVTNRPGENIPRLIHQTWKDDQLPEKWRKAWKECREGM
FT                   PDYEYMLWTDDLSREFIAKHYPAHLHMYDSYEFPIQRADSIRYFILHHFGGVYMDLDIG
FT                   CRRRLDPLLQGDWEVILPITKPVGISNDLIFSSKGSAFMDGTVHGLAAFNHKYFSNYPT
FT                   VMFSTGPMFLSAQYAIFSASHPLTESHPRSEIRVLPKSLYGKNAPISDVPHSFFSHFYG
FT                   SSWHADDAGFITFLGHWGKRLMWIGVVILICGAIRLIWVKRKAAAGHQYQLLSILPTTR
FT                   SPSPSGYDTVEASKTCAGSIHVS"
FT   gene            1091709..1093226
FT                   /locus_tag="CNH00350"
FT   mRNA            join(1091709..1091841,1091901..1091946,1092092..1092142,
FT                   1092201..1092224,1092282..1092288,1092466..1092725,
FT                   1092804..1093226)
FT                   /locus_tag="CNH00350"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1091835..1091841,1091901..1091946,1092092..1092142,
FT                   1092201..1092224,1092282..1092288,1092466..1092567)
FT                   /codon_start=1
FT                   /locus_tag="CNH00350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00350"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44920"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA5"
FT                   /protein_id="AAW44920.2"
FT                   /translation="MTRGDQRERDRAKALKAQAAKGTKLAGSPQQRREADAKAVAEKQA
FT                   LKAKARAEAEARGELSAYDAKVEKRKQNAQQKK"
FT   gene            complement(1093473..1095920)
FT                   /locus_tag="CNH00340"
FT   mRNA            complement(join(1093473..1093752,1093809..1094783,
FT                   1094833..1095241,1095297..1095515,1095569..1095640,
FT                   1095701..1095767,1095840..1095920))
FT                   /locus_tag="CNH00340"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1093624..1093752,1093809..1094783,
FT                   1094833..1095241,1095297..1095515,1095569..1095640,
FT                   1095701..1095767,1095840..1095861))
FT                   /codon_start=1
FT                   /locus_tag="CNH00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00340"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44919"
FT                   /db_xref="GOA:Q5KCA4"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA4"
FT                   /protein_id="AAW44919.1"
FT                   /translation="MVDTQYAFRAQKTAGVADAPAWEVSNRIPAETVGSKCYAYSPNGE
FT                   WLAYAMNNCVEIIPSHSSSPTPVTLQQANIVALKFSPMSSYLFTFERPVKTESGEMYKN
FT                   AKAWDVKNGEIVGGWYQKTMEDWEPIITPNETHLLRAGPSDLAIFSPPFAPRPSTRLKI
FT                   EGIRGIFISDPSALPATSTNSRPIPAYHEPAVAIWIGEKKGAPASLGLWSLSSLMGKNA
FT                   LQANGNGDIQTETRDMPPTTARKAFYKADKLTVKWNNAGTMALFLAQSDVDNSGKSYYG
FT                   ETNLYLVGLDGTFDGLVELDKEGPIYDFAWSPISREFTVCYGYMPARTQMFDLKAKPVY
FT                   SFGENPRNTLVYQPQGKLLLSAGFGNLAGGIDIWDVSTRNKVAEFKASNASHCEWSPCG
FT                   RYVLTATLSPRLRVDNGVKIWWCNGQLLHIQPVEELYQASFAPQRVTEIGSFPAIVPKA
FT                   PEANPSVAAYRPKGETDGVAAKPAGAYRPPGARNRPEGENASASFGSSRGKPGVRTVPG
FT                   AGGRQPPGSAPGASTGAGGDDKKKRQRKRGGKDKEEEKKDEAPTQEAVKPEVKEEAGED
FT                   AVAKKIRNLMKKLKAIDELKTKLAAGEILEKTQLKKIESEAQVKSEIKALGGNV"
FT   gene            1096104..1097766
FT                   /locus_tag="CNH00330"
FT   mRNA            join(1096104..1096201,1096295..1096601,1096756..1096956,
FT                   1097020..1097336,1097401..1097766)
FT                   /locus_tag="CNH00330"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1096165..1096201,1096295..1096601,1096756..1096956,
FT                   1097020..1097336,1097401..1097612)
FT                   /codon_start=1
FT                   /locus_tag="CNH00330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00330"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44918"
FT                   /db_xref="GOA:Q5KCA3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA3"
FT                   /protein_id="AAW44918.1"
FT                   /translation="MHQIGNSIKLLTGNAHPKLAEAVAARLGITLTPCHVSKFRSLETS
FT                   VQIHSSVRDEDVFIIQSPSPPDVNDHLMELLIMISACKTASAKRITAVIPCYPYARQDK
FT                   KDKSRAPITSKLVANLLAVAGADHVITMDLHASQIQGFFDIPVDNLFSEPTMMQYIKSE
FT                   IPGWRDAIIVSPDAGGAKRATALADQLNLDFALINRKRRRDLAASMCLPTVPPTPTGSD
FT                   SGSVHSHDIDDESNIVEKMELLVGDVKGKVAILIDDMIDTGHTVRLAAGVLRENGAKEV
FT                   YALVSHGLLSDTTMENLSDLPVKKLIVTNSIDQTKRVIACNGLLETLDIAPVIAESIRR
FT                   THNGESISALFRPHDSF"
FT   gene            complement(1097740..1099524)
FT                   /locus_tag="CNH00320"
FT   mRNA            complement(join(1097740..1097859,1097908..1097985,
FT                   1098054..1098213,1098318..1098425,1098499..1098533,
FT                   1098588..1098601,1098659..1098725,1098776..1098790,
FT                   1098853..1098895,1098945..1098967,1099071..1099524))
FT                   /locus_tag="CNH00320"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1097831..1097859,1097908..1097985,
FT                   1098054..1098213,1098318..1098425,1098499..1098533,
FT                   1098588..1098601,1098659..1098725,1098776..1098790,
FT                   1098853..1098895,1098945..1098967,1099071..1099356))
FT                   /codon_start=1
FT                   /locus_tag="CNH00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00320"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44917"
FT                   /db_xref="GOA:Q5KCA2"
FT                   /db_xref="InterPro:IPR040453"
FT                   /db_xref="InterPro:IPR040661"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA2"
FT                   /protein_id="AAW44917.2"
FT                   /translation="MNFIQWSGQCIAVRKQAGAVLALPPLSFQAHVMHGPPRLIARRMP
FT                   SKDEALKSSSLASSTLSSCDFYRFNLFTAGQQPKKNMSKRGLSMEEKKTKMLEIFHESA
FT                   EFYSLKELEKIAPKSKGIVVQSVKEVLDDLVSDGFVVMDKIGTGNYFWALPSAAGATKN
FT                   TALVKATKELEKIDAGISETQAGLVEAEKGREDTEERRTLLAALQQEEQTSIKLKAELA
FT                   AFGAADPVRYQKKREAVKVCKDAAVTWTDNTLMLLQYAVSLGVEAAAIRGMLGITEEWE
FT                   DLKL"
FT   gene            complement(1099819..1099913)
FT                   /locus_tag="CNH00310"
FT   tRNA            complement(1099819..1099913)
FT                   /locus_tag="CNH00310"
FT                   /product="tRNA-Ser"
FT   gene            1100040..1101585
FT                   /locus_tag="CNH00300"
FT   mRNA            join(1100040..1100421,1100483..1100732,1100791..1101067,
FT                   1101125..1101244,1101299..1101585)
FT                   /locus_tag="CNH00300"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1100089..1100421,1100483..1100732,1100791..1101067,
FT                   1101125..1101244,1101299..1101335)
FT                   /codon_start=1
FT                   /locus_tag="CNH00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00300"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44916"
FT                   /db_xref="GOA:Q5KCA1"
FT                   /db_xref="InterPro:IPR013260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA1"
FT                   /protein_id="AAW44916.1"
FT                   /translation="MPPRKSKSRDVKSTAPSPSPSIGQRRSSRAPRKEPAPAVEVVEEK
FT                   DEVSSESEEVDAAEGLETRETDAGEAEQDEQVQEVAEKEHVKSNKGKEKMSMAERMAKI
FT                   KELRMKMNQSAAQNRRDLVEDHQKAQVTAKELARLEKQRKLAQTLRLKAEAEENGEDIE
FT                   RKKNWEWTIEDNERWQAKLEEQKVKQDTHFHNAEDDAYKKYNRNLRATKADLVAYERQK
FT                   EAALGLAPGTLVPARATSSSLAASSSKPGLTGAEDLYRGADTLVYGDNKPSEDAVDRVI
FT                   SKINKDIGKKKRTKKDDEDGEINYINERNKVFNKKISRYFDKYTKEIRANFERGTAL"
FT   gene            complement(1101427..1103804)
FT                   /locus_tag="CNH00290"
FT   mRNA            complement(join(1101427..1101763,1101826..1102206,
FT                   1102260..1102341,1102396..1102522,1102574..1102662,
FT                   1102713..1102859,1102908..1103006,1103064..1103137,
FT                   1103204..1103309,1103390..1103444,1103510..1103804))
FT                   /locus_tag="CNH00290"
FT                   /product="cyclin-dependent protein kinase, putative"
FT   CDS_pept        complement(join(1101633..1101763,1101826..1102206,
FT                   1102260..1102341,1102396..1102522,1102574..1102662,
FT                   1102713..1102859,1102908..1103006,1103064..1103137,
FT                   1103204..1103309,1103390..1103444,1103510..1103511))
FT                   /codon_start=1
FT                   /locus_tag="CNH00290"
FT                   /product="cyclin-dependent protein kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00290"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44915"
FT                   /db_xref="GOA:Q5KCA0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KCA0"
FT                   /protein_id="AAW44915.1"
FT                   /translation="MNYVQLEKLGEGTYATVYKGRSRTTSEIVALKEIHLDAEEGTPST
FT                   AIREISLMKELKHVNIVRLHDVVHTESKLVLIFEYCEQDLKRYMDIHGDRGALDLNTVK
FT                   SFTHQLLQGIAFCHDHRVLHRDLKPQNLLINKRGELKIGDFGLARAFGVPVNTFSNEVV
FT                   TLWYRAPDVLLGSRTYSTSIDIWSVGCIFAEMITGYPLFRGRDNADQLVQIMKIVGTPS
FT                   DATIAQIKLNSPEIQIKSPLAKHAKQPFQAIIPRAPRDAISLLEHLLQFEPTRRYDAHQ
FT                   AMAHQYFTSGPIAPPTLHENNPAVSSASSLALPPRVAARASQASAAVQAQQAAQAQAQA
FT                   QAQAQAQAQAAQNAQMMAQQQQQQQQQQQQQQQYEMMMGQQNMQGYYDPQAAAQMQAHQ
FT                   QAQAQAHAAQMQQMAQQGYYMNPNGQHGHHH"
FT   gene            complement(1104160..1105270)
FT                   /locus_tag="CNH00285"
FT   mRNA            complement(join(1104160..1104708,1104773..1104949,
FT                   1105002..1105270))
FT                   /locus_tag="CNH00285"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1104271..1104708,1104773..1104949,
FT                   1105002..1105232))
FT                   /codon_start=1
FT                   /locus_tag="CNH00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z9"
FT                   /protein_id="ALO69552.1"
FT                   /translation="MIEPVVDPSLREPPIAGSSRGKRKAKGGSSSGNAASTSRRGRGRP
FT                   RRARGSDDGVRGVSSTDGQTPNVQDAYNAESSKRLRIASPFKLHAAIQGRKDTLYGSGS
FT                   SVAGPSRKSSRSGATGMESLASVAVAHDPRRNSSYNRPPYPFGLTPFRYPCHNLDLPPP
FT                   PPGNPNDPNFRPFDPRAFHEEGAASTLSSNGTTSKSTPIHTPVDPSSSGPSRQYASATH
FT                   HHYPARPHHYTGGYRASQAELEANAHAAYESISALLSASQYPVMDELGDNERYGPEQGA
FT                   "
FT   gene            complement(1105437..1108223)
FT                   /locus_tag="CNH00280"
FT   mRNA            complement(join(1105437..1105661,1105720..1106497,
FT                   1106547..1106668,1106730..1106914,1106966..1107093,
FT                   1107143..1107621,1107667..1108223))
FT                   /locus_tag="CNH00280"
FT                   /product="ATP dependent RNA helicase, putative"
FT   CDS_pept        complement(join(1105537..1105661,1105720..1106497,
FT                   1106547..1106668,1106730..1106914,1106966..1107093,
FT                   1107143..1107621,1107667..1108168))
FT                   /codon_start=1
FT                   /locus_tag="CNH00280"
FT                   /product="ATP dependent RNA helicase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00280"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44914"
FT                   /db_xref="GOA:P0CQ90"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CQ90"
FT                   /protein_id="AAW44914.1"
FT                   /translation="MAKIDKKTKLKLNKKSVRAPSKPTTEKKPKKYVTADTLTWKPVKT
FT                   SSFSGIDGGGGMMMLEELEDVGIEWEETDGGRKIAKFVEVESKTSKGKKNAAQEEPNQE
FT                   GRGDDEKASSASETEEGKKADDKEAVEEDDEEEFPDFAGFAEEDLNAADEEEHPNLDDE
FT                   PAFNDDLLPEWSSISLHPSLKRSFLASSFTAPTAIQSRAIPAGITGRDVVGVAETGSGK
FT                   TLAYSLPILHYLLGQRKSKAGIKRPLSALVLCPTRELALQVMDHLNALLKHALATPDGE
FT                   KPQGPPRVSVGSVVGGLSAQKQKRILERGCDVIVATPGRLWDLIKADDELATSVRTLRF
FT                   LVIDEADRMIENGHFAELESIVKLTQRSTAQQGPDDDDPVFQAMATLFEESTAREDMQT
FT                   FVFSATLSKDLQKNLKRRSRSWKGKGKRSSTLEDLVEKLDFRDENPEVIDLSPEGGVVS
FT                   SLRESMIESTKDDKDLYLYYFLLRYPGRSIVFVNSIDSIRRLLPLFTLLQLPVFPLHSH
FT                   LQQKQRLKNLDRFKSNPKGILIATDVAARGLDIPQVDHVVHFNLPRTADAYIHRSGRTA
FT                   RAQNEGFALQLVSPDEKSVQRALMKSLERTHELPDLPIEAGFLPSLRERLRVATEIEKA
FT                   QHRATKATHDKNWLLEAAEAMDIDIDPSMLDGEDDDPDAPYYKPKKQDRGKGKASVENL
FT                   KMELKALLQEKLVARGVSIRYPTSGSKVIVDDLIKSTGHGMLLGASTSKAYDQVEKTGK
FT                   RKLGSGRPGAVKKKKVEGR"
FT   gene            1108361..1109888
FT                   /locus_tag="CNH00270"
FT   mRNA            join(1108361..1108557,1108608..1108756,1108812..1108889,
FT                   1108944..1109104,1109160..1109274,1109333..1109647,
FT                   1109698..1109888)
FT                   /locus_tag="CNH00270"
FT                   /product="DNA repair-related protein, putative"
FT   CDS_pept        join(1108410..1108557,1108608..1108756,1108812..1108889,
FT                   1108944..1109104,1109160..1109274,1109333..1109647,
FT                   1109698..1109790)
FT                   /codon_start=1
FT                   /locus_tag="CNH00270"
FT                   /product="DNA repair-related protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00270"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44913"
FT                   /db_xref="GOA:Q5KC98"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC98"
FT                   /protein_id="AAW44913.1"
FT                   /translation="MSRDAITNAAGTVESTLLHQVFIQSLLSRRVVSEAIALELYKRAV
FT                   TAVRAYDRQFNPPYAISGHGVASFVTDVSTLLHSVSLEVIRTIDQRSDRAFFVLRNLDA
FT                   SEVASFATDLNSMEVEYLRNLIESIVVSYPANSLAIGQARDVINDSPLTQHKMTKSHAE
FT                   SLLDALVSRGWLYKSKRTRFSLGVRALAELETYLKNEFDQYVKSCAQCRRVVTEGLACS
FT                   NVGCDCHIHNTCYARNIQQLANPVCPSCSSSFRDLAPKPVGEKAVSIMEDNFKGGRKRK
FT                   GKGKNVGDMDDEGEEEEGGSSEAEDELDERRESQSQTQNQGSIRRSYVPETQYDEEPST
FT                   GSAGPSKRIRRG"
FT   gene            complement(1109857..1112181)
FT                   /locus_tag="CNH00260"
FT   mRNA            complement(join(1109857..1110854,1110904..1111151,
FT                   1111208..1112063,1112114..1112181))
FT                   /locus_tag="CNH00260"
FT                   /product="expressed protein"
FT   CDS_pept        complement(join(1110074..1110854,1110904..1111151,
FT                   1111208..1111291))
FT                   /codon_start=1
FT                   /locus_tag="CNH00260"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00260"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44912"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC97"
FT                   /protein_id="AAW44912.1"
FT                   /translation="MSDTDRPSRVWLFLANLSLCLCSVREDDSERQALYPPDTVLSAPR
FT                   PRLRPRLSNLSPYGSTTSRRWPSASTSPIKSGGLAGFTGIESNVDAETRREEGKRKMDS
FT                   ISKAFAERMTALDLPPHIHTLNMPFTPSLQPLTTAVSHPTLPTIHTIRPLGSPNRPSAP
FT                   HLGRSISEPRSLHDLGGFAAHHVPFGSSVVVHGRGISPGVSRGRGRMRSATIGERWTVP
FT                   GEGTRGRKGLERRSPSGLNKESIDSDEVEQEAKMERSASPSLNLSFGRPVLRSCSNSQS
FT                   HSCTRRRQSSPLAGHPDQQEPLSMGSCWIDPESHLHSSSRAHSDVRAQEVIHRDLGLNA
FT                   LYSGSAASHPKRIKGKGKGKKTRRMRLSSS"
FT   gene            1112466..1115517
FT                   /locus_tag="CNH00250"
FT   mRNA            join(1112466..1114220,1114277..1114957,1115019..1115517)
FT                   /locus_tag="CNH00250"
FT   gene            complement(1112492..1115481)
FT                   /pseudo
FT                   /locus_tag="CNH00240"
FT   gene            1116610..1117904
FT                   /locus_tag="CNH00235"
FT   mRNA            join(1116610..1116850,1116910..1117904)
FT                   /locus_tag="CNH00235"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1116662..1116850,1116910..1117581)
FT                   /codon_start=1
FT                   /locus_tag="CNH00235"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A0A0S2M605"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M605"
FT                   /protein_id="ALO69553.1"
FT                   /translation="MDGEPPSKNGGTFLRLPSRGQLLHALTLTQNTSAMVFTIFLVPHL
FT                   ASPVVAAFAGLDGAEKTMMIARDLYIPLEPILVYIPLTIHLLSSLSRRLLLSTSTSLPK
FT                   SIRFPTLPHQTLAYPLVFLLIPHIITHRLIPSSSAPPIRELSPSELGWEFVGYNLRSWG
FT                   AWIAYLGLVGAGAWHALVGGMKVATWLKSLRRRPARGGPSNILSTKRKIYPDDGEKSGS
FT                   DPAPRVIAKPRKLGLRGLIVVLLGVVSFGLARVTSDTGLVSGMMKRRYDAVFNATPWAK
FT                   LYRLF"
FT   gene            complement(1119377..1121676)
FT                   /locus_tag="CNH00230"
FT   mRNA            complement(join(1119377..1119892,1119963..1120236,
FT                   1120298..1120584,1120642..1121450,1121500..1121676))
FT                   /locus_tag="CNH00230"
FT                   /product="cytoplasm protein, putative"
FT   CDS_pept        complement(join(1119783..1119892,1119963..1120236,
FT                   1120298..1120584,1120642..1120663))
FT                   /codon_start=1
FT                   /locus_tag="CNH00230"
FT                   /product="cytoplasm protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00230"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44910"
FT                   /db_xref="GOA:Q5KC95"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC95"
FT                   /protein_id="AAW44910.2"
FT                   /translation="MTSSMPIPDGVSEGSYIGTFIGESIPVVKCETNDLLVPATSEIVF
FT                   EGFLSVTETAPEGPFGEMHGYVFQGNSRDSPVYKVNCITHRDDAILPMSACGRLTDETQ
FT                   TLIGSLHAVEIGEICRDAGLLVTECFSPFKYQVTWIALQLDGKKLTEMKTTSEELRKKV
FT                   GDLVFNTKAGSTTHRIVLVGDDIDVYDGTDVLLAFSTQCCPNMDETFFEDVPGFALIPY
FT                   MGHGNGNP"
FT   gene            1121871..1125451
FT                   /locus_tag="CNH00220"
FT   mRNA            join(1121871..1121999,1122101..1122123,1122254..1122386,
FT                   1122436..1122511,1122562..1123868,1123916..1124347,
FT                   1124405..1124866,1124937..1125451)
FT                   /locus_tag="CNH00220"
FT                   /product="ubiquitin-protein ligase, putative"
FT   CDS_pept        join(1121965..1121999,1122101..1122123,1122254..1122386,
FT                   1122436..1122511,1122562..1123868,1123916..1124347,
FT                   1124405..1124866,1124937..1124970)
FT                   /codon_start=1
FT                   /locus_tag="CNH00220"
FT                   /product="ubiquitin-protein ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00220"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44909"
FT                   /db_xref="GOA:Q5KC94"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR024928"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR035983"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC94"
FT                   /protein_id="AAW44909.1"
FT                   /translation="MVAFTATGNRNLTRKIRVTIVAADSLIKRDILRLPDPFAIVSVDS
FT                   EQIHTTSVIKRTLNPYWNENFDIDVKDSSIVAVQIFDQRKFKRKQDQGFLGVINIKVSD
FT                   VIDLELGGQEMLTKELKKGSDGQAVQGKLIVYLSTQTNAPISNNPAASSSTNVATPAPA
FT                   ASALASNNAAGQSISRPASAIQPAQGAEASVPTSADAIASAVPQPAAQAVGVSSSGAPN
FT                   VNPTIQAASTGQTGTSTNVGHEFDSHSDQYGPLPVGWERRIDHLGRQYYVDHNTRTTTW
FT                   NRPSDNELSNSATQATSTGEARARHNQRTLPDEMLDVQQSGANSGGATTPTTGSAQANP
FT                   VNASNATTAGQGPLPSGWEQRFTPEGRPYFVDHNTRTTTWVDPRRQQLLRFIAPGQQGN
FT                   LSVQPQTVSQLGPLPSGWEMRLTSTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRD
FT                   FRRKLIYFRSQPALRSNTGQCHMKVSRDNIFEGSYTEIMRQTPNDLKKRLMIKFEGEDG
FT                   LDYGGLSREFFFLLSHEMFNPFYCLFEYSAHDNYTLQINPNSGVNPEHLNYFKFIGRVV
FT                   GLGIFHRRFLDAYFIVSFYKMILGKKIALQDLESVDAGLFRGLTWMLENDITGVIEDTF
FT                   SITEEHFGEVVTVDLKPGGRDVEVTEDNKKDYVDLVTEYRISKRVSEQFQAFMSGFNEL
FT                   IPQELINVFDERELELLIGGMSEIDVDDWQKHTDYRGYNPSDEVVEWFWKIVKNWPAEK
FT                   KSRLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVTQLPKSHTCFNRIDLPAYKS
FT                   YEALEQKLTIAVEETVGFGQE"
FT   gene            complement(1125424..1126783)
FT                   /locus_tag="CNH00210"
FT   mRNA            complement(join(1125424..1126207,1126297..1126363,
FT                   1126447..1126783))
FT                   /locus_tag="CNH00210"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1125732..1126207,1126297..1126363,
FT                   1126447..1126731))
FT                   /codon_start=1
FT                   /locus_tag="CNH00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00210"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44908"
FT                   /db_xref="GOA:Q5KC93"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR040107"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC93"
FT                   /protein_id="AAW44908.2"
FT                   /translation="MADKSKTERPSWNKEEYATKAKEKDKEAYEHAKATEESLAKGHAP
FT                   KKQSQYDDLPKPTELLKARTEDLGLTKNLNKTMLVTTTTTGKGPRGAGFYCELCNRTFK
FT                   DSLAYLDHINGRLHLLKLGQSTHVERSTLSQVRAKIASLRAATHQKVTAQNFDFQSRLK
FT                   AVKNAQEAERERRKDERRRKKMEREKREERRRMGILDDDEGNRDESGEKMDVDGAEKDV
FT                   KDGKKDKRQERKEKREQQVKDQQRDREVEKAIRENEDMSTMMGFGGFGTSKRK"
FT   gene            1126910..1131838
FT                   /locus_tag="CNH00200"
FT   mRNA            join(1126910..1127179,1127241..1127848,1127897..1128000,
FT                   1128050..1128291,1128344..1128509,1128576..1128745,
FT                   1128822..1129023,1129084..1129357,1129423..1129766,
FT                   1129856..1129947,1130023..1130208,1130278..1130477,
FT                   1130561..1130645,1130709..1131022,1131102..1131169,
FT                   1131242..1131348,1131429..1131838)
FT                   /locus_tag="CNH00200"
FT                   /product="expressed protein"
FT   CDS_pept        join(1126936..1127179,1127241..1127848,1127897..1128000,
FT                   1128050..1128291,1128344..1128509,1128576..1128745,
FT                   1128822..1129023,1129084..1129357,1129423..1129766,
FT                   1129856..1129947,1130023..1130208,1130278..1130477,
FT                   1130561..1130645,1130709..1131022,1131102..1131169,
FT                   1131242..1131348,1131429..1131754)
FT                   /codon_start=1
FT                   /locus_tag="CNH00200"
FT                   /product="expressed protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00200"
FT                   /db_xref="EnsemblGenomes-Tr:AAW45239"
FT                   /db_xref="GOA:Q5KC92"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR037624"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC92"
FT                   /protein_id="AAW45239.2"
FT                   /translation="MFNSPSTRRVQTPRRQQAQQPSSRLQALRVTKSPAPSNAETIRTE
FT                   RPVDEKEKVFWSKDERHSTTSLGKFPGEVAALIKASDLVVDPVTGQVDSRTGFALVSSP
FT                   RACIAWNYSKRTHSAPTTYAFPAPLPTSSPSRFPPPVLSALCTSTSEPGMILMSSTGEI
FT                   RYWESMSLALSNVERYQQLFLDLPQGDWIERLVKVDGNNFILTTTSSQAYRLSITSSAG
FT                   RLSPVVTPLMRPGGMFGRASPVIFGGKHDRFGIRSVASNGAEVYLMAQRSIQKWSFTSD
FT                   GQKLVQEYDIYEAIGRELFKNWSSIDISIDLEDVVALDSDSLAVLITYSDSTSPPSHAL
FT                   VLLSVHRSNPPIVNRTISISFTSGQDQRLLDIPRLVIPPGSTMAFVRFGSAVMMVSLDF
FT                   DAPYEEALTLKDPNNAYIGAGPVTSNSNSPTMVLIPAEGGLMNVEALEPRASPDSLNQL
FT                   STATARLKSKLEQAIFFGQRSDNPLSFELEEDVRGQGDVAEAAELVSGEVVAARSPYTP
FT                   TIYELRPHLLDRLDRLKALVKYIRTNGLMNQLPQATRRRLSGDGEKVRGALELWDYQNR
FT                   LMDQSSGPGPSQAKSLLSISIQVYFSSRHRFLAPSSSPTDEREQDLVRLFFRTEVSNLD
FT                   KLLTVVFGEFRDKQKGEVDVSERAGWVGEVNQIFIAVERAAAQYREEESDLYAIDREKP
FT                   AIEMWTASDSLIDSLDHLYTLTEALIKERTRELGSVIDEAHVAGGPTSRIEAGREELRK
FT                   EQVVQATLKRQMGWLAAALCTNMEDKCRVVVRRQMDDGADEQEGIMLKAKWDAMKPRVI
FT                   RPLVSVDRISEAYELAEHHHDFPTLVMLCNDPVAGQGKGDSRIQVYIEKFGEDFAFELY
FT                   RWYIDQGQLHALLTQDEVYGSLVTRFFETHHYPELGWIHHIACKRYGEAAGALTQVLDE
FT                   GEGKEESGELDFRKVVGSIAKLASMTDISLRGPSEARDQIFQKIGQQLSLIDIQSSLRT
FT                   YLLSLFPSTARSSRSIAKHFAPILTRLSHRPGSESGSAFLALFYNLAERVIGGEAVDLE
FT                   GMLDLLTLKDNVGREDDGVDALRVLVLDRSLPKARSEVALLAVWRRIYIRDDWAEISNT
FT                   VGRSEQAQRTKLKTTMIYRVLKALHSMPEFPQAAVISPYDTSIPPTTAELSARFPSLSS
FT                   EDIAALKADYDDEVAVLMEYVEKDALEERVKEVKGMIEREWEEEQGREINEAIGAQAES
FT                   EVVVVEAEDVEADEDVEM"
FT   gene            complement(1131695..1134219)
FT                   /locus_tag="CNH00180"
FT   mRNA            complement(join(1131695..1131958,1132070..1132876,
FT                   1132965..1133297,1133349..1133430,1133501..1133756,
FT                   1133808..1133811,1133861..1134219))
FT                   /locus_tag="CNH00180"
FT                   /product="SD08430p, putative"
FT   CDS_pept        complement(join(1131918..1131958,1132070..1132876,
FT                   1132965..1133297,1133349..1133430,1133501..1133756,
FT                   1133808..1133811,1133861..1134161))
FT                   /codon_start=1
FT                   /locus_tag="CNH00180"
FT                   /product="SD08430p, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00180"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44906"
FT                   /db_xref="GOA:Q5KC90"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC90"
FT                   /protein_id="AAW44906.2"
FT                   /translation="MTVRDPSKRAHTATTTARDSMIHRENNTVRPRNVEDITELEEKGL
FT                   LRRVDDDSPGPSPARRRGKGKEKETRLEKAPVEEEYSTGLTTRRDKEAFALLVLLYLLQ
FT                   GIPLGLTFGTLPFLLKSHLSYSQLAIFALSTWPYSLKLLWSPIVDAWFVKKWGRRKSWI
FT                   VPVQGLVGLGMWVIGGKIEEWLNVETVDVKFLTAVFGSLILAAATQDIAVDGWALTLLS
FT                   QPNLSYASTAQTIGIGIGNALSFTVFLAFNSIDFSNKYFRSPSRPLDYPLVSLGGYMKF
FT                   WAVVFVGVTVGLAVLKKEDPPSEDDPDMDVKKVYKVMWSIVRLKNIQTFLFVHLICKIG
FT                   FQVNDSVTSLKLLEKGLSKEDLAVAVLLDFPAQMAVGWLAAKWSRPAPSSSSSSHPLTA
FT                   GRGAGAGESGNVLKPWLYAFWARLAMAAISTLVVAGFPSNRASSVGTTYFLLIIATTLF
FT                   SSLTSTVQFVGICAFHTQIADPLIGGTYMTLLNTVSNLGGTWPKPLILRSVDMLTVATC
FT                   SVSSSSTTTSLRSKLSLSSSASGLGECVTEHGKNLCAQAGGECVMQRDGYYIMSAVCVT
FT                   LGAGLLVVFILPMVKRLAALPMSAWRVKIPN"
FT   gene            1134441..1135780
FT                   /locus_tag="CNH00170"
FT   mRNA            join(1134441..1134910,1134981..1135189,1135249..1135322,
FT                   1135391..1135780)
FT                   /locus_tag="CNH00170"
FT                   /product="phosphomannomutase, putative"
FT   CDS_pept        join(1134501..1134910,1134981..1135189,1135249..1135322,
FT                   1135391..1135513)
FT                   /codon_start=1
FT                   /locus_tag="CNH00170"
FT                   /product="phosphomannomutase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00170"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44905"
FT                   /db_xref="GOA:Q5KC89"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC89"
FT                   /protein_id="AAW44905.1"
FT                   /translation="MSAPQPASATIFPPGVTPFAQRRLPKTICMFDVDGTLSLARQSAT
FT                   PEMFATLRKLRESCAIAFVGGSDLTKILEQVGGDQGLSNFDYGFAENGLIAYKLGQQLE
FT                   SASFIKHVGEEEYKKLVNWILRYLSEVDIPIKRGTFVEFRNGMINVSPIGRNASIQERI
FT                   DFEKYDKEHGIRGDMVAKLEREFLHLGLTFAIGGQISFDIFPKGWDKTYSLRHIEGEGF
FT                   EEIHFFGDKTYKGGNDYEIFSDPRTIGHTVTSPEHTMQLLDELFLTTAP"
FT   gene            1136144..1137985
FT                   /locus_tag="CNH00160"
FT   mRNA            join(1136144..1136311,1136374..1136910,1136998..1137293,
FT                   1137486..1137985)
FT                   /locus_tag="CNH00160"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1136169..1136311,1136374..1136910,1136998..1137293,
FT                   1137486..1137667)
FT                   /codon_start=1
FT                   /locus_tag="CNH00160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00160"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44904"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC88"
FT                   /protein_id="AAW44904.1"
FT                   /translation="MHYTIAFSDNENNIDNDNDNDNGRTTPESELNELSDGEYERERLE
FT                   NIKHRDALLSSLGLDVPKKPHHLYPQQQQQQPQMEGSAGQLAEKTRMSREDAKKRKVAK
FT                   EREKELRRVEPVRKSRRVAERAGKDKDGKGTGDDDDQNPLSSSRKPSNSINRYMDPLPK
FT                   ATRPTLPPGPEYSSGQIENEKQPRPLKGDGGRLVFEGRWRGVFTPNVTPEEMFGGGAFG
FT                   GSFFRDTYSGLLRTPLSSDAALASLPFPPPFPGSDINTIAPNLLTSRIPKPSVNRFQVL
FT                   AGQSLEEWEKAGWIWPGDPRGWAEWYVRFWDGRRCEDDERQVRRWLNVAGPTGRFKRAL
FT                   LKKIQKAGGQVAVGDEDVGRVLRQCLWQWGYELTEREYEEAMGGP"
FT   gene            1139882..1145660
FT                   /locus_tag="CNH00150"
FT   mRNA            join(1139882..1140227,1140592..1140818,1140967..1141446,
FT                   1141496..1144544,1144600..1144853,1144901..1144960,
FT                   1145009..1145660)
FT                   /locus_tag="CNH00150"
FT                   /product="hypothetical protein"
FT   mRNA            join(1140410..1140818,1140967..1141446,1141496..1144544,
FT                   1144600..1144853,1144901..1144960,1145009..1145660)
FT                   /locus_tag="CNH00150"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(1141078..1141446,1141496..1144544,1144600..1144853,
FT                   1144901..1144960,1145009..1145467)
FT                   /codon_start=1
FT                   /locus_tag="CNH00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00150"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44902"
FT                   /db_xref="GOA:Q5KC87"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC87"
FT                   /protein_id="AAW44902.2"
FT                   /translation="MARPIRPAPGPTTPSAGPSTSLRTSARTHRQSASTSVTSTSTSAL
FT                   TPGPSTPASDGTGARNVSARRAPAVEAKTHGLRSTGSSVERTPCPFPAQFGGRANCGIA
FT                   EEDEADEVLMGILSAIAFYDNRALSVEEIALTCFQQGWLRPPSAAIEPTTPINNAIRSY
FT                   IKRCEKAKRHCLLAKYQLAGSVVESVLEVALHPDAFNGSTRPRGAVWFLLSGSGAGSGK
FT                   AKWKSPFEGLEIPKMPPRKPAPKKQKENKRVDEKKQAVREKSKDKALAPVKIRLVLAGG
FT                   NGEEESQSEKSRSRSVSVSKDSIISEVKVEPVSKHEGTAPRRYDSSSDSDTSDSDIEID
FT                   SSSRLQSSRPMRKGPPPPLVMNGSPRVFGSSRLSQQPPFVDLFFPSPAINTFAPPHTSP
FT                   FPSHSLDNTTWTARYDHNQRHLDYSSSSEEDEVVDLEWGVASDVIIRDSVEDETKAAWS
FT                   LEDEAKVKEATDALRVLFPLEEPEEDIGLGKGFELIQSESRPTGTDSPSISEPGSIATS
FT                   ATARNSFRNKLKAIDAGGLPLNDWVVNSSPIPSPNVRPFKAFHQAPPVDFSPTQHFSKL
FT                   RGSFDPDENMDVDDEPWLDETGELPVKAEDTFSDVDLNSTIDEIASPEHDRRLHTALWA
FT                   QEAAATIRVKAEPEDFPTPSSIEDEPMQSSRASSTPSYGPSDGPDYDDIGMESVADEKI
FT                   LGPESVSVEELDGWLPTVKTERTPHRGRPRKGGKDKSDGQKLGCWGGIGVCSSGKRATR
FT                   SHTATSTATRRRKSKSCFERLTPVSDSGSGLATAAGGEDENEVDDAIGTEDLEKARVEA
FT                   DAREEEHRKACKEKAERHRVMLEAYRQTVRAELSDTDITPSPWEAPSSATPWGSSSTDS
FT                   LQLPTPGALSPMVLHSVSNSSLATPGEGQHMMSVDPKALVSPPLQSVFGQGISGKRDLG
FT                   MGLGVGMLDAALTQQEVDDIMGTSSASTTAPYSTSATTPATPSTSTASALAPALQRPAT
FT                   SSPISGSAPSSSVLALQPTPVPVISASAPNEKGIAIVALPTTLSDSAQASSTLVTASTA
FT                   SGQPVHVPKPIAKNTKPIPSSATPSRSSTPSTASSGSGSSRSGGKIATITKPLCPGVDA
FT                   CVVDNIPVYAHLFEGRNGSGKQVLLRRLDTDFVNANALLHALGVSPSKHSEYLDHPISQ
FT                   ARLAARHIVQSSTSGMEYSNGVSGIWVHLSEAREFARRAKLAGGSLLASVLREDLFQLF
FT                   ATLAQIKPDHPPSESFGLPFVPRRQTPPTSTMSTNSKSTPNLPSLSTTASAPAANHIRS
FT                   APSGLSAPINGLKGPLVRTAPATPPDGCPQSKRRRATISSPLTKKSGVAMGSVALAPAP
FT                   ASAEVGEGAKTGVAVGAGPGAGVPKPTHTTVTAAQKRATRASFGGLPVKPASG"
FT   CDS_pept        join(1141078..1141446,1141496..1144544,1144600..1144853,
FT                   1144901..1144960,1145009..1145467)
FT                   /codon_start=1
FT                   /locus_tag="CNH00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:Q5KC87"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR036887"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC87"
FT                   /protein_id="ALO69554.1"
FT                   /translation="MARPIRPAPGPTTPSAGPSTSLRTSARTHRQSASTSVTSTSTSAL
FT                   TPGPSTPASDGTGARNVSARRAPAVEAKTHGLRSTGSSVERTPCPFPAQFGGRANCGIA
FT                   EEDEADEVLMGILSAIAFYDNRALSVEEIALTCFQQGWLRPPSAAIEPTTPINNAIRSY
FT                   IKRCEKAKRHCLLAKYQLAGSVVESVLEVALHPDAFNGSTRPRGAVWFLLSGSGAGSGK
FT                   AKWKSPFEGLEIPKMPPRKPAPKKQKENKRVDEKKQAVREKSKDKALAPVKIRLVLAGG
FT                   NGEEESQSEKSRSRSVSVSKDSIISEVKVEPVSKHEGTAPRRYDSSSDSDTSDSDIEID
FT                   SSSRLQSSRPMRKGPPPPLVMNGSPRVFGSSRLSQQPPFVDLFFPSPAINTFAPPHTSP
FT                   FPSHSLDNTTWTARYDHNQRHLDYSSSSEEDEVVDLEWGVASDVIIRDSVEDETKAAWS
FT                   LEDEAKVKEATDALRVLFPLEEPEEDIGLGKGFELIQSESRPTGTDSPSISEPGSIATS
FT                   ATARNSFRNKLKAIDAGGLPLNDWVVNSSPIPSPNVRPFKAFHQAPPVDFSPTQHFSKL
FT                   RGSFDPDENMDVDDEPWLDETGELPVKAEDTFSDVDLNSTIDEIASPEHDRRLHTALWA
FT                   QEAAATIRVKAEPEDFPTPSSIEDEPMQSSRASSTPSYGPSDGPDYDDIGMESVADEKI
FT                   LGPESVSVEELDGWLPTVKTERTPHRGRPRKGGKDKSDGQKLGCWGGIGVCSSGKRATR
FT                   SHTATSTATRRRKSKSCFERLTPVSDSGSGLATAAGGEDENEVDDAIGTEDLEKARVEA
FT                   DAREEEHRKACKEKAERHRVMLEAYRQTVRAELSDTDITPSPWEAPSSATPWGSSSTDS
FT                   LQLPTPGALSPMVLHSVSNSSLATPGEGQHMMSVDPKALVSPPLQSVFGQGISGKRDLG
FT                   MGLGVGMLDAALTQQEVDDIMGTSSASTTAPYSTSATTPATPSTSTASALAPALQRPAT
FT                   SSPISGSAPSSSVLALQPTPVPVISASAPNEKGIAIVALPTTLSDSAQASSTLVTASTA
FT                   SGQPVHVPKPIAKNTKPIPSSATPSRSSTPSTASSGSGSSRSGGKIATITKPLCPGVDA
FT                   CVVDNIPVYAHLFEGRNGSGKQVLLRRLDTDFVNANALLHALGVSPSKHSEYLDHPISQ
FT                   ARLAARHIVQSSTSGMEYSNGVSGIWVHLSEAREFARRAKLAGGSLLASVLREDLFQLF
FT                   ATLAQIKPDHPPSESFGLPFVPRRQTPPTSTMSTNSKSTPNLPSLSTTASAPAANHIRS
FT                   APSGLSAPINGLKGPLVRTAPATPPDGCPQSKRRRATISSPLTKKSGVAMGSVALAPAP
FT                   ASAEVGEGAKTGVAVGAGPGAGVPKPTHTTVTAAQKRATRASFGGLPVKPASG"
FT   gene            1146000..1147904
FT                   /locus_tag="CNH00140"
FT   mRNA            join(1146000..1146103,1146166..1146236,1146295..1146689,
FT                   1146897..1147904)
FT                   /locus_tag="CNH00140"
FT                   /product="Rho small monomeric GTPase, putative"
FT   CDS_pept        join(1146057..1146103,1146166..1146236,1146295..1146689,
FT                   1146897..1146965)
FT                   /codon_start=1
FT                   /locus_tag="CNH00140"
FT                   /product="Rho small monomeric GTPase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00140"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44901"
FT                   /db_xref="GOA:Q5KC86"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037874"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC86"
FT                   /protein_id="AAW44901.1"
FT                   /translation="MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVSVT
FT                   IGDDPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEIAHH
FT                   CPGVPALIVGTQVDLRDDPAQTEKLGRQRMKPITQDMGERLARELGAVKYVECSALTQR
FT                   GLKNVFDEAIVAALEPPMATKKKSKKCLIL"
FT   gene            complement(1148351..1150006)
FT                   /locus_tag="CNH00130"
FT   mRNA            complement(join(1148351..1148880,1148986..1149177,
FT                   1149250..1149627,1149699..1150006))
FT                   /locus_tag="CNH00130"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1148716..1148880,1148986..1149177,
FT                   1149250..1149627,1149699..1149974))
FT                   /codon_start=1
FT                   /locus_tag="CNH00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00130"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44900"
FT                   /db_xref="GOA:Q5KC85"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC85"
FT                   /protein_id="AAW44900.1"
FT                   /translation="MTYLTAHLPFPSGSSLPPPASHLVISDTLNSPAQFALYHLVNAAL
FT                   LKQKSQPPSLTQARQINGRGTEYVTKVVWVDFRSEGRSSWEVILKKLGTPLPSPTSPAF
FT                   IHITPSSLPACISSSSTNANSPRIFPSLSLGTGDATSDRDGRPTLKHVYDTLLPHLQTQ
FT                   AQLRSQPPSNPEQGEGGSELECLLILDGLSDLLSIGVPLREIHRFVRAVYAQIRISKAA
FT                   LVSTLHTDSLSFLTQPSLSLPLSESETETNLLERLLKIGHGVWWRVENLQSGRSGDVMG
FT                   EISSHPFGTHHSHPNSNFRAETEKDTYIPRSKPLQYRLEPSTVRVFAKGTGRGFL"
FT   gene            1150206..1151874
FT                   /locus_tag="CNH00120"
FT   mRNA            join(1150206..1150351,1150408..1150472,1150552..1150732,
FT                   1150821..1150999,1151085..1151234,1151338..1151874)
FT                   /locus_tag="CNH00120"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        join(1150293..1150351,1150408..1150472,1150552..1150732,
FT                   1150821..1150999,1151085..1151234,1151338..1151378)
FT                   /codon_start=1
FT                   /locus_tag="CNH00120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00120"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44899"
FT                   /db_xref="GOA:Q5KC84"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC84"
FT                   /protein_id="AAW44899.1"
FT                   /translation="MSLRIATTTARAIPARAVATRSIMTLRRVAVPQASPKGYRQSSIL
FT                   QDTAKTAHSAFANLASAAPIKKGDKMPDVEIKIDGPEGKVNLGKEKGKNVVVLVPGAFS
FT                   GVCSNQVPPYITSFSDFKAKGINNVYVVAVNDIFVVNAWKDKMIGEFSSKEGEGVKFAA
FT                   DDTAALASALGLTFDAQPVFGGPRLKRGVLVVNDGVVEYVGVEDSPGDITISAADKVIK
FT                   QL"
FT   gene            complement(1151780..1153983)
FT                   /locus_tag="CNH00110"
FT   mRNA            complement(join(1151780..1152053,1152111..1152349,
FT                   1152410..1153270,1153346..1153557,1153607..1153690,
FT                   1153746..1153983))
FT                   /locus_tag="CNH00110"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1152001..1152053,1152111..1152349,
FT                   1152410..1153270,1153346..1153557,1153607..1153690,
FT                   1153746..1153910))
FT                   /codon_start=1
FT                   /locus_tag="CNH00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00110"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44898"
FT                   /db_xref="GOA:Q5KC83"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC83"
FT                   /protein_id="AAW44898.1"
FT                   /translation="MSALMDEKYSIEHTENGEVLNKDDGHHHLTQQEMKHGDNALKYIG
FT                   EERIEVTVEDDKRIRKLTDKYILSLLTWVYFLQILDKTILGYANTFGMSTDTHLVNNQY
FT                   SLLGSVNAIVQLAWQPFSSYLIVKVPARYLMPAMVFGWGAAQACMAAAHNFGGLMVSRA
FT                   LLGLFEAGCLPLFSLLTSQWYRRSEQPVRVAVWYSTNGLATVVAALLSFGLSHVSSPHI
FT                   KVWQLIFIICGGITCLTAPVIYFFIDADVPSARFLSEEDKAKGIERLRANQTGTGTNEF
FT                   KLSHVWELFYDVKSYLFLALALLLNVGASVTTIFGPTLIKGFGFNSRITSLLNMPFGFL
FT                   QFLAILAGCFAAYKFKIKSAVLASFVIPVIVGLVLLYVENSAAVLKQAPALVGYYLLAF
FT                   LYGANPIIVSWIVANTGGQTKKALLMSVYNAGSAAGNIIGPLLFQDKDKPHYLPGIKAT
FT                   LGIFCALIACIGFTAAFLFFLNKQRQRQRVAVGKPQFIKDTSMSTKYEAYGGDDVEGRL
FT                   GQNALLDLTDFKNDEFVYVY"
FT   gene            1157185..1161618
FT                   /locus_tag="CNH00100"
FT   mRNA            join(1157185..1158844,1158989..1159065,1159209..1159261,
FT                   1159485..1159650,1159840..1159854,1160128..1160279,
FT                   1160437..1160539,1160883..1160995,1161185..1161618)
FT                   /locus_tag="CNH00100"
FT                   /product="endoplasmic reticulum protein, putative"
FT   CDS_pept        join(1157439..1158844,1158989..1159065,1159209..1159261,
FT                   1159485..1159650,1159840..1159854,1160128..1160279,
FT                   1160437..1160539,1160883..1160995,1161185..1161334)
FT                   /codon_start=1
FT                   /locus_tag="CNH00100"
FT                   /product="endoplasmic reticulum protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00100"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44897"
FT                   /db_xref="GOA:Q5KC82"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC82"
FT                   /protein_id="AAW44897.2"
FT                   /translation="MALEHHQDAQEPQDQSPWRRRMSHPLPIPTFRPNIPNIPHLRAAL
FT                   LGYLGELETALRRKLGDDLSEVGGVLHGGGNGSGRGRLPSVSLSSSMSTEDWTTSTESN
FT                   DEDSYHGYSSALAGSSSISEVRQRNIATNADSNGSPSANTNAKDDTTTDPSSTKDSYIN
FT                   LLNHLSALREEASNYLPSLSVHMPLSIPNRQWLRSLPSRLSIVDPGLLSPLDKAKIKDE
FT                   LAAVIDFESGAVEGARKRVVDMVHAMLPSEDWAGWERLGWEEQEYGDGWRPGEYGHRRT
FT                   RSASLGRSGKGKHNQDNDSDYPMMEDEEPEYLFPNRTPASTRALARRRAVRSKSVGAAS
FT                   LPLVKRARMERSQSYAFGSLVSFSPGKTVSEPVEMGSAGGSDREDGDEARDEDGDEVDE
FT                   VMNEEGKDEGEFISISYLTVDLKSSLIAVETTTDPSVADGLRSSEDGGKLITYNELPAI
FT                   WRNNEHIRTGYRFIPLHLKTGPVPLIKSAFAIHNETVNIHSHLIPTLFIFACIPFIIYN
FT                   TPLPDAHPLDTAVVIAYLVAAISCLSSSAGWHVLSGCASRKWFEWGACVDYIGISWLIA
FT                   ASFGTVVYNGFYCQPKLTLFYCTTNMLCGALGSYLPFQRWFNERRNKHLRISFFLFLCF
FT                   AMFAPMVHMFGQYGWHKASAFVAPFMVSIVAYVVGLLFYAFHFPECKWPGKFDIWGSSH
FT                   QLWHLGIVVAIVLHYRAIFVAHGVKHEYSCAAPGQDISVAMVLERMIGWR"
FT   gene            complement(1161978..1165958)
FT                   /locus_tag="CNH00090"
FT   mRNA            complement(join(1161978..1165286,1165337..1165567,
FT                   1165615..1165833,1165873..1165958))
FT                   /locus_tag="CNH00090"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1162161..1165286,1165337..1165567,
FT                   1165615..1165632))
FT                   /codon_start=1
FT                   /locus_tag="CNH00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00090"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44896"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC81"
FT                   /protein_id="AAW44896.2"
FT                   /translation="MSIQVPTGLLSIRRTKLVDVSYTLRVTLNNSIYVDLPVTLISFLS
FT                   IDPPPMPGGATRGVPMAEWAAVRGTPVPAPHEEEGKSRHTQETPIPAARASSTTLHPDP
FT                   SQPLVQPPPPLPAFESHSQCESATSTYTSPSNAASATSLPNLFTIPAYSRAQAHAQAQS
FT                   SSPHLSAFSGFSPRPETYAYPEDDPQLDIDDENQDTISRAQNRAKGRQRSLMIIRAEME
FT                   RDDEERKMSFAQGWDADARGGAQTQEGTMEGTYETDVDVERTPMPEPSAYLPRMDTAPE
FT                   RDMPDVERGIEELLEMEEEGWDFDSVDAHPPSHQPYQPYTDQNTEMDQNVDPEHPHQHQ
FT                   QDYGQGQELELLDEERREIERVIPHPSHELKADDEQDEPDEPDRDDESHAWGYEDELAL
FT                   HSEDEGDKGDTPTATPRRTTHSRSRALSSVAPASPVVSAPPAPPALAPEIIMETKAESE
FT                   IQEKTEVDEEREDRHVETHLDPVKRRISVRLPPQLLPTFSSSTSIPSPSPDSISSAAPA
FT                   AQRSPTKSPTKTIIRSGSVPSLCAKVSREALNERLEGVVKKSGIVSSSSMSATTTAPTT
FT                   ATTGRRVSVLSKKESTSSLASVAEVNSGGGGAKVVQKKNSFSFATPGSPLKVKIPLSPA
FT                   PNTQSPIPSPRKTSRKPSPTKPNSNPTPKPQSNRNRNPSPTKSPLVSSRPMERAPSDTS
FT                   AKSQTTNGASPHNSQPPPLASPRASDSASSSEGKWLESPRGEEEAQQLHFLAPASGGGG
FT                   YQSFSPLISPTSPQDGLEWGLMQQQQQRQGQDQDQEQGLGSPFTFHSLRPPTDSVMSRL
FT                   SLPRPRSPFSSVSGHHHHYHHDPMAKHDTLPIPFDEISIHASPSSTPSSPSSCHSMLPS
FT                   VKTKIAQMESREEALRKFSVSGSAMLSPPLRLSKTDSERQTVERMEEIREKEGESGWRN
FT                   DRGEERKPPVKRKSYTAALAPRANRTGSKAPLSAPRPFIPRQTSTSTIHSTQSISSGSS
FT                   SNSNYDYDPIYAPESNTSTPKVPKRLPASPSATTPTASPRNSLVHNGRLPISPASTKST
FT                   TTSYGDLMSTPKLDPFGLGYTSGGMNGVGPGMGMAPIGGGLHKVDEEVGHEGLSRESSY
FT                   EVGGYDSGRCEARVRME"
FT   gene            complement(1166406..1167904)
FT                   /locus_tag="CNH00085"
FT   mRNA            complement(join(1166406..1167048,1167100..1167904))
FT                   /locus_tag="CNH00085"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1166406..1167048,1167100..1167854))
FT                   /codon_start=1
FT                   /locus_tag="CNH00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M5Z6"
FT                   /protein_id="ALO69555.1"
FT                   /translation="MPLSPNPSQGLGITLPNCAHPPSPLRISTTSSPPLEPGGQTRAHA
FT                   DGQGSPIKVAATATAASSGGIAGTRLRVKTNDSFALRPTHSHSPTASISSIPSSPLTYS
FT                   TGTVKSLRTSKPLGPRSSPREGGTHGLRVEVEEMYRDEAHGEENGGDKDDDRQRLVPSP
FT                   TADTDADAHAAPSRAPSSASVISTSFSASTHHTSSSKVGRVKSSEVLRRRGAAKEGGKY
FT                   MQLEGGDGEREDEEIVRSPLSGKDGYREQRLPSYHHQHPSVHAPAPVFAPPAAYAFPYP
FT                   PRRTGQPETFQATDLPRSASQPMHLYSVPAFFDPTYTTARPAGDDSQDDELRSRPWSES
FT                   TLDGVRVGTAKRRGRSLSDGAELLARQGTLLDPSCGTPRSSAELGILLGGARSRRLSRD
FT                   RLAAAGAGGGVRLEASKKGRARVEVDVVVERECVVEGGDVRGRVEVRVRGGRRAPRGRR
FT                   QGARGGV"
FT   gene            complement(1167905..1170157)
FT                   /locus_tag="CNH00080"
FT   mRNA            complement(join(1167905..1169190,1169263..1169841,
FT                   1169914..1170157))
FT                   /locus_tag="CNH00080"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1169026..1169190,1169263..1169841,
FT                   1169914..1170018))
FT                   /codon_start=1
FT                   /locus_tag="CNH00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00080"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44895"
FT                   /db_xref="GOA:Q5KC80"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC80"
FT                   /protein_id="AAW44895.2"
FT                   /translation="MASVLLGEPNSLPSDSAPEKRRKIPKVAFYVAGSAFALTIGMTAM
FT                   VIPFVRQAAKTMNGPQFMSHRNLEHLASRRFPSPSLSPFASSSIPPRQVRDSSPPVPPP
FT                   SALKSAIPAYSSASISAEIPISEEDIKHLGEGSKSTLDPVVQAEESAETIKSRLFNARE
FT                   EKALYGSSLMPLSSNTASEGEGEGGGDKMEGALLGAKALMFATTLVVGFTGLGMWAVGK
FT                   AMGAEDPADFAVKMRQQLVLSMPQLVTSVNRPGRSTDGFDSEAIEKWVNELEREEVARP
FT                   S"
FT   gene            complement(1170350..1172721)
FT                   /locus_tag="CNH00075"
FT   mRNA            complement(join(1170350..1170874,1171018..1172524,
FT                   1172587..1172721))
FT                   /locus_tag="CNH00075"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1170721..1170874,1171018..1172524,
FT                   1172587..1172671))
FT                   /codon_start=1
FT                   /locus_tag="CNH00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0S2M604"
FT                   /protein_id="ALO69556.1"
FT                   /translation="MASTSTAQKLSYEWPESILTFEGLFNTYSSSRHPFSIFNISLFRW
FT                   RPSLPSSAMLEPLLTMASNTLHPEQQPTIKALIGLQTYTTQLRDAVRVRQLDMGDKEVQ
FT                   GRLDELVKGYAAAGNVIARILWESDGDKGRIRSHDLHIALKQSIGSFFAVRSLLETSLA
FT                   TRHDTHILGSILPSIPPYHQSFLSPILEHCRHIITSLETNPFRPLAHSKLPNAAHQLSR
FT                   DLTDTEVTCLLEYLQTINEGLSNIGEIDSLNSTSLVGKVAKAKEKHMKQENEHRPLRVR
FT                   MEVMLLRCDLLLSMTNKRMSEVKARAARRMSGEESQGAAEEKVESEARNRSKSREKSRS
FT                   KSIDNMRDMSDTSTNIVPFCAVTSTFSSSDTPSSFIEWEVLTEESLIDCFDFAASFTEN
FT                   DSIAVLTKSINLSDWLGATSPQLKTGTKSKTQSHPCPLSTNMSDDEDFDLDSSTSFISE
FT                   DDNDEAEGSYYRCPLRTLFALHDRYEEQRLAIWLTLPTSKRGKMTAFMRGGKDGEIGRA
FT                   WDGLGMNVMSVVCGSSLISYYGLAPDKLSKWTDLIAVRQAKRSRKKGKEDGLISQVRPL
FT                   NQNDI"
FT   gene            1173871..1176597
FT                   /locus_tag="CNH00070"
FT   mRNA            join(1173871..1174115,1174168..1174348,1174400..1174491,
FT                   1174567..1174597,1174650..1174842,1174896..1174965,
FT                   1175025..1175365,1175417..1175621,1175685..1175801,
FT                   1175854..1175936,1176000..1176115,1176181..1176597)
FT                   /locus_tag="CNH00070"
FT                   /product="monosaccharide transporter, putative"
FT   CDS_pept        join(1173983..1174115,1174168..1174348,1174400..1174491,
FT                   1174567..1174597,1174650..1174842,1174896..1174965,
FT                   1175025..1175365,1175417..1175621,1175685..1175801,
FT                   1175854..1175936,1176000..1176115,1176181..1176391)
FT                   /codon_start=1
FT                   /locus_tag="CNH00070"
FT                   /product="monosaccharide transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00070"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44894"
FT                   /db_xref="GOA:Q5KC79"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC79"
FT                   /protein_id="AAW44894.1"
FT                   /translation="MSKITVAPSREEVPSLSALGIKAHPDALTLAYDDNALAGSYGGNG
FT                   LKDLFASRMVLLAASAACIGGLLFGFDQGILSICLTMPQFQDQFPETNAEVNPQASLNK
FT                   GIMTALLELGAFLGAFMSGYVSDRYSRKGSLAFGMVWFIIGSVLQSASYSFAQLVVGRF
FT                   IGGIGIGVLSSTAPTYISEIAPPNIRGALLVLEQFSIVLGIVVMYYITYGSRYLSGGGS
FT                   FRLPFALQMFPCIILGGFLYQLPYSPRWLALRGRDQECLASLCRLRQLPDTDPRVQAEW
FT                   ITIRAEAIRNREVLVKAHPTMTDKSTKSEFKLELASWVDMFRVGSIRQTMIGILLMFFQ
FT                   QFVGINALVYYAPTLFEQLGLDYELQLTLAGALNIAQLVAVVAAFFLLDKFGRKVFLIV
FT                   GAIGLTVSHSVVAAMIGTYGDNWPAHKGPAWVGVGFIFGVMIFYGIGWGPVPWAMPAEI
FT                   HASSRRAKGVAITTCSNWLNNFIIGLITPPLISGTKGYGAFIFFAIWSLLACLWSVFFV
FT                   PETKGRTLEQMDAVFKSRTAIEDAQARDDILQIVCKEALNSINNPRQVPKMEIEMLENV
FT                   DEKKSGTPSTISQV"
FT   gene            complement(1176618..1178846)
FT                   /locus_tag="CNH00060"
FT   mRNA            complement(join(1176618..1177208,1177261..1178218,
FT                   1178270..1178378,1178441..1178846))
FT                   /locus_tag="CNH00060"
FT                   /product="hypothetical protein"
FT   mRNA            complement(join(1176618..1177208,1177261..1178218,
FT                   1178270..1178835))
FT                   /locus_tag="CNH00060"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1176904..1177208,1177261..1178218,
FT                   1178270..1178752))
FT                   /codon_start=1
FT                   /locus_tag="CNH00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44892"
FT                   /db_xref="GOA:Q5KC78"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC78"
FT                   /protein_id="AAW44892.1"
FT                   /translation="MASPKASEAISDSSLSPASYQALPELPKSPRDDPIAYGGHPKNRD
FT                   RPYPLSLIPFDLNEPYEVSEYLTIRSYDEACQVDYLNQDWADEYRDGGIVDEQMFDDGH
FT                   VRRYLDRFIQENPKLIATTFRHKANLKTVFYSGKDEEWAKLDLVDVYRRQTGKVLGVPS
FT                   QSQYTSNSKNGGAITPDASLIGNVNDPSSPSFRKRMLYAVIEVKWMELATLLTGEAKRQ
FT                   SDEKALNYLRQEGVFQTMWYVILGYAISGCIFGLSIINEYFYRIVYLYQHSDSDIPVIA
FT                   LEADSEFLGKTGRHFGYLRDSYSIEELAGLQDFWSSPPNCLISDRANAILNKEARYHLD
FT                   ATIFLFLNRAASLSKQCFLNGLPLPHIRRSLHPTKANKRTLADLDDEGKKEGVEDIPGD
FT                   EKLSRKVNRRNGPESDGLCGRGSGHDRVHEGNGASAHRTEAAHARRPMKPQEFLRGLEE
FT                   LSTVVDVSDVKSSIIASLISNSHTTPSMNPSSISSDCDSFSYTSFGSREKLPVSDHLPA
FT                   ALHPRSHECDPVDTDFDAIDSETGELTLEAYRSRLAMLGVRVKLVTREEMDVLLARGGK
FT                   ENSDC"
FT   CDS_pept        complement(join(1176904..1177208,1177261..1178218,
FT                   1178270..1178378,1178441..1178571))
FT                   /codon_start=1
FT                   /locus_tag="CNH00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00060"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44893"
FT                   /db_xref="GOA:Q5KC77"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC77"
FT                   /protein_id="AAW44893.1"
FT                   /translation="MRSPNTLLSAPTMRHAKLTISIKIGPMSTETGESLMSKCSTTDIH
FT                   KANLKTVFYSGKDEEWAKLDLVDVYRRQTGKVLGVPSQSQYTSNSKNGGAITPDASLIG
FT                   NVNDPSSPSFRKRMLYAVIEVKWMELATLLTGEAKRQSDEKALNYLRQEGVFQTMWYVI
FT                   LGYAISGCIFGLSIINEYFYRIVYLYQHSDSDIPVIALEADSEFLGKTGRHFGYLRDSY
FT                   SIEELAGLQDFWSSPPNCLISDRANAILNKEARYHLDATIFLFLNRAASLSKQCFLNGL
FT                   PLPHIRRSLHPTKANKRTLADLDDEGKKEGVEDIPGDEKLSRKVNRRNGPESDGLCGRG
FT                   SGHDRVHEGNGASAHRTEAAHARRPMKPQEFLRGLEELSTVVDVSDVKSSIIASLISNS
FT                   HTTPSMNPSSISSDCDSFSYTSFGSREKLPVSDHLPAALHPRSHECDPVDTDFDAIDSE
FT                   TGELTLEAYRSRLAMLGVRVKLVTREEMDVLLARGGKENSDC"
FT   gene            1179074..1180480
FT                   /pseudo
FT                   /locus_tag="CNH00050"
FT   gene            complement(1180537..1181962)
FT                   /locus_tag="CNH00040"
FT   mRNA            complement(join(1180537..1180883,1180944..1181261,
FT                   1181346..1181550,1181641..1181709,1181769..1181962))
FT                   /locus_tag="CNH00040"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1181152..1181261,1181346..1181550,
FT                   1181641..1181709,1181769..1181897))
FT                   /codon_start=1
FT                   /locus_tag="CNH00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00040"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44891"
FT                   /db_xref="GOA:Q5KC76"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC76"
FT                   /protein_id="AAW44891.2"
FT                   /translation="MSEPPEYQKLLNKDTESFDVDVEDQAPTYPPGPSDFVSRVIFVYA
FT                   PPRFGFDDPKEYVGLVGKTKEKTIQNICRYIPELAEYPADHISFRLSSTASAHPRNWPV
FT                   VTEDIWFTFVSDPPEKLGVIVEPTQKDKDANRARQVKISIIIVCCFIGFWGLVAAIVAM
FT                   GDHFFPS"
FT   gene            complement(1185477..1188566)
FT                   /locus_tag="CNH00030"
FT   mRNA            complement(join(1185477..1185762,1185821..1185873,
FT                   1185933..1186102,1186154..1186278,1186343..1186498,
FT                   1186557..1186664,1186727..1186799,1186850..1186923,
FT                   1186973..1187094,1187148..1187224,1187278..1187344,
FT                   1187394..1187561,1187617..1188342,1188430..1188566))
FT                   /locus_tag="CNH00030"
FT                   /product="Alpha-L-arabinofuranosidase, putative"
FT   CDS_pept        complement(join(1185634..1185762,1185821..1185873,
FT                   1185933..1186102,1186154..1186278,1186343..1186498,
FT                   1186557..1186664,1186727..1186799,1186850..1186923,
FT                   1186973..1187094,1187148..1187224,1187278..1187344,
FT                   1187394..1187561,1187617..1187992))
FT                   /codon_start=1
FT                   /locus_tag="CNH00030"
FT                   /product="Alpha-L-arabinofuranosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00030"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44890"
FT                   /db_xref="GOA:Q5KC75"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC75"
FT                   /protein_id="AAW44890.2"
FT                   /translation="MAVYSQHVTVNQSLLQQQAPRDFPNTPSHPKTLASTPILLDVTRL
FT                   LYPSGPPVTDKLFSGFLEHLGRCIYGGIVDDPKDPSPKWLLEVQDEGKTFQKDRLGWRK
FT                   DVMGCLAKDGELEIPMLRWPGGNFVSNYHWQDGIGPISERPKRVELAWLSDESNRFGTD
FT                   EFIDYCRATGAEPYICLNMGTGSLEEALAWVEYCNGTGDTHWANLRRKNTGRDEPHAVK
FT                   YWGLGNEMWGPWQVGNLLPSEYVRKARQWAHALKLVDPSIVLVSCGETGASDWDREVIQ
FT                   GLLPWADMHSIHFYTMLGHDKMSSVSGYDYEKNVFGPAAAEKHIDICKSLIDLANIGRT
FT                   WERMPAKDMKICFDEWNVWDDVKAPGSNGLEQWYDYTDMLGFCAWLNVLVRKHKDIGIA
FT                   CLAQSVNVISPLMTKPDGIVRQTLYYPLQLFSKYMKNGHLLQLPVFPDVYTGPTFPVYI
FT                   QQGNYKPSYVDSVAILVETEKGASIRVSILNRHPEVDWSSKIGFSGFEVESVEVHEIYS
FT                   DDLAAANTFENPDTIIPKITKKNAKEWDGDVLVKKHSWSFIIFNGRFH"
FT   gene            1188744..1191355
FT                   /locus_tag="CNH00020"
FT   mRNA            join(1188744..1189065,1189114..1189307,1189363..1189491,
FT                   1189543..1189560,1189613..1189746,1189798..1189865,
FT                   1189926..1190082,1190139..1190245,1190297..1190473,
FT                   1190526..1190648,1190701..1190819,1190881..1191078,
FT                   1191140..1191355)
FT                   /locus_tag="CNH00020"
FT                   /product="glucose transporter, putative"
FT   CDS_pept        join(1189019..1189065,1189114..1189307,1189363..1189491,
FT                   1189543..1189560,1189613..1189746,1189798..1189865,
FT                   1189926..1190082,1190139..1190245,1190297..1190473,
FT                   1190526..1190648,1190701..1190819,1190881..1191078,
FT                   1191140..1191246)
FT                   /codon_start=1
FT                   /locus_tag="CNH00020"
FT                   /product="glucose transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00020"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44889"
FT                   /db_xref="GOA:Q5KC74"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC74"
FT                   /protein_id="AAW44889.2"
FT                   /translation="MLPPKIYTFLCGCFAAMGAMLYGYDLGVISYVLVAPDFLKTMDTT
FT                   DENYIGFITSSMLLGAFVGSIPASLIADAFSRRMAITVAGVVFIIGGILQTAAPNKEAM
FT                   FAGRFFAGIGIGMLGLLTPLYQSEIAHPSARGMLTATFQFFLGIGSFIAGWIAYGVAQT
FT                   HFESPMAWRLPLGFQMLPAVPLIFLTFLLPESPRWLIIKGHDEKALRSLARLHAKGDES
FT                   DPFVLGEFAAIKNKVDAEAVMQQSWRLIFNFEDRTNMRKVLYGIILQFSVQMTGVSAIQ
FT                   YYAPTVYASVGFSTNTSLLINSINSVNALIAQFCCILFVDKIGRRFPLIFGNILSGTCF
FT                   AVATALAKQFADGRGSRGQGIGFVVVLYVYNFFFSACIGPLSWIYPVEIMNTAIRAKAT
FT                   AMVNMAAWISNFMIGQVSPKAFANIGWRYYLVFCICSFTNAITFYLFFPETRGRTLEEM
FT                   DNYFRQMNLIVPLTKDVQKISAHEREAQLVEQGVIQQEVGMQQEVDEKDEKNEKKDEKK
FT                   EIEHQEVV"
FT   gene            complement(1192567..1193839)
FT                   /locus_tag="CNH00010"
FT   mRNA            complement(join(1192567..1192607,1192728..1193193,
FT                   1193289..1193431,1193498..1193509,1193560..1193839))
FT                   /locus_tag="CNH00010"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(1192567..1192607,1192728..1193193,
FT                   1193289..1193431,1193498..1193509,1193560..1193839))
FT                   /codon_start=1
FT                   /locus_tag="CNH00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CNH00010"
FT                   /db_xref="EnsemblGenomes-Tr:AAW44888"
FT                   /db_xref="GOA:Q5KC73"
FT                   /db_xref="UniProtKB/TrEMBL:Q5KC73"
FT                   /protein_id="AAW44888.1"
FT                   /translation="MHMDVEEKKQSYEKLCKTLRYDATREDNYRTDALTVFSQISLGGR
FT                   SGPPYADIDLNSEDMGYLKSHDMSMAFMETDASKVINRLMPSKTRSKNAAEEISEVPSS
FT                   SQPSSTTASIRILDTAIVFSYEHSEAGAEGSEFKSTEEEEERKVYLGQCLMYSDAGYQM
FT                   FRLRRALAVCGTRSARVWALSGRCGCRTFAVETSRPLNNTGPMVAADFFSQVNLDLFPH
FT                   NLIIPSPSTGSFAIDHGKCGLLELTVSRVCDSILWRAYISLAVPVAPNLPGIVNVINTS
FT                   IEIWNIKYVYMVSNIVGNTIKTHLNLCPLVKH"
XX
SQ   Sequence 1194300 BP; 306292 A; 290238 C; 289632 G; 307982 T; 156 other;
     taacccccta accccctaac ccctaacccc ctaaccccct aaccccctaa cccctaacaa        60
     tctgtatccg tgaagatcag tatttgacgt ttatgaacca tttgttgacc gaacttacgg       120
     cagtcgtcag cctggtgata tcatcaacca gctttgtctt gccctcgttc acactcttca       180
     tgctcatagc cgccctttct gctctagcat catttccctt tgcaccttca tcctcgactt       240
     ccagcagccc actgaaggaa gagacgccga taagcagatg agaaacggcg tagcgggaag       300
     gtaaaggtac tcgaagagta agcggacggg cggatggatc ggtggattct tgaagagaag       360
     gttgaacgga agaagcattg aggaagcggg gcgatgtgag gagggaggtg ccatgggagc       420
     gggtaagatg agaggcatgg gtacgggtgc agacgtgaag cagatcttcg acgcttagag       480
     catcgggatc ctgccgttaa gttagtagct gagatgaaat ttacaacgat cacgtaccaa       540
     atgaagcatg ctgttgtcca taacgtcacc agattttaat cctccgccta caccagcttc       600
     atcaacaacc catttgacat ttaattccaa tctcagcacc ctctcgcttg gaacgagtcc       660
     accgcatgct atatcgctca ggaggttatc caattcggaa cgaggagtcg tcttttccgc       720
     cagagtaatg tggatgatgc cgcccaccat tgtctgacga gatgcgggaa gagttgccgg       780
     tgcttgagga cgtttaatgg aagtggagtc ttgacgctgt acttgcatgg gtctttcacg       840
     gctttaaaag gtatcagatt aagagttaaa cctccttgca tatcggcact tacagccagt       900
     atttcaatcg taaagtctta tcctcgcgat ccatttcagg aatgagttgc cctctccact       960
     tgccctgact aagagcaatt gcttgggtga acaacacttc tagccgatat gataatgaca      1020
     agtgttctgt aatgctgtta gttactcttt ccaaaagaag aaaggaacac tcacgaagca      1080
     aattgtatac ccttactaac ggcgcatcaa cagtcttctt gactacttcg accacttcac      1140
     tcttcttcac ctggggatcc tctgttatga ccgtatccac ctccatttca ttctcaggta      1200
     attctctggg aggtaaaact tcgccattcg caatatctaa gatcccttgt ctttcttcgc      1260
     cggtaaattt cttggtgacc ctgcctccag ggtcatccac gcccttctcc tttgccttcc      1320
     agccccactc tactcctgtc aaccaccatc ggctagtatc ctcaaatccg acaactgtaa      1380
     gttccgctct ccatccatcc cctcgggcgt acatccgacc atcttttata tcttcaacaa      1440
     tgagctctgg aggaagatag tcgaggcagc gaaggcggta tctgatttga cgattgagcc      1500
     gacggaggac tttaagaatg gcagaatttg ttaaaactgg tttgggtaag taagggtcga      1560
     caagcgatgc gggaagacga ttgtaggtgc cggtagcgag gagggataag gctgtaagga      1620
     ggtcggggtt cctttcacgc aagccttcta ctactttggt gacatgcttg acatgctcga      1680
     ttgctacttc atgttgctga ttttgatgtt ccataaagtg cgcaattcgt tttgcatctg      1740
     tcactttgcc cttgatgacc gattcatccg cttgagtctt gcttttgcct tttcctgcga      1800
     aggcatctgg agagttgtca ttgggatcat tattggaatg gggcgtagga aaagatgctg      1860
     gacctgctgt gttcgcgacg gatgatccgg tgcttgtaga tgcaatgtcg acagaggtct      1920
     tccatcgaag gacagcgaga tatttgagga gtgcttgtcg ggtggtttta gcatattcta      1980
     ttataggttt tggtcgttca cgaatggaaa gttgaggaag actacatcca atagatcaat      2040
     atacaatggg aaggcaaaga tgggctccac ttacacttcg ccaaggagca ctctgagatc      2100
     atggttccct tttcgagcga accgatccag aactaaccct aatgaaacat tctcattctc      2160
     aaaataaggc ggaagctctt cttctagttg atctggagtg ggcgtggggt atgtaaagta      2220
     tggctctggt cctagttggg ggtttgtgga tgtcaaaggc tgttccgatg ccgaggcaat      2280
     gggagccgaa gccatttttg agagcggacc agcctacgat ggtttgttcc tctcttgata      2340
     ccctataatt caatatgatc catagcgcga gaggatggag ggagctagat ggggccgtag      2400
     tgggaatatg caagacagga ggaatggaaa gagataatag aaacaaaggc caagacaaaa      2460
     tgactacacc gagagtgctt ctggagagtg tatcattagg cacgaagaaa tgtctgctct      2520
     tctcgcacgc ctaatgtacc aaacaaatcc atcgtctgtt tcgttcattc gctgccggtt      2580
     cgatgaattt tcatatatgc agctgccctg ctaccaaaaa tggtaaactg accatgccgg      2640
     gcaagaagca atgtccataa gatgcaacca ttattctaat ctacctactc aagcggcctt      2700
     atctcctctc cgctcatccg ctgcaaatcc agacaaaacc caaacaccgg gccgctccca      2760
     tgccttgtca tatattttta accatcgaat gaagcggcgt cagaacaagg cactggcttg      2820
     aagccatcaa acagcagtgt ccaattgttg cggtcgaaca ttgcaccgtc cctcttcatg      2880
     gcttcatacc tcagcttcag acaaaaaccg tttgccaaaa gtgacaggga taacggtagg      2940
     gtgtgccgcg gcgtccgaaa caccagctga gttacaccaa tagattttga cgctcgttag      3000
     tatgttctgc ccccgcaaaa ctgtatctat cccttggata ctccatgaaa ggcatccctc      3060
     attaacattt tcgctcatct cttcgagggc aagccacccc atggcgtctc cggctcatct      3120
     ggacttcctc tgccggttca tctgctgaat gcggaaattt gaacgatata taaacatttt      3180
     ctgaactctt gattcttgaa accatcaaaa ctcatcatta gctttctcat gcccaaatca      3240
     ccatgacatc tcctctgttc cttggcctcg acgcatccac gcaatccctc aaagcttcgc      3300
     tactctcagt caacctggat gtagtcgccg aatgtgccat ccactttgac tcggacttgc      3360
     ctcaattcgg tacaaaagga ggtgtacatt tcggctcaga tggtcaagtt cattcgccag      3420
     taatgatgct ggtcggagcg atggatttgc tttttgacaa gatcaaaatc gccggctgga      3480
     aagtcgacga tattcgaggc gtcgcagccg ccggacaggt aagtcctttc tttgctaagt      3540
     agtcttttga tcatcgctga taaaaccaca gcaacatgct tccgtttact ggtctaaaac      3600
     ttccccaaag atccttgctt ctctaaattc ctcattgccc ttatcttcac agctcgtcga      3660
     agccttttct cgacctatta tccccaactg gcaagattcc tccaccactg ccgaatgtca      3720
     ggcactcgac gccgccgttg gtggcccagc tgcacttgca cagcttactg gttctcgagc      3780
     atatgaacga ttcactggtg cccaaatcat gcgtttcaag cgggtcgatc ctgtcgcata      3840
     cgatcagact gaccgaattg gccttgtcag taactcagtg accactctgc tctgcttgga      3900
     tggcgaagtc aaggggatcg acgaaagtga tgcttgcggg atgaatctgt ggactatgaa      3960
     cagaaaacag cgagggtgga atcaggaatt gctgaaggca atcgctggtg atgatggggc      4020
     ggcagagctt tccaggaaac tagggacagt ggagacggat ggaggtaggg ttgtggggcg      4080
     tataggcaaa tggtttgttg atcggtacgg gttcagttca gaatgctgtg tgttccctgg      4140
     caccggggac aatccagcta catttttgag cttgacttgt aagtccacac tgtttcgcag      4200
     attgtcacat cgctgaccgc ctaaagtacg cgaaagtgaa ggtctagtct ctcttggcac      4260
     ttctgatgtt gtcctcattt ccacaagcgc ctaccaccct gatcccgact accacgcatt      4320
     ctttcacccg gctcagatag cacctcctag tgagcaagac gatcaaaaca gacaaggagc      4380
     agaacctctg agatatttca acatgatcgt ttataagagt gagcagatgc tcttgttcgc      4440
     tcttgaagtc aagatactga tatttcgtag atggctctct tacccgacaa catgtgcgag      4500
     atctctactt tgatggatca tgggacaagt ttaatgcggc aattgaggaa ctacgcccca      4560
     agtcagtcat cgaccttcct tctcgtacag ccttctggtg gcttctccca gatatcgtgg      4620
     taagttcaca atgaccactt acatgaatgg acttgctata cagggctaac gagcgtagcc      4680
     acacggtgca catggtatct acaaatacat aaccgaacct actgctggga cgctcttcga      4740
     agtaccagct gctaaaaagg tcgaccaatt cccagacatc aggcaagaag ccctcgccct      4800
     cctcgaatcc caacttttca attaccgttc ccgcgcctcc gtcatccttg acgactcttc      4860
     caccccatac gacccttcct ctcccaatgt cgatgctttc ctacctcgtt tgaccaaggt      4920
     atacgccacg ggcggagcca gcgctaaccg tactatcttg agtttgatgg cggatgtatt      4980
     atcgacaaag gtgtgtaaga atgtagagta tcttgatggg aaatggaaag atgccgattg      5040
     gaatgcctgt agtgtcggag tggcgtacaa ggctcgttgg ggatgggagc gagtgatagc      5100
     agctgatgga gatgagagga agtgggttgg gtttgacacg gtaatcaggg aatgtagaga      5160
     ggcgagaaag aaaatccgag gtgatgaagg gaggggattg gaattggaag aagaaggtat      5220
     caggattgta gccagcccag ggcctggatc aagggcgtat gagagaagga ttgagtggtg      5280
     gagagagctg gaacgcaaag cgttggcgga acaacgagct gaaaagaccg cgtgacaaca      5340
     tgtataatcc ttttctgcta caattgtagc aaaaaacacg taatctgtga cgtgcactaa      5400
     ttagtacaga atattcacag acatattcta atataagtaa taaagaaaaa aactttggaa      5460
     gagcctaata atgcacatat cggatcaagt ttaagggaag aaatagactc ctcatttatc      5520
     atcgtcaatt atttagttat tggtggcgat aagcaaaagg cggaacgata gtgatccgac      5580
     caacaaaggt ttatgggtct tagcagacgt cgcgctattg ttcattgaca actcaaaata      5640
     cacgaatgcg taagtggtta ttcgcagggc acatactttt atctagagga ggggaaagaa      5700
     tattcgatgg aagacgaaag cgtctttttt tgcaagagat tataattgta cccttcacat      5760
     gctcaataac aagttcctgt tcgtataacg gctagtatgc tcgcttgtca ctggaggatt      5820
     catatccact gcgtccgcgg gagatcggag ttcgattctc cgacaggaag tttctttttg      5880
     catttttttg agggggggga gattcaatcc ctcacacata ttccatatta tatgcatcat      5940
     gaacaatgtg ctcatgcaat tttcatatag cgatgatagt gtccattcat gatatcaaat      6000
     cgggaactaa gagaattaca aacgacgctt gtgtgtcaac aaaatgtaaa atgagcttct      6060
     acgtaattct atcctccttt accatccctc agctccatca ttctgagctg ctcatcagcc      6120
     cttttctctc tcgccactac cgtattccaa cactctcccc gaatcctcct catcatccac      6180
     cccccaaagc tctcaccttc cacccatcgc atttctacat ctttccaacc cggtcgaagt      6240
     atgtcatctt ccgcagtgtt ggtgatcaag atccagttgt cgttggggac agtcttgcat      6300
     ggaacaatag gtacgtgtgg atcgaaagag gagaacgggt cgaggattga tcggtgccct      6360
     ttcctatttg gtcctggctt tgattgggaa aatatagcgg agattccaaa gatgcagcgc      6420
     ggtacgggat cctccgattg agagcgcgcg cgaactgggt gctgtgccgg agagtcttga      6480
     gaagacgtgt tgcgatcatg cggagagcgg agagaaatcc gaggggctcg ggcagccgtg      6540
     gcagatgcga aactgacagt tcccatggtc ttgacggatg aggatacgga aggtcggcga      6600
     gaagatgcaa aggtgaaatc accaattatc tctacatcgt catcttctac caaagagtgg      6660
     atggtctgat tttcagcggt gctagcacgg acaactgcgt gatcgttgag ctcgaaagag      6720
     ccccgagttg atttggatcc ctttgcgcta ttgatcctat tggtcactgt atccataatg      6780
     ggcttggcgg gggcaatgct gtggtcgatg actaaacgag aggtttcctg aggggccact      6840
     gcgcggatgt gattccttgt caaagtactt ccagccggat aatggctttg cccgatcgtt      6900
     ttggctgtag ctgtagacga taccgatcct gctttgccat gcctagctct agtcgactct      6960
     ggtttaactt gagctacgcg agacataagc tgaatgacga taccataatt ccccctgggc      7020
     acactcacca tcctgtctgg gaggttccca tccagacgaa ctatggcgcg tctgattacg      7080
     gacggccgcg ccttgttcct cttcaccttg ctcaggttcg tcgcaatgct cataggattt      7140
     agttgagaca gtgtgatgcc tgagtctgcg cggtgttgat gatttccact gtgggagagg      7200
     ctgagaattc agagagtgta aaacttcagg tgattcagct gtctttgaga tgattgctga      7260
     cgattgagaa taagtagtca tactgtattc tgaaggtcca ctgtcatctg gcaaatgggg      7320
     caaaggcttg tccaacggct ccgatttttc cgtattgtcg ttgagatcgc aacttccctc      7380
     gtttcttgcc ctactagcct ccgattctgc gtcttcaaat cgtaaatcgg cagcttttat      7440
     atgcttctgt gaacctgcac tcgcgggaga caagtgctgc gcagcggcaa gtttcttgtg      7500
     agacgtttgt tgatcctcgc tgtggtcaag gtcgccccaa acaatattac tcctatataa      7560
     catgtccgct tcttctggaa ggcccaggaa agatccgtta gcagtgaagc tattgataga      7620
     aggagcttcc cgcacagcgg tagcgatatt gaaagcgacc tgtgtagcct tgggagtcgg      7680
     ctgctcgtcc gactcaattg tgatcttggg cggtggcgtt ggtggtggat tgtcgatagt      7740
     cgatgtcgag atgaaagagt ctgttttgaa gtcatcaaac caaaggtcaa tcgattttga      7800
     aatgctttct cggagaggct gctcaggaaa ggagaacgca gaagggctag tggagataga      7860
     gggcaatgaa gctattactt tgagctctaa gcagcgctcg tcagtctacc atcaccaatc      7920
     atagactcac gatgagaccc cttcgaaaca aatggcctgg aaggcttctt tgctatgttc      7980
     ttctcgcaca cgtaggcctc cgatggcatg cccgcatcct cctgctgata ataaaactcg      8040
     ccgtcctcct tttcctgctg atccaatgtc ttcgtcctca gcgattcatt gcgaaattta      8100
     tccttgctga tgctcagttg cggtacacgc tgtcgaattt gaagtttaat gccgccaaaa      8160
     gactggtcag aggagtgtcg tttaggttcg aggatgcgag taggggccag agccgaacgt      8220
     tgactgagtc ttgtaggcat gttgaacgtc agcttgcaaa tcccagcccg gaatttccct      8280
     ttgatatgtc tcttaggtgc cttctgtacg tttctgcccg gttcaatgga ggtaggaaat      8340
     caatgaacga cgaagaaaag aatgacaaca attgcgtggt gtgaatcgtc ggcgacctgt      8400
     gaggagggtg agagggcagg atgtctgtta cgtaaagcca aaagcgataa taactatctt      8460
     cggtcttttc cgagaggact gatggtgatc agtggtgaaa cggtgatgat cagagaaata      8520
     caaagcagaa gtacgctagt ggggcagaaa ccgagttccg gctgacatgg tggtcctaag      8580
     ccggaagcca gaagcttatt cctcgaaccg caaacacggt ctatatacta ttgacagctt      8640
     ccttaataac taataagtaa gactactact tgagtaaatg cagtgcggat gtggcgttcg      8700
     tactacgtag agcgtattag agcgtattag tgcaatgtat aataataggt ccaggctgaa      8760
     ttgacaagta caaatgttta tatatcatcc tgtttcgttt cttaccaccc tccttcttct      8820
     ttattgttgt ttttgttatt cttttcagaa ttcaccgacc gtcccattga tttgactgtt      8880
     ttctcattct atttatcaca tcactccatt cgtttaggat gcctggtctt tcaccaaacg      8940
     tttccgaaga cgaatcgttg gtatctcctc aagctatttc aacgcaacag ctgacatatc      9000
     tcgaagtgcc catattgaag aagagcagcc tctacttcct cccaagagag aacaaggcgt      9060
     tggcaataaa ctcgatctcg gccaatacat ccctttgctg gtaatagccg tctttgtatg      9120
     ggtgttcttc acttccatgt tcaatagcgg acaggttcaa tctttgagtg gtatacacag      9180
     agataccacg gagttacaga aggctgtaaa ggacttggtt agggaggtta gccagttgag      9240
     aagggtcttg gaaaaaggca ggggaactga ttgttgggaa tgattcttgc tatcagatca      9300
     tgtacacggt tttgatccga catgcgtggc ggctcagaaa ttaaggctac acgcaatgcc      9360
     aaatctcggg tttacaatta aaccatacgg gttgttgcca agcggtcgac acatgcctgg      9420
     tgatcggaat gaaactgttt agcaccacaa catttggttt ttttttgtct gcgtgctcat      9480
     tgcaagtttc tcttccacgt tgaatgattt ctacatagat taaaaatatt cagtgattga      9540
     tgatttacgg gttaattctt tttgcgttca ttttgttcta gtttcaggtc gattgcgtac      9600
     tttgttgcat ccaaagaaga aaggaagaat agaaagaacg agataagacc atggagggtc      9660
     tgtgctagaa tctgaacttg tttgaagctc cgaggggtcg gcgatggagt caatattatt      9720
     atgacttcca tacatttacg tagcatttct atcctatgtt agggtacatt gattcgatga      9780
     tgtggttttc aatgacatcg gtagggtcta atattcagct cctgtcagag acaacaaccg      9840
     aagtccgcgt ccgagatcat tactggaaca ttcgagaacg atggcttggg tcagacagac      9900
     aaaaaggata aaactggtct ccagcgtctg ctataaccat accggccaat ccgcttgatt      9960
     ctaagctagc gaacaagtac gccatccaca ggtttacgct ggttgatagc gacgcagttc     10020
     ctctccttgg cggcaagctg gcttccagtc ataagatttg tcctcctcga ttcggcgtgg     10080
     ttgagtaaat cgcagtgagg tcgatgtggg cgaacgcctt ccttccccct aaagcctccg     10140
     catctctttc ccagtctcaa aattagtcca tccccaattg gcggcgataa atgcttcgct     10200
     tgcaagaaga aagttggcca gaggcggggt ataccgtgtg atggttgcca tggtacgttt     10260
     caaattgtcc ttccgaacgg cttgacattg aacgaaggcc gcgtggctat tgtacacgta     10320
     aagtgctcac actctgcgcc aaagaattgt gctggtgcaa aaagggagtc actaaatgtc     10380
     aaaaatcgtt tccaaatgtt gttgatcgca tgttccggtg ataatgtcac gattacgtcc     10440
     tgtacaattt cgttttaaat gtcagttacg acttgccatg gacttgataa cccctttgtc     10500
     tcagttacat ctgtgcattt caaatcgttt gttgcaaagg gataggctgc cctaatggga     10560
     aagcaacttc tcatcgacgg cttccgtggt caacccctcg gcaccatcgc gcgcttcaag     10620
     gacctggagt aatcatcagc gtatggacat agtttgacta aagcgttgac atacttttgc     10680
     agtttcagaa acttgttgga agtagctgag ggaagaagcg tggagggtca taagctcaat     10740
     aggcgaagta gttggtgccc tatggatctg taagcgattt tccatgtgca ctgcgaaagc     10800
     caccagctta ccagttgatc aacagaaggg gatatgatat ccggccatcc ttgtgtttct     10860
     gcagaattca atttaatcag caccacagac aatcattaat ggtcattaca cacaagttcg     10920
     tgggagagta agacatatcg aggggcattc tctggcagtt ctgcagagcc gttagttacg     10980
     ggatgacatg tcaatcatcc gtaaacttac cctcagcgat ttcctcgata gattgaccct     11040
     cgaactcttc atccacagcc atggtcaagc tgttcttgat gatcttgact aaaaggcatc     11100
     cagccttcta ttagacatga tcattatcag aaaatgtggg caaacttgcc agagatggca     11160
     gtggtcccct tgctgttctt gaatcggaac tgcttgagag cgtcgaggac gtcctgaggg     11220
     atatcgaccg ttcgtgactg aaaaaaaagg tcagtatata cccttgtctt ttgcgaaaca     11280
     ctcgccattg ttttgctaat actcctataa ttgaatttcg tatggaaaat atgtgaactg     11340
     tcgtgctcgt atcatcatgt tgctgcaccg gtgatgttgc tgttaaccat ctcaacagct     11400
     ctcgacgtca ccacggtgcc tgaacgggat caaatttata gtatatgatc gtcgactgca     11460
     ggcttgcttg ggcacggaga catttaacac gattttcgca tatattgtat ctggctctta     11520
     tactctatag ataaatctgt caagggccat agaaccactc gctcgtccgc cagcaaccct     11580
     gaatctgcat tcgaacagcc aacatgggta tctcctggct cctcaaaccc gttgccctcg     11640
     tatctaccgt cgcactttca acgcttggtg tcttatcaag gcgctatcaa cgtgcgcgat     11700
     tctacttcaa tcttaccatc tatgtctcca ctttaggtct catgagtgtc tggggggtag     11760
     tagttagtat tttggcaact gctgctggtc aggtacgtgc ttcttttgca ttgtgtgtgg     11820
     atagaaggtg gcaagaacgt gctattattt acctcacaaa tggcgatata gagattaaac     11880
     atcaactact atgtggctag atcactctat ggactcagtg gtcctctgct tgggatcaaa     11940
     tttgaggttg aaggagagga gcatcttgag gggcttatga cggctaggga tgggcaacac     12000
     cagggagctg tgcttctgag taaccaccag aggtgggtga aaggttgatt ggagaagcag     12060
     actttatgct aatgaatcta tagtttcttg gacattcttt atatcggaag gatcttccct     12120
     aagcaggccg ccattatggc gaagaaagag ctcaagtgga ctcctcttct tggtcaattc     12180
     agtgagtgcg gcgcctatca aagcttgttc taaactaaca acatttaata gtgtctctct     12240
     ctggagctgt atttgtcaac agaaaaaata gacatgatgc agttaaggcc cttgcaattg     12300
     ctggcgagga catgaagaag aagggcgtaa gttttgacgt cagttttagc atattggtaa     12360
     cgcactgaca agtagactag gtctctcttt ggatcttccc cgagggaaca cgttcgtctt     12420
     ctcctgaacc taccctcctt cctttcaaaa agggtgcttt ccaccttgcg gtccaagctc     12480
     agattcctat tgtccctatc gtgtgtgaaa actatcacag actcttcgac ggacgcacaa     12540
     ggtttgagtc cggtgttctc aagattcgag gtaagaagaa aagccttccg ccactggact     12600
     atataactga caactgtggt agtgctcccc ccaattccta caaccggtct gactgttgac     12660
     gacgttactt ctcttgccga gtccactcgc gaaagtatgc ttcacgctct ccgagaaata     12720
     tctgaaccag ggccttcatc ctctaccccc atccctacct ctgctgaagt ccctcttgca     12780
     ccccccatat ctagaaatac cactcagcct cccgccggtg actccataca acttgacatc     12840
     tctgaaagtg gcgccctccg ccagcgtggt gttcactcta gtggtgtttc aagtgagtgg     12900
     tctgagggaa agttcgaggc gcaaagtgag gagacaacag aggatgagat ggacgaggac     12960
     gtggttttgt tgaagaagcc gaaggagaat gtggcgtaaa atgtagaaga gggatttgcg     13020
     ggaggccagg aacgttttgg gctgtccgta ttatcagtgt aacgtagcat ggggcggtca     13080
     tgcattaacg ctgtttgtat ccaatagttt acttcttttg gccatacgta atatggccaa     13140
     acattgagca caggagaagt ggagactatt agagggtaga aagaacaagc caaataaaga     13200
     caggaccccc ctctgagaaa ttaaattgga aattaaatga cgatgcgcgc gacaccttgc     13260
     aagtactctc tggaatcgtc catctctcca taacatcctt tattttacac tggtccagct     13320
     cgcatctgct atatttcaat ctccagctta cacaccactt acagtactat cgcatatccc     13380
     ttacacacac atttaatccc tgacaaaaaa cgttcaaaat ggctatggcc ccgccccgca     13440
     aaggttagcc ccatccctaa ttcacgtcac atgtattcgc taaccatgca atcttcaggc     13500
     gagaactggg aacttcgcca acagctgaac tcagagtaca gggataagcg ggcagatgct     13560
     atcaagagag tcattgcgaa ccataccatt ggcaaggact gtagtggctt gtttcccgat     13620
     gtcgtcaaga atatggtgag tgtttaataa ctctttgctg gagtcaagga gcaagggagt     13680
     acaggtaaga gctgatgttc tgaccgcagc aaacagatga tctggagcaa aagaaactcg     13740
     tatatttata tctcatgaac tatgcgaaga cacaacctga actcgttatc cttgctgtca     13800
     acactttcgt caaggtgggt ttgagtttga cttattccat ctcttctgct aacctgcttt     13860
     attaaaggac actgccgacc ccaatcctct tgttagagct cttgccatcc gcaccatgtc     13920
     catccttcgc gccgagaaaa tcctcgatta cctcgcttca cctttatctc gatgcctcaa     13980
     agatgagaac ccctacgtcc gaaagactgc tgctctgtgt gtcgccaaag tgtttgattt     14040
     gaagccagag ctggctatcg aatacgggtt cattgaaact ttgagagatc ttatcggcga     14100
     tggtaatcct atggtatgtc atgcaatgat gagcgtacga agatgtctga tcaattgaca     14160
     ggttgttgca aatgccgttg ccgcactcgg ggatattcac gaggcttctc ttaaccttcc     14220
     ttcttctcag cccggctcgc caaatgacga tgaatctcct agcagtgtcc gtcccaatca     14280
     atcccttttc atcattgacc ccgctaccct taccaaactc cttgtcgctt tgaacgaatg     14340
     ttctgaatgg ggtcgtattg ccatcctcac caccttggcg agatatagga caaatgacga     14400
     gaaggagagt gaacatatct gtgaaagagt gatgccccag tttcagcacg tgaatgcggc     14460
     agttgtgttg ggtgcggtaa aggtgatcat gattcatatg aaaaatgtca ccaaggaaga     14520
     ccttttgaag tctcttactc gaaaaatggc tcctccatta ggtgagttca acatttttta     14580
     ttttttattt ttaattcaaa aatgaatggt ttgaccaaca acgaacagtc acccttatct     14640
     cctcaccgcc cgaggtgcaa tgggtcgcac ttcgtaacat caacctcctc ttgcagaaac     14700
     gtcccgatat ccttgccagc gagatgcgcg ttttcttctg caaatataac gatccttcct     14760
     acgtcaaggt ggagaaactt gagattatgg ttagattggc gaacgagaag aatgtggaca     14820
     ctttgcttgg ggagctgaag gaatacgcgt cggaagttga tgtcgatttt gttcgcaagg     14880
     ctgtcagggc ggttggccaa gttgctatca agatcgatga ggctgccggg cgatgtgtcg     14940
     aagtattgat ggaactgatc gagacaagag tcagctatgt cgtacaggag gctgtcatcg     15000
     tcgtcaaggt aagcttcact gcatgggtat atctggatga ggctaattct ttgacaggac     15060
     atcttccgaa aataccccca ctcatacgaa ggtatcatcc cggcgctctg tgctaatctt     15120
     gaggaattgg atgagcytga ggccaaggcc tctttgattt ggctcatcgg cgagtacgca     15180
     gagaagattg agaatgcgga cgagttgctg ggagcgttct tggagacttt cagtgaggaa     15240
     agctatcctg tacgactcat catgatttca ccattcactc gttgactcat catctctgca     15300
     ggttcaactt caaaccctta ctgcgattgt caagctgttc ctcaagaaac ctgatgaaag     15360
     ccaggctatc gtccaaaaag tgcttcaagc tgctacaaag gactgtgaca gcccagacgt     15420
     cagagatagg gcctacatat actggagatt gctgtcatcc gaccccgccg ctgccaaggt     15480
     aagtcaatat ccacctcttg cttcatgcga aattctaatg gatgtaatat agtctgttgt     15540
     tttgtcagtc agaccaccta tcagtcttcc tcaaacgact gtcgctcctg caatccttga     15600
     ggagcttatt ggcgaaatct cgacattggc gagtgtgtac cacaagcctg cggctacgtt     15660
     cataggcaaa ggtcgtttgg gtgcagacga gatgcacaag aagagcttgg agtacgtcta     15720
     tctctcattc agtccttata gtgatgacct aacctatgct ggacagtgcc gaggacgatg     15780
     tctcacgcga aaaggctctt caagctgtcg ttgccggtaa ccaagccgaa aacctgctcg     15840
     actttgacga cgaacctact cctaccaacg gcgaatcttc catccctgct ccgggtgcgg     15900
     gtttgggcat ctcttctcag gctattgcga gcgcagccaa gagcacgaac ccgttagatg     15960
     aattaatgga cttgttctcc actgctagca tgacaacacc agtcgttcaa cctggtcagc     16020
     ctgcagctca ggctcaaacg tcagctcaga gttcaggggg tttgggcggg ttaaatggat     16080
     tggcagggct gtctagccca ccgcagagtg tatcgccgca acccggagct ccgcaaagcc     16140
     agaaacaaca acagcaggcg gcggctcaag atgatttgtt ggggttgttt tagatgaata     16200
     actgaaaatg tatgttgata tgggtcttca agtggtaaac gccgctttcg tgtcgcagtt     16260
     gagctgagtg aaggcattgt ggcggagaca cttaaataag atgtagatgt gagttgatag     16320
     cacatatttt gcacgtattt caaagatatg gcaattcaag tcgaaaaatc aaacccatca     16380
     gacattcaag ttctacatcc cctgcccgcc gacctagaca gatgcctaca aagcactacc     16440
     cgatgcgtgt ccttcgatgg aacaacaaaa tgcgctgctt tgtttaactt ttccattgga     16500
     tacccgtggc tatcctcgca actgcaaccg gcaagctcag cctcaatcta tagtaccacc     16560
     catattgaca gatttggccg gatcatccaa ttttattgtt tccagcacac gcatggatgg     16620
     tcgggaactg atggaagcgt gggcaggaaa aaaacgtgtc gagggtcctt tggccacggc     16680
     ttcgcagtga tttttcgagg acgcatctgc aagacgacaa gataaaagcc atatacagtc     16740
     acagatgata atgatatgcc aatcatcaat cgtttcgact ttgctactga cctgggcgac     16800
     aacaggcaaa ggagagacat cacgccaagt agcgaagaag accacaaaga cgaagaacaa     16860
     gaaggcctat caacgtgtta aagggacttt gaatacaata agagactgaa tcctgacctt     16920
     acttgtcatc aagtcgaggt tgccgaattt caacaagcac aatgatacac atactgctaa     16980
     ttacctttct tctcggcatt gtaggtgcta taagcccctc ccctcgaccc ccgacccatt     17040
     ccaaaaccct ccagccttta ctaccctatc gaactcctca tgtcccctct cttgaccaca     17100
     caacgcttca cctttttcct attagagacg accctactct cagccataga agccgcagga     17160
     ccaagcctct tgggcggatg tatagtcaat ctgagcttat agggtgggat aaagaagcga     17220
     aaagagcgtt gaattgggaa cttcaaatcg catatgaagg acagacgttt tttgatggat     17280
     gggactggtt cacaatgata ggtgcgtgac ttgaatctga acagtcttgc taaaggttgc     17340
     ttgtcgatag atccaagtca tggccgtgag tcaagatatt tcattaaaat gagaaacaaa     17400
     gaaatattga cctcaaactc cttagtcgtg acctatgtcg ataacgcaac agctttcaag     17460
     gatggtcttg cgttctggac aagcgatgga ataccaggta ttcaagtaga tcactggtct     17520
     gatacagccg tcggcgccaa cagaaactct gtccgaatca ctaccaaatc attatttgaa     17580
     ggtggtctct tcattatcga tttggctctg atgccgtggg gttgtggcgt ttggccggcg     17640
     tgtaagtgcc ttttggttct gatgtaatgg tcaacaagat gtactggtgt gctaattacc     17700
     ttggttaata agtttggacg ttaggatatg aagggacttg gcctgagaca gtgggttttc     17760
     atatggagat agatttgggc ccaatactga tgataccgga agggagaaat tgacattatc     17820
     gaggggattc agtcaaacac taacaagtga gtagctttgt gatgccatgt atttcacgac     17880
     catatcctag ctgagcggct acaatcctta gtcaaatgac tatgtgagta gtgcccctaa     17940
     gggtatgtgg attgtagaac tgagcggata aaacagacat acgatgccag gatgctccat     18000
     taattacagc accagcaatc tgtactcggg cactttgact gtaagctgtt tctctttctt     18060
     tttgaatata tatattgacc tcttttttga agaatcaaga ttgtgattca tctacaggtc     18120
     attaatcatc tttcttccac aaactgtgtg tgcaatctaa taatgtgatt acaggcggca     18180
     gtggctgctc cattatttcc gcttccaact cgtcgtacgg gatgccattc aactcggctg     18240
     gtgggggcgt attcgcaatg aaatgggata cagatgggat tcgtatgtgt gagtcccata     18300
     tcggaacttt gttttttttt tttgttttcg gatcaagcta agtgggcgtt agggaactgg     18360
     aatagagcac agataccatc cgagtcagtt gggttcttga acgctatttg gtttagtttt     18420
     aagaaagctg atcaaaagta gcatcactgc ggagacgcct gatcccgacg cttgtgggtt     18480
     gagcattctt ctcacctgat cattagctaa catggaagga ccttagggga tctaccaaca     18540
     gctatctggg acgcatccat ctgcgatcta gagtccttct tcaaagccca agttttggtg     18600
     ctcaatatca acctctgcgg cgactggatc aacagtgtgt gggatcgtaa gccctttgtt     18660
     ctcccttttc gtctccaccc cattactttt gtctgacatg cacaaacaaa atcattctag     18720
     aataccctta ctgccctggc acatgtcccg aatatgtctc caacccactc aacctcaata     18780
     acacggtcat gctcatcaat tacatcaaag tgtaccaaca atcggatgca gaagtgacaa     18840
     cccagcaggc ggaaacgaac tcgaatctga cgggcgctgg aggacctgtt ggggtgatta     18900
     atggggctac tattcgtagg ccatggtggc ggacggcgag agagaagatg ttggggatgg     18960
     tgtctgtggt gccagtaggg cttttatttg caggctggat ataggcgttc aggctggaat     19020
     gggatcattt catactctat aaccttggat ataataacgg ctactaactc tgtgcttatt     19080
     tcgatgcata tccttgctca ttctctcgtt gacaaccttt tactctccta attctgacgc     19140
     cttgcaccag tccatctcac tgaactcgac acctgtcctg ccacttttcc accatgtgct     19200
     aatcaaagaa ttagatccta attctccatt actttggtct ctgtcatttt tagtttagct     19260
     acacactatt gaacgctttc aacgatcatt caacattttc tacacaaggt tgtcctggcg     19320
     catgcctaac atcttgtgct ttttgttcaa cttttacccg ccttttgttt tcggtaaaac     19380
     cggagatcac cgaaatgaga tccgagagga cggacttatt tatcgcgctc ttcgcggcta     19440
     ctacgtattc tcagtcgctc gcccacgctg ccttcttcag cgcttcgaat ctcctcagag     19500
     gccccaaaga gcagctatcg ggaccatggc gaacatatcc cagtctttgc acgctcttct     19560
     ggaaagagct caaaagcaag attcgctcgg caagctcata atcgaagccc tcgtcctaat     19620
     cgagtctgtc atcgacatcc ttgggtgcgt atttagtttg tgcaatttgg atcgactgct     19680
     gatggcggat ggatgcagag aggaaactgt ggcgatctct tttaatggag gtaaagattg     19740
     tatgtctacc tgcaagctgc ttgctgccat tgctttctca aggctaattg tcggcaattc     19800
     attccaggta cggtattgct gcatctctat gctgctgtcc tgtatgcccg acatacccct     19860
     tccctcccac ctcatctatt tcccaagcct tctccaaaga taacgatccc tccgctgcca     19920
     tctcgtaccc cgcaagaacc tctttcgccc caaccagttc ttccaccttc cttgccagca     19980
     tgtacgcctc cttccatcac cccaccagcc tccaacccgt ccccaccctt ttcacatcct     20040
     cgctccaccc accaccaccc accgaccgat cttccgtacc caccaatccg ttcaatatat     20100
     ataacagctc ccaacccttt tgctgaactc gacgagtttg tactttcatc caccaagctg     20160
     tatggactgg atttgtacag atttggaggg ggtatgaagg ctgctttgga ggaatggctg     20220
     ggatgtggag gaggaagggg agtaaaaggc gttttggtcg gtacgaggca gggtgatccc     20280
     aatgatggtc agttcattct catctactca ctctgcgcag tcattaacgg aagcgcgcag     20340
     ccgtggacat aatagcaccc accgaccctt cctggcctca gttcatccgc gtccacccta     20400
     ttcttcattg gacatactcg gatgtatggg acttcctcct tgaacttcag gtgccgtact     20460
     gtatactgta tgaccaaggt tacacatcgt tgggttcaac gacaaatact ttaccgaacc     20520
     cattgttgaa aagcgaaagt gtggaagggg gatgggaacc agcacatagg cgtaagtcag     20580
     tgattggaat ctttgaacca gcagtactaa tgagaggatt agtgaaagac gcaagccaag     20640
     aacgtgctgg aaggcactga aaaagcagtc tctgactagc ggcgggatac atagcataac     20700
     agtaacactg taactcatat attagacggg gcctatacat gtagagtagc gatggaaatg     20760
     aatgtgccag ggaaatgatt caagtggtga caagcgtcat atatttattt atgaccgaaa     20820
     cgagaaaagc tcggaagaac tatgcataaa acactttttt ctccttctac ccgaatgaaa     20880
     ttccctataa tgctcttgct ttgaatccca ccttttattc gtcaaatgct aaaattccaa     20940
     tccctttttc ttttctatga aacgccacta accagaacta agagactata tatatatata     21000
     cctgaaagaa atgaatgaat ttaagagacc tccctgcccg aaagaaaaag actaagaatg     21060
     aattttccca actcaaaccc aggaccattt gacttctggc cgccaacttc ttcactaacc     21120
     ctcaccgaaa aggaaacaag gaaaaaaaaa gagagaaatg ttaactagtg cctacccagc     21180
     tttccatcgt ccatactagc ccttccacca cgtgggctaa ctgccgcact tgaacccaaa     21240
     cccgaaaggc tcaatccact cgaactctgc ctccctggct ctccatcctc gttctcgtca     21300
     tcaactgtca attcttccgc catcttcgcc aactcatcac ccaccgcgga cggcgctctc     21360
     gtctcttcat ccgaatcgtt ctgaccatcc cccccgctca gtggactact tcgcaacttg     21420
     tctttcccgc ccaaagcacc aacgcccaac gtcctatttc cagctgtgga agtagcatgt     21480
     tgaggaggga tcgcgttggc aaagtaatcc tgtccctgcc tggcttgcgg tgaattctca     21540
     gatttgccct gtaacgcccc acctggggga ccggcatact gcccatatcc aatcggccca     21600
     ttaggaaacg cctgcgtcgt aggtgtgccc agtgcagctg aaccggcttg tgggtgatta     21660
     ccaggagtag aagggaagcg attaacagga gctccaggag cagggttgag gaaagggttg     21720
     tactggaatg caccgggcga tgtgacagga atgcctggtg aaaatggtcc agcggcagga     21780
     gacataaaat gagaggcgtg cccgtgaaga ggaggcgtct cgggataatt gaaaacgaat     21840
     ccaggcatgg aaggtgtcat aggagggaga ccgcgagtgt gaagtggtga tatgggattc     21900
     ccgtgttcca tatggaaggg aggcatggat atgggaccgg gatggtgggg gtgacggaac     21960
     acgggagtgt gagaggtggg tgatggttcg ccatgagggg gttggccatg ccctggggcg     22020
     gtgtgagtct gtaaagaagt gttcagactc caagggagct tggcaatggg ggaagtgcta     22080
     ctaggcttgg tggaaggaac agaggtgtcg atcggagtaa tgccattgct ttggagcata     22140
     tccttgacgc cttccgggac gccagtcagg tggtcctgga tacccagaga agtagcctct     22200
     ccagatacag aatttctggc actacgctga gaaacttcgg ggtggatgtc cctctccaag     22260
     tgagcacgaa tccggaaacc accgatctcg cggctaacgg ctggtcagct atgatctgcg     22320
     ttgaagcttt gggccactca ctcgttgaac aaaagtacag ctcttgtggc atcggcttca     22380
     gtagcgaaca atgcagtccc gaatcctcta ggctttccgt gggcatcggt ggcaacactt     22440
     ttacttgaat cagcacctag gtactcttca cgaatgaaaa atggaaacct actctgctcg     22500
     aataatggtt cccgcaggcc ttagcatgtc tttcagatct tgccattgca tcgacaaagg     22560
     taactgcgac attcagtcag cgtctgcggt gaaatttcaa agatgattga cttgcgtttg     22620
     agacaaaaat cactcggtca tgcagcgtgc taggaggacc taatcccatt ccctggttgg     22680
     ccaatccttc caactgagga atcggcgccg ccgccaatct ccccgctcct ccatttggac     22740
     tctgtgctgg tacatctcct gcaatcgtag gtgctatcgc atcaacagct ggcgcaggtt     22800
     ttataccggc aaacaaggaa ggaggaaggg ggccaagcgt acctggtgga ggagcgcggc     22860
     ttccaccagg agaaggaggc ttgacgctac cactgctcga tgtaggccgt gaaacggcca     22920
     tattaggtga cgtactcgag agaggggccg ctgcagaatc aaaagttgtg agggacgctc     22980
     caaagggtgt gagagaatcg cggcgaactg cgctaacacc tgcaggcata gcagctccag     23040
     taccagatgt gagagatcca gcaagaggtg actgtccaag cgagtggaaa gcattcagac     23100
     ccgtattttg cacgctgagt ggaagaggct gagctccgaa gacagaaggg ggcgattgcg     23160
     ccccaggtat cggcgtcgag ctcgtcagac ccacagcact tgaactcgat gggacaccca     23220
     tgcctccggg tatcaggcca ccggccgccg agaacggcct tgaactcggt atttgtccag     23280
     ggagccagcc ttggccggat tgaggggtga tgtggcccgg gatggaaaaa ggtgtatgag     23340
     agggaccagg gaagttatgg aaagagtaca tggcggagcg agggttggcg ttgtggtgaa     23400
     tgggatggga ctggggctca tactctggcg ggagacggtc aggtcggact tcaagggttc     23460
     ttgtctgcca agtgtagcca ttgtagcgat ctggtttgga ttagtatgga acgttacgag     23520
     gatcagccaa cgtacctatt gctcgtgcag catcttccct gctgcccatt aagacggtac     23580
     cgtatcctct actcctatta tccggtccca aactgacgtc cgccctcaat actgttcccg     23640
     cttttctgaa aagatccttt agatcctgcc atcgaactct atacgggagc taacacagag     23700
     ttagcaactt taggtgtgca gcaagtaaat agatttacgt tccccacgaa aaggttgact     23760
     cgcccgtcac taccaactgc cgagggcaaa agatttgtca tgagtggcgt tacagaacgg     23820
     tttactaatg agtctgccat taatgctgtt tctcccgtcg tctactgaag gaagaaggca     23880
     actcactgtc agagttaaag tctgaaggag gtggtggagg tgcgttggct atcgcagcgg     23940
     caatgacagc atcaatctca gccgatgtcg gagcacggga actcgcaccg ctcatgtctg     24000
     tcatagtgac ctgcgttgat ggatctaggt gagcaagtat atctccacca catgcttgca     24060
     acacttacca caggggagtg tcctttacct gacctttcga gtatgacggg gttcgcccca     24120
     tgtgcagccg cttcttcgaa ggccgcggcg gcctcgaata aggacgacat gtgggaagaa     24180
     gctgcggatg cagagtggat attttgactt ctggggagaa aagcagtcag cagttgtgga     24240
     tagagcggtt ggaccataag aggtgtggga gaagcgttgt ggtagagcgt gtcttcctag     24300
     cgcgcgttgg ttttcgactc gggatgccta tgacgacacc gcctgcgctg ggtgtcgttt     24360
     gtgaggaagg gagaaaggag gacgtacggt tgactggact gcggcgtaga gagcggtggc     24420
     gagggggtgc agcggttgga aggaaggatg gaataggaga cggtaggacg gtaggaggac     24480
     tcgcagccgt gagactgagt aacactaatt atcggatctc gccaatgccg ctcaaaaacc     24540
     acccccatat actgcagaca cgtcatcccc actcagccac gacttgcatt cacatttctc     24600
     atccttgtat gcatgcattt atatcactga actgcgtgca agtacaagtt gatccccaca     24660
     agtacagcct tttcagcgct tcgcgacgat atgtggtatc caataaatac tgtgcatccc     24720
     tgctctgcct tccgggcgcc gttgtggcat gtactgggta ctggggcctg gcgctgctgt     24780
     agcgctccta tctgtcaaaa catttcacgc cgggcaatac cggcagtggt gaaataagtg     24840
     cagttcatca agcaatcttg ctagaatata tatctcgtgc tgcagacatc ttgctgaccg     24900
     ctgactcaga tctgttcaga ttcaacttct aacatcaata ggcttctgtg tcgaaacgcc     24960
     actactacta cagctggatc tgcctttctg ccaacaacgg ctcagcaata catcatctag     25020
     ctttctgctc gctgctcaga atctgcacct gaatctgcac caaactctgt acgagactca     25080
     gcacagtagc gcggccgacg tgaagaaatg cagttccgcc tttcaccgaa tgtccgttga     25140
     gcccaccaca tgctcgtttg ttggcagtcg gaaattattg tttctaacag cgatagatta     25200
     ttgaacaacc agagtaccat ttattgataa aggtcggcaa tcgaccgcaa ttcacagata     25260
     tcaataagtg cgttgtcgac ctatcaattc acatgaattc gtcaggtcta taaacagaca     25320
     tttatcaagc aaattgtagg cctttattcc tacctgcgat caatccataa tgccaaacgc     25380
     catatccagc aaccgaaacg actaaaaacc attccaatcc acccatccac aacttcattc     25440
     cctactctaa ttcatcttct ccaaccctcg cacctactcg attttggatt tactccttca     25500
     ataacggtca ccgccagtcc tcctgttcct gtgggcgaca ctagctcagg atctctaccg     25560
     gctccattta ataccatctg catacctcgc tgcgacaact tatcgactca gcctagaaag     25620
     ctggaatgca acgttcttcc tcccctttct cttactggtc aatctgccga cacgcctttt     25680
     ttagaaggcc agggcctctt taggatttca ctgaaaggag aaataattct tctcagaagt     25740
     agacagcata atctgtcggc atatcagtag gcacgcgtcg gtcggatagt gagcggtagt     25800
     ccttcatgag atatgttcag gccgattaca tcttacagct tacaaaggaa gccctcttcg     25860
     cgctttgttg atcctcgatt tgctctaaat cacgatacac cacgaggttc taaggccttt     25920
     gatatccttt catgctattc tggatttccc tcgaactaca gcagacatct tgggtgaaga     25980
     tactctgagt aagctagtaa atgaaataat aattaacaat gagcggcaca aggtgcgaga     26040
     acggcggtac ggagcaggac tgtgaagagt ggtgaattgg tcgcgaggaa tggcactggg     26100
     catagtgaaa gtcgtgagga aggttgagta tgctgtcttt agagattaaa gaaggggcac     26160
     caggaaagga tgaatgcgtc ctagtaagct gttgtgctat cttagtcgaa gtttgataat     26220
     gaagcaagac tattgtcatg tatgaattct gtaaatcttt cctggtcaca tttactacaa     26280
     acgctccggc attgctgcga ctgactatcc tacaacgtga gggtttctga tataaaggct     26340
     aatcaacatt ttctgagcgc ggggacacaa catcaaaaga ctaaatgcac attggtgggg     26400
     tcgagtaccg gctcgacata tataatgata caacatttta cttgttctat attgtattaa     26460
     taagagtaaa gaggtgctaa agttgaacac ttacaaaatt gaaaccatac ctggkgttgg     26520
     aagggctgam agggccgagg tagctgttgg tgggaggcga matggcgata ccgtgcgagg     26580
     amctagcgat gtgggccaag tcgacgcctg caattaagga caagtcagca taagtaaaag     26640
     cggagatgga tatgaaaacc aaccctgctt cttgtggagg acaccctccc tatagagcct     26700
     catcttctct ctctcttcat cactcaccgc actcatcctc ctccccatcc caggcctgtc     26760
     gccagagtca aggctgctca tactatcggt ggggctggta gcaatattac tctggccctg     26820
     gatactccct cttttgccaa ggtccatcgg cttaaagtca ttgccagagt cggtgacagg     26880
     catcgcaccg acaggatcat tgatctcttc atcgaggtca aaaacgtcgg aagacgggag     26940
     ttcgtctaga gcggcttcag cctcggcctc accgtcaaga cggccggaag cttcgtcatc     27000
     gcctttacgg gcggtagatc cccagttatg ggcgccatcg ccgttcttgt ggttccactg     27060
     ggtcttgtcg agaccagtgc gggaatgacg gtccttgagg acggcagcgg ggtattggtt     27120
     gcgctgttgg gtcagtgcgt agtggggtga catggaaaga tgggataggt ggagcgagaa     27180
     ggaatggtgg ggaatagatc gtagacgaaa caagggtaaa agcaagatgg gaagaaaaga     27240
     taggcgcgga gtggagtagt ccggttagac aggagacggt cacggggaca tacaataagg     27300
     gcgcagcacg gtggtaaaag acattccaga tgaagatacc atggtgaagg cacatttacg     27360
     tgaggccgta ggagggcagc ggtccacagc gcatagagga caggcagaca aacagtgatt     27420
     ggtaggattg gagacgaagc ggaaggacag ttgttagcct ggtccaaact tggcatgcag     27480
     ctccactgcg gtattgagat ggagacgtca ccagctcggg cggtggagcg gccaaaactc     27540
     acctcagtcc tagtcatgat ggcaggcgtc agagtagttg ttgtgtttat tggctggttg     27600
     gagtgatgtt gtgagaaagc aataagaggt gcagacagga aggatcgcag accggtgtcg     27660
     gccgtatata tatacatggg agggccaagt tatcgagtcg agctgcgata ggtcatctgc     27720
     tgtcgtcaca tcacaacagc agagatcggg tgccgcagct gggtcacaag accagaacgg     27780
     ttgcggccgg gctcgcattt ccccgcgggg tcagggctat caaccaggca ccgctcggca     27840
     tttcacctcg atcaccgcag attggcaccg ccaaggtgga tccaacaaga agttacgtat     27900
     gcatccgatc agacgcttgg tatctactat ctctatggcc tctctcatct tacagctcgt     27960
     cgtggtgcac aggtggcgca tactttaata tatcggagag ttctacagag gattaatacg     28020
     gttgacatgc atgcggaaaa tgcttgactt actctgtcta gtctctgagg atactgctgt     28080
     ggggaaaacg acagaatatt caatgaacat gtcccccggc ggaatgtcca tgtacgatgg     28140
     catctaataa caatagatca gattcgcaaa acaattaggg tgctagaatt cttacaccct     28200
     ctccttcgat cacttctact tctccaggct gggtcgttcc tgtccgtgac aatgtaattg     28260
     tacgaccatc aagatgcgtc aagcgtctct caaatccaag caatgcctgt ccgaaaataa     28320
     cgcttcagcc aagttctttc tgtttccacc aaacagggat ttacctcagc cacactcaat     28380
     gttacccttc ccaaaatccc attctccttc ctcctccacg ccccttcacc ctcgttcaac     28440
     ttactcctca cccgtaccac tacatcgccc gcttccatat caatctgttc atccgcttct     28500
     ccatggaaaa cctcctcaaa tccttcgggt gcaccggcag gaatgtgtag agcgagagtg     28560
     tgctgggttt gaacagtttt ttcagagtgg cagacatgac atgagcgggt gatttgtttg     28620
     cctttaccat tacaatgagg gcacctttca agcaaaagca ttagtggatg agcctgctga     28680
     gagggttggt tgcgatgact cacgtcattt ggacattggt gaacattccg gggaagacct     28740
     gatgtcgctg gacgaccact ccttgtcctc cacacttgtt acatgaatga atatccttct     28800
     cagactccgc tcctgatccg tgacaatgag ggcaaatgac tcgtcgaggt atttggaact     28860
     gcaatcaaca agcattagca attatttcaa aaagcttcct tcaaggagaa cgtacctcca     28920
     acgttctgcc tgtgtacagg tccgccaagg aaacctcaac attcgtgatc aatccaggac     28980
     ctttctgctc ttgtgcagca cctacgaatc ccaaggtcag taaatcgtcc cccacagtaa     29040
     agggcatcaa tcgccccccc tcaccccatc acctcgttca cgccgctcct tactaatcct     29100
     cttcccatag caaagcgaat gaagactaac ctcctccaaa gaatctggca aacggatctt     29160
     ggcttccgcc agatttttga gcttcatgtt gcttcaaacc ctgctcgcca tgtctgtcgt     29220
     aaatcgtcct tgtctcagag tttgacagga cctcataagc tatacacagt caccgtaagc     29280
     cccagaacgt gcgtatacat taatcatatc gtctgacctt tagaaacttg gataaatttt     29340
     tcgtgggccg cctcgtcagg attgatatcg ggatgatatt tttttgacaa tttctgcaat     29400
     gaaattcagc tctcatgctc tcacctatca ttcacagctg agatacggcc tctagatgta     29460
     tactcacccg gtacgccttc ttgatatcag cgtctgaagc gtcctttctc actacaacac     29520
     atctccatta gtatgtcacc tctctgcaaa aaaacgcgta aacgtcgacg tggaaacctc     29580
     cactttttac tcctccattt ctccgcttaa agaaaaagaa aactgacctc ctaaaacgtt     29640
     ataaagcgat tccgccaagc atccgcctag taaggctagc gtcagtaaga agaagagggt     29700
     tgtggggagc attatttgtc tgcagtttag aaatgaggtc aggacgaaat gtgggctttg     29760
     ctaaaaaaac gaacggtggg cggttcgcgc atcatcgaag gcgcgtcttc ctcttcctta     29820
     attgaacgga atcaaataca cgtggctaac accggttatg gccgtatcac ttttgccgcc     29880
     atggtcaatt cggcagatgc ccgttggccc acctggtcgt catgtctttt tacttttctt     29940
     tgttggagtg cttctataag atactaaatt tgaacatgag acggtaaaga acaagtatgg     30000
     cagacaaaga agaactacaa gaacgaacta aagtggctag acaagagtat agagaatatc     30060
     taccgcttgc acagcaactc caaggagatc tccgagacga cgccgaacaa cttcgggtac     30120
     aggaaggctg ggatgaagat acgtggaatg gtgttgaaga gtgggttgat gatgtgggaa     30180
     gtatatggag agctttaaga gtaagtctta gtttgatttc gtatcatcta agcttgacta     30240
     atgcgacatt gcagagaaac cgctatgacc aaaacaagac acactcattc ctcctctcag     30300
     tcctgtcgac tcgtctttct ctctctttac acggccctat cccttctatc ctaccatact     30360
     cggattcccc tctcttccac atcctccccc tcccttcaca caccgataaa ctcaacagac     30420
     caattgtcgt tctcaccgcg cgcgaaattg ttagggacga acaaggaatg ctagatgatg     30480
     tcaaagaatg gatatggtgg gctttagaaa tgtgtaggag gacatctaag gactggtgga     30540
     gtaaagggat gtgggacgga agtggggtgg atgggtatgg gaggggaaaa gggaaggcga     30600
     ggggcgaagg aggggaaggg attgtcttgt tggttgatgc agccggtgcg ggatatcgaa     30660
     accttgtaag tgcaataaaa gtcacgtatc cattcatgcc aggggcatta taaattgaag     30720
     caattgcctg tttctaggag gttgatctac tgcctacact actttccgta ggacataaca     30780
     gctttccggg cctcctcgag gcggtatacg ttatcaacgt tggatggaca gggcgaagca     30840
     tgtgggccgt tgtcaagcat ttgctcccca aatctgcttt agaaagggtt gcattcctgg     30900
     acacgaaaga atcactagcc gaagtcttcg aactggacaa gatcccacaa ggtatgtgca     30960
     tagcagtgtc ccttgtaatt gtgtgatctt caataacgct gtacacagca tacggtggcg     31020
     acagccctta tacattctcg ccctctaata atcccattta cgcatactat tcccgccact     31080
     cgagtcattc gtttattgcc tccatttcca gaagcacatc atgcacctct atagcagacg     31140
     tatactacac agcgcgcaac acgccttttc cgagccgccg aacgtctcca ttgattagta     31200
     ggcagaatag cgcttcaagt ggtatgatga aagccatgtt tcgagcgggg tatggaaatg     31260
     atttgagaat gaccaagagt cgtgatgaga gatcccgaaa ggtggaggga gatgatgatg     31320
     gcgatgaaga ggatgagatg accagagtca tatctgcatc tgatgttgcc gccgtaggcc     31380
     cgatgacggg tcttataaca cagtccttga ccgaaccgga agatccacaa ccgattttat     31440
     ccagggcaag tagtaccctc acgtcaagaa gtaaaccacc tactcgagct ccctcgtccg     31500
     cagcggtctc acgcatcaaa tccctctccg actttcatct ctatctctca ccttctcgat     31560
     tagcgcgtat cgatcttctc tctgactctt ctgattcgga agatgagcct ccccctccac     31620
     cttctatccc ttcgcttcct cgtcgcaaag tgcttcgccc ggcgctgctg gaaaagagcc     31680
     tagcaggaac gcctgacgag cgcgagaaaa gaactaatag acccgctttg cggttgatgg     31740
     gccttccagg tcatttggcg gatgatgatc ctgtgcgaag ctattcggga agattgcaga     31800
     tgcatcatgc aaagtggctg gagggatgga agggaactcc ggaagagctt ggactggaag     31860
     ataatcataa gcttggcggc gtaaaacatg aggaagagga aaacgccccg ataccgagaa     31920
     caatatccgt ttcaccacct attgatcgtc ctccttcacc ttccggcact cttgagccat     31980
     ctccgtcacc gtctcccatc cattctcccg caatgacacc acaacctcat gacatccagc     32040
     cttactccac ctcaaatcct ttcttcggtt atccagtagt gcaatttggc agctctatca     32100
     ggccaagata tcctcgtaac aggaaacgtg atcttgtcaa gacgctcttg ttccttttca     32160
     tgctaaagtt acagagctgg agggattctg ttgaaagagc tctaggcttg aaccgtctac     32220
     gtatcccgtc cctttcccaa ccttactgct cgtcctcact ttatactcct gggcctaaca     32280
     ggagaaaccc cgccgagggt cttgttcgct ctgcggcaac gcccggcacg tactcgaagc     32340
     aagtcgcgaa atatagaaga tgggataaag attggtggtg gatgattatt gggatgctgt     32400
     tgttgagagg aacgtgggga agaattgtgc tggcaccgtt ggaggcattg ggactggggt     32460
     tgtctgaatg gaaggctata tggggagcag tatgacacaa gagcggtgac acaagagccg     32520
     cgtggtgtga tggagagctc cgatgttttg ttgtggtaac tgctgttgga cctttcatat     32580
     gtactcgcca ggttgtattc attgtcgtca tgcaatttgt gatgttgtca tgccccatca     32640
     tccatcagcc tttcagtgct tcctgatgca aaacactgcc gagtgtcgac cgatttacgc     32700
     gcgtaagatc atgacgagtt agcgaggatg cttccatcaa tcacccaagt ttggaaggct     32760
     cggaccgaac gagaccaaca ataacttcac cgtaatcaaa agaggggaag attggtcctg     32820
     cctattattt cacaatacct ttctaagaag ccataagaag ctttaagaga attaattgcg     32880
     gcggcttcag atgtggtgat agaatgccag aggttcgctg gagtcttagt cgccatagta     32940
     atatacggtc ctccccaaac gggctccagt tccaaccaca tccacattca tcattccctt     33000
     cgcgtttttt acagcctttc aattataatc atgagcgacc cgatgagaga tatgtgaata     33060
     cgctccgcaa atgatctcct ccaatagaga gattacttct gctcgaaatg tttccgcctc     33120
     tatcgcaaga gtctcgtgca cccacaagag ggagaaagtg tgataagcgt ggggtaggta     33180
     gcaaataatc tgcttcggga gagaagagct aatatcggtc gtgcaggagg ttttgtatga     33240
     cagagcgtgc gggggttggt atcgcacctg gagaggtcga cccgccagat ttacactcga     33300
     cattatctgt gatgctgcag tcaggtattg tgagtaaaaa tgcttcgata gggccatgtg     33360
     tgggtgatgt gtgctgagca gcctcgtggt gtcaggtcga tcgacgcagg aacgcagcct     33420
     tgagaggcgt acttgttgtt atttgtatcg gtagtatgta gtagctgatt gtgacgatgt     33480
     ggtgttcata atgaagacca aactttggtg atcaattcgg ttagccatta tttcaattat     33540
     ctgatgacag ggattattgc tagaatacgt cgtatttgtc tgtacatcat ctatgcagaa     33600
     gagatgatgg tggtctcttt ctttcctaag aggagatcgg gacaccgaga agcggggagc     33660
     tgggcgatgt ccgttgttta ccttgcgacg tggaagatgt ggatgctcgg acgcgttcga     33720
     ttgaccgctt ctcgaaatct gttcttccat ctttttcgtt ggcaatcgac tataaaacgg     33780
     gatctcaaaa gatctgaaac gcattgatac ccccctctat tgattaagag gaaatttggc     33840
     aaagctttca tttgatactc aatcgcattt gagctttaca aggctacgtt ggcttagctt     33900
     ctgaagagct agaccaaggt aacttctgtt gaaatgggag tcctcaggta agttccatct     33960
     gacgcaagca gaaatgctgc gttaaaaact gattatgtct tcaaggttag ctgtgtgtat     34020
     ctcgggtgta tacgctgcct ttttactgtg ggccatcgct caagaacggt gtcagtcctt     34080
     ccttctggat tcctttgtct tcacgctgat acagatgcaa agtatcaaaa ccttttccct     34140
     ctgtgcaccc tcatcctcac caacagcccc attcaccttc agaccctcca cccggcgata     34200
     agttcccttc gccattattc ctcaactttg ctcaagctct ggcttccagc ttgagtgcgc     34260
     tttgttactt gtcgttcaaa gcttggagag acggatggaa agggcgaggt ctgggccagc     34320
     tgttaggatt gaaagaagtg ttcggtaaaa gccaaaccgc attgaatggt gatgccaaag     34380
     ccaacaagaa agagtccgag ttgaacgaaa agacgaagga ggttgtcgag aaggcaccga     34440
     agccgccgaa gaagagtctc ctcgcactcc tcgtgcaggt ttcggtcttc cagacgatag     34500
     ccagtcccat tggattcctt gccttgaggc atatctcata tcctacaatg gttttaggca     34560
     aggtgattac tccttactct tttgaatgta gtgtctaatt ccatctttag tcctgcaagc     34620
     tcatcccagt cttgttgctc aacgtccttc tctatcgacg aaagttctca cctcataagt     34680
     atatcgtcgt agcactcgtt accgtcggca ttagtatgtt catgcttttc gctgaaacat     34740
     caaaaaagaa gaagggtgga agtgatagta tgtggggact cgttttgtta cttgtcaagt     34800
     gagttatcat tacgtggagt cgccgcatca agctcatacc ggaatagcct tcttatcgat     34860
     ggcctgacaa actcgaccca agaccaaatc ttctcatcat atccttcata caccggccag     34920
     cagatgatgt tcacaatggc gctcactact caaattatcc tattacctct ccttgtcctt     34980
     ccgctcccca ccaacccaat atctcttctc gcccatttac ctccgccttt tggctcttct     35040
     gtgccaacct ctactctcag cttctcccct cctgcggcat tggaatctat ctctttcctt     35100
     ctttcccatc cttccgctct tgcgcctctc tttgcatacg cccttcttgg tggcttgggt     35160
     cagctcttca tctttgaaac tatccagcac tttggctccc ttaccctcgt catggtcacc     35220
     gtcacaagga agctttttac catgctcctt agtgtcgtcg tctttgagca caggctcaca     35280
     aaaggtcaat ggttgggtgt gggcgttgtg ttcgctggta tcggtgtcga ggctgggatg     35340
     aaaaggaagg atgtaatgaa gaaagcgaag aaagactgac catattctag agtgttacat     35400
     catggcatat gcatcgcatt gtaaggaaca aaggttatct attcctttcg gcctgagtga     35460
     gaagggttgt tcgaagaatc agtactagtt gttttggaga ctgttacatt agaagaagaa     35520
     gttatctacg aatacccaga aggcaaatcg tgttagtggt cggtgaacat tacttcgatg     35580
     ttaactcgta cgtcgtgaat aaacccttcc acatttatcc gccggtgttt tcttccactg     35640
     ctaagttgcc ttagatctag agataggagt tcaaagtagt aggcgcctgt gtgtggagaa     35700
     aataagtata gtggtcaaag aagaacatac gtagatcaag attatggatg gcatacagaa     35760
     gcctgaggcg cgttgtcacc tggaactcac gtggtcgcgt ggcacagtcg tccttcgttg     35820
     taaatctacc attttgtgtg ttttcgtcat tctcacaacg gaaccgtaca acgtccgcat     35880
     tttcgactgc caagctcagc aataagtttt ccgcagcatg tcagttccca ctcaacgctt     35940
     ctcggacatc cggcggtccc gtccgtctta ctcttgtcaa gtctgccgcg accggagggt     36000
     acggtgcgat caggtcagaa cactcctgaa gctatagccg agccgcctcg agccctgcta     36060
     atcttatctc caggcgcgcc caaagtgcgg aaactgtgtc cgcaaccaag cccaatgtgt     36120
     ataccagtct aacctgtcgc aaaaacgcaa agacccgatt acggacgact cggcaaacaa     36180
     gatgcctcga aggaacaagt cgtcgggttc ggaacgcagc ccatcgccac tcgagacagg     36240
     aaagctcaaa cccgggtatc tggtgcttaa tagtgggggc agatcacggt atacggaaag     36300
     taccttctgg gcatgtgtgg atgccgaagt gagcagccac ttacatgacc catcgtttgt     36360
     ccagagttga caactggctg ccagggcctc gagcttgacc ggattctgcg caacctcccg     36420
     cttttcccga ggaccggcgg cccagacgac ctggttactc ccccagcttt ttcgagcagt     36480
     cccggggcgg cgacaagtgt gccgaacccg tccactggaa cctcgccgga tcgcatcagc     36540
     tggggtcccg ttcgtctagc aaaattactt caaccccttc ccccgaaact cgtctgcgac     36600
     cgcctctttc gagcgtttat ggactgcatt catcctctca tccctctaat gcacattcca     36660
     tcgttcgaat ccgcctatga cgagttttgg tcttggcgtt taacacgtcc tgctcaaaac     36720
     atttcgttga gtatcctcca caggaatcct agctttctcc ctcttttaat cagtgtttta     36780
     tctgctgggt ccatcacaat tcacgaacca tggagcgatc gagtcggcca aaaactgcgc     36840
     ggcctgatgc cagaagccct tcgagtaatc ggtttcccct actatccctc ggtgtactct     36900
     ctgatggctt acatactcgc taactcgacc ctgatccgcg aagaggacgc ctttagctct     36960
     tgctcatttg tcgccgtggc tctaagggtt gcacagtcga tgggtttcca tcgcgatggc     37020
     accgaattcg agctcgaccc tatatcgact gaagagcgtc gccgtgtatg gtggcacctt     37080
     atgcatctcg ataccatgac aagcatagct cagggtctac ctggcatcat gtcgagttca     37140
     cgctgcacca ctcaagtaat cagcgagatg aaggacgaac ttattggtaa gatcaaaagc     37200
     accgactcgc ttgatcgtga gctgtgggtc gaaccaaagt acgtgcttgc ggctggacgc     37260
     tatgaagcta gcacccagtt gcgaaccatt ctagagcgac tgcaagaagc accgaatatc     37320
     actctttccg acatcgcccc cttggagatg cagattgagg acctacgccg gcgtcagtcc     37380
     cgtcgtctag agagcgtcaa tctacatgcc cattcagcat cattacagga aatattggat     37440
     cagctctcgg tccgtgtcgg gggggacgac tttactgatc atcgacctcc gccgcccacc     37500
     acagcctcaa aagccattca acaatggaat caagcactct tgcatctcac gacggttaaa     37560
     gcatactgta tattgtatca gcccttcatg tcagacaagg tgatttgggc aaatcttcga     37620
     tcgaggtttg catcccagtc agtcatagaa tggccataca cgctaaagca tcttgtaggg     37680
     cattaccaca ctttcaatac tttttggctc tgtttttgga gatgactacc aatccgtcgt     37740
     accggccatt tcattggctt tatccaggct catatcaacc gctacaacca tgcgctgtct     37800
     tgctttctga tctgtcagca catccccact cgtccgacaa aatgctcagc atgcagctca     37860
     tcgatagagt attctcgtta ctgggacctg ctggcaggct agtcagccct gggtcgtatc     37920
     agtctttgcc ctcgttaacg ggtgcaaaac aagtatggac tgtcctcgaa aaattgcgtg     37980
     caaaagtgtg gcacgacctg ggatacgacc atacgctgtt ctgggcagag gatgaaaagg     38040
     gtgatgatgg gttggcccat cgaggctcca tggacttttg gctgaccggc aatctggctg     38100
     ggcattctgc agacagaagt gataccgcaa ccagttccta cccaccccct atgccgcaaa     38160
     atggcgaagc tattgccgac tctacgaccc atcctaccag gtaagagtga catttgatcg     38220
     cacaatatcc cgctcatcaa gccacagtta cgccgaatct ggtgctacgt ctacctcgtc     38280
     tattccgctc ccagtcgcag ctcttaacga gcaagattgg caaaacgata tggatgcctt     38340
     atcctggata ccttggggga catcaaatga tccccctttc cagtctatcc agaattctct     38400
     tacgaccagg caagtgtgcc ctctctgatt gaatgaaatc ttcgcttatc tatccgtctt     38460
     atgtagcaac tacatgccgg aatcaaccga tagcggtgaa gcagagatag cccctgggca     38520
     aatgattgtt ccgccaggta acgaaactga tcttttcgga ctttacccgc ccacagagag     38580
     tcagttgtca tcaacccgct atcagggaca gaatttcttt tagtcaggat acgcatgtat     38640
     tgcagcctgc cttcatttct tagtccgttt gaaaaccttc acattggcaa taaaatcgac     38700
     attcgttgaa agggtatgag cgcacgaacg aaacatacgt aaccatgcca tccgaaaaca     38760
     cgtgttgatt cgcatcggca gcatcttttt aatggagagt gcggtgcaca aatgaaataa     38820
     tcacaaagac acaaatttcc gagcgcactg attgcttcat aacggtgaca tcgcaatatt     38880
     catttcaaat atgtatcatt gtcaggcttc tcacatggct tttaccttgt caaatgtttt     38940
     tccctttact ttcctttgtt gagctcagcc aaacggtctt cgatggactt ggccaaatca     39000
     acattcacct tggcgaagat ttctgtaatc aggttaacat ctcgtgccgc aaaacactct     39060
     ccgttgacca cttaccgaca gctcctttct gcaccgacgg gatagccttg cttagatgac     39120
     acgagacatt ggtgatcaag tcctcttggt cgccagcttt gccaagaacc tcccagaaca     39180
     tgcgagcttg gacgtaatcc tcatccgtta cctcggatgt gtacgccgca actcgaccga     39240
     cccattcatt gtgtttctcg ttgcccccag tggaatggcc ttttgcgccc aattgaccct     39300
     tgaagttgac ttccttgaga gaagatcgca cataattggg atcacctccg taattggtca     39360
     tgtagcgcat cgcaccgtca cgctggtagg gcgcataaac ctcactgacg ggccgattgc     39420
     acggaagttg ctggtagttg acaccgaggc ggtatcgagc ggcatcgggg taggcaaaca     39480
     tcctagcttg cagcacttat tggagtcagc ggatacagta ctttaaacaa aggactcagc     39540
     ccacttggat ctccggaggg cgcaacgccc ggcaccattg tcgatggcga aaaggcagcc     39600
     tgctcaatgt ctgagaagta gttttcgggc tattcgtcag aaaaagattg attagtctat     39660
     gaaccagaca acatcccaga taacactcac gttacggttt agggtcaatt taccaagtgg     39720
     tctgaggggg aagtctttgt ggggccaaac cttggtcata tcgaagatat tccagcggta     39780
     gttttcagcc tcttcgggct tcatgacttg agcatacaac gtccaagtag ggtagtcgcc     39840
     ccgctcgata gcatcccaca tatcggtcgt gtggaaatcg ggtgcttcgc cggcagtgcg     39900
     tacgccttcg gcctgcgtca tgcccttgac accttgattg gatttgaagt ggagtttgac     39960
     ataaacaaaa gagccgtcyt aaagaaagag tcaatgattc gctagttttg aaaaaatgag     40020
     gcacaaaccg atttggtgag cttgtaagtg tgaccactgt aggagttgat ttgccttagt     40080
     gaatacggca gccctcgatt gctaaaatac atcatgatgg catgagttcc ctcggggttg     40140
     ttgttgtgaa agctaaactg taagtatggt caccatgtcg tggatgtaaa acgaaacgca     40200
     ctcccagaac tgcataataa tcagctgggg caacaaacgt ggaagttcaa ccactcacca     40260
     tagaagagtc ggcggtatgc tttgcgggat gacgcttgtg agatcggtta acagagggga     40320
     atttgattgg gtctcggatg aagaacaccg gctagagaac ttcagcaccc atacaaccag     40380
     cacatggaga acggagtcgg ccacatacaa tgctgttgaa gacaaagtct tggttgccct     40440
     cttcagtgaa gatcttcatc gaccagcccc tcacatcccg aacagtctcg gctgtgccag     40500
     cctccggtcc cacagtggag atacgcataa gaaccttgga ctttttgcca atcccattga     40560
     ggaaagcagc cgaagtgatg tcggaattgt cgtgagttac ttcaaattcg ccccatgcac     40620
     caacggcaga agcatgcacg gtacgctcgg gaatgcgctc cctactgaag tgggccagag     40680
     tctcgatgag ctgggtgtcc tgcatcaaca tcaggccctt aacggggcaa ctgcccagac     40740
     gctgggcggt cgtagcatcc gcgatagggc atcctacact ggtcagcaac catagcgttt     40800
     tggctggaat gatccgacgg accttcggac agggtgtacg tcggtgtttt ctcagtcatg     40860
     attgattgct gatttcgtca aatcgccaaa tgtgtgattc aataaagttc tgaaaggaga     40920
     atatgtaccc aggtttaata tagaccgttt ccatcccatc tcgcaccgct gtcttgataa     40980
     aggggcatta tcattggctc gaagaaatat cttaggccct tccttgacgt caatgggctt     41040
     gcgttgttaa gacgagagtg attatcagct gcaaaattgc attgaaccgc tccacacccc     41100
     ttatcgcatc atattggctc gaagaaatat cacaggacct ttttttacgt gaacggacgt     41160
     acgctaaggc gagcgtgtgc tcagccacaa aactgaattg aacccgctcc agacctctta     41220
     tcgcccgggc ttaccaactt tcgagcgaga gatatcgcaa tctcgcacga gacgcgagag     41280
     tcgtccccac gcgagttatt ttcgacacga gcagtgcaga tttctgggct atatctttgc     41340
     tctcctagcc cggtggatat gctgcattta agggaagatc gagcgagagt atggaaaatc     41400
     gtttgtagat cgcttcttgt cccaagctgc acttcgtgat gtcaagagag ctaggagatg     41460
     accgtattag aactgggatg ccttgccggt ggatctgcat tggccgaagg aatatcacaa     41520
     gacctttttt tcgtcaatga gcgagaaata agacgagggt gtttccgcca caaaactgag     41580
     ttgaaccgct ccagacccct tacagcacgg acatgctgcg tttcagcgag agtatgtaag     41640
     aacgtttgtg ggaacgcttc tcttcccaag ttccaccccg taatgtcaag tgaactagga     41700
     gatgggtgta ttacaactgg gatggccggt cgatggatct gcattggctc gagggaatat     41760
     cacaggatct tcttttacat gaacggacgt acgctaagac gagggtgtac tcagccacaa     41820
     aactgaactg atccgctcca gaccccttac ccgcccgggc ttccaagttt cgagcgagag     41880
     atatcgtaat cttgcacgag acgcgtgggt tgtcccttcg cgagttattt tcgacacgag     41940
     cggtgcacat ttctgggtta tctgttgctc cgttagccca atgggcatgg cgcatccgag     42000
     cgaagattgc gaaggtcgag atagagtatg caaggacgtt tttagaacgc ttttcgtccc     42060
     aagttctgcc tgctgacgtc aagtgaacta gaagatggtc gtattaaagc tgggatgcca     42120
     ggtcgatgga tttcccattc cccccacagt ctttgcactt atacactatt attcatcagc     42180
     aatatggttc acgctgctac tcatcccaaa gatgctccca aaaactttga tttcatcgtt     42240
     cttggaggtg gtgccggtgg ttgtaccgtt gccggccgtc ttgccgagaa cccaaacgtg     42300
     tctgtacttc ttgtcgaggc cggtgtgaag tgagttttcc ctttcgtcct agcattagca     42360
     tccagactta cagtaaccag caacccttcc gagatcaccg acatcaccac cccggcgaag     42420
     gccatgggtc tgcgaaactc tcagtacgac tggaagtaca agacgaccat gatagaccga     42480
     ccagactata ctcgtatcga gaagcctaac acccgtggaa aggtgttggg cggcagtact     42540
     gcgctcaact attatacctg ggttcgaggt tcggccgcaa ccttcaacga ctgggaggag     42600
     tttggtggtt ccacttggaa ctgggaaaac accaaggaat acttcaacaa gtcgaccact     42660
     taccacgacg accttggtct cttccctgac gacattaaaa gcatcggcaa caagggtggt     42720
     cccgtcgaca tttctcactc tgatttggtc cccgagctga agccttggcg tgatgccctc     42780
     gaaagagcgt gggtgagcaa gggtcatgag ttgaccgtgg acgtctacaa tggtgtccag     42840
     aagggtctct tcaagtgtgt caactcgatc tacaagggtg tccgatctac tgcggctgcg     42900
     ttccttgagg gcaagcccaa catcaccttg gcctcttcga ccatctccaa gaagattatt     42960
     tttgagggca agactgccgt cggtgtcacc gttattgggc ccgacgaccg cgagtacgat     43020
     ttctacgcca accgtgaggt tatcgttgct cagggtgttt acgaatccgc caagatcctc     43080
     atgctgtccg gtatcggtat caagtccgac ctcgaggctc tcagcatcca atgcgttgtt     43140
     gactcaaagc atgtcggcca gaaccttcag gaccacccta tcctgtccca tgtcttcaag     43200
     attaaggacg gttttggcct cgataatcac ctccttcgcg cgggtgcgga gcacgatggt     43260
     gccatttcgt cctacaggaa gaatcacaat ggacccctca gttcgggtct actggagctc     43320
     gtcgccttcc ctcgtattga caatcgtctg gagaaccaca agcagtatcg cgattataag     43380
     gcgcagaacg gtggcaagga ccctttcggt cccgacggcc agccgcactt tgagatcgac     43440
     tttgtcgtaa gcctgccttt gcgtatacac agcgattcgc ggaacgaaag ctgaccccaa     43500
     cgtgacagcc gatgttcgcc gatgccttcc aatggcactt ccccactccg cccactggtg     43560
     attacatgac cgtcattgtt gacttgatgc gtcccatctc gcaaaacggt gtggtaaaac     43620
     tcacctcgac cgaccccttc gagcagcctt acatcaacct caacttcttc tcgcacgacc     43680
     ttgacctcat cgcccttcgg gaaggtgtcc gctttgttga cgatattctc ataaacggcg     43740
     agggcatgaa ggacattgtt gagggcgact acccctggcc gatgccccga aattcagacg     43800
     agggcatgat ccgacagatc ctggaaaggt cgcagaccgg tttccatccc tgcggaactg     43860
     ctcgtatcag caaggacatc gaccacggtg tcgtcagccc cgagctctcg gtccacggcg     43920
     tcaagaacct ccgtgttgct gacgcctcag tcttccctct tatccccgat tgccgtatcc     43980
     agaacgttgt gtacatggtc ggtgagaagg ctgctgattt catcaaggcc gcgcacccgg     44040
     acctttacaa agaggcaaag taaatgttgc gtgatgtcga aaggacgatc attgcgaagc     44100
     tgtagaatac ggaagatgta gactcggtta ggtatggaat ttgaaatggg acttgttaga     44160
     aggatgcaaa tcgtgactgt ttaactgtcc gcgactcctg atgcccagca gcgtgagaaa     44220
     tgccgatgag cttattataa ttatgtagtc ctaatcaggt tttattcttt ctcaacctgg     44280
     aacacatttg cctcccgcat ctaagtctac ctccgacttt catctctacc ttgccttctc     44340
     gattagcaca catcgacctt ctctccgacg cttctgactc tgaacatgaa ctccctctgc     44400
     cccttcaatc catcccttga cttcccggcg gcaaagcggt ccatcccgca ttgttagaaa     44460
     aagagtctag caggaacgcc tgatgggcgt gagagatgga tcgatagccg ccccgtttga     44520
     ggttgatggk tctccagggc atttggcaga tgatccgtgc gaggctattc ggggagctag     44580
     cagaggcacc gtgcaaagtg ctggagggca ataaggtacg cccgaagagc tagggtcgga     44640
     agagcatcat caaaatgatg gtgtgaaaga tgaggagtgc gccccgatgc cgaaaacagt     44700
     atccgtatca ccgcctattg atcgtccttc ccctttcagc gctttcgagc tcttcccatc     44760
     tccctcgcca tcctttcgtc tccaatgaca ccacaacctc gtggcaccaa gccttattcc     44820
     atctcgagtc ccttctttgg ctaatcaatg ttacaagtat tattaatagc cttcctcgtt     44880
     caccttcaga tcgtccaccc ggcgattagt tcccttcgcc attattcctc aactttgctc     44940
     aagctctggc ttccagcttg aatgcgcttc tgtcgttcaa agcttggaga gacggatgga     45000
     aagggcgagg tctgggccag ctgttaggat tgaaagaagt gttcggtaaa agccaaaccg     45060
     cattgaatgg tgatgccaaa gccaacaaga aagagtccga gttgaacgaa aagttgaagg     45120
     aggttgccga gaaggcatcg aagccgccga agaagagtct cctcgcactc ctcgtgcagg     45180
     tttcagtctt ccagacgata gccagcccta ttggattcct tgccttgagg catatctcat     45240
     atcctacaat ggttttgggc aaggtgagac cttcaccttc ctcaaatgca ccgtctattt     45300
     tgggtcttta gtcctgcagg ctcatccatt cttgttgctc aacgtcctcc tttatcgacg     45360
     aaagttctca cctcatatac ttgtcttggt gattgtcaag tgagttaaca ttactcataa     45420
     catatacatc gcattgtaag gaacaaaggt tatcgtctat ttctttcgac ctgaatgaga     45480
     agggttgttc cacagccctg ccaacaagat aagaccttgc actactatca ataggaccat     45540
     tgaagctaac gctctgtgtg cgttgtgagt tgatcagtca gttgttgcct ctctgttcag     45600
     ctagagaact cacaagcccc agccaacacc tatctttcct ttccatccat ctcggatatc     45660
     acccgctcct actgcagcaa tgataatgcc tggtagtccc catgctaaaa tgccaatcac     45720
     tgcaaacagt ctcaaccata cattcctcaa ctgcacagca cagaaagtac gcatcttcat     45780
     gtcagatggg ggccaaaaga ggatcggttc ccgggtggat ggctgagtac gggcatggaa     45840
     atggattgta agaagtaaga gaaagaaaat gctgacagct atggttaatt ctgtgtgcct     45900
     tgttagcgcc aaccgatagg gcacgaggtg aaaaaaaaaa cttgcggaat acgaagaaga     45960
     aagatgcgat ggataacgac ttcgtgacag atctattgaa acgtactgag ctcaatctcg     46020
     caacccatta atctacaact caccccggca aattcaaaga ctgaaccacc gaatcacttc     46080
     ccgtatcccc aggtatccgc caaaaactct ttttcacaca gtcccctcca ttcaccccgt     46140
     ctgcccaact acaccaaccc caaatcccga acccgtatgt ctccccactc ctcccgctct     46200
     cgggcgagac ggtgacgagc cacatacggc catggagatt tgatttgtca gaggctgaga     46260
     atgggacatt gtaaaggatc accaggaaga ggaggattgc agatacagag gtgaggatga     46320
     ttgagacaat gtgtgctatc ggggaagttt gactgtcggc tttttctgtc atggtttcgt     46380
     caatgttgat tgcatgaaca aaactagaat agcttggaga gaaacaagtg ttagtgcaac     46440
     agctgtgatg ttttggcaga aaggaaagac agcctcggtc cctcatgtta ggagagtcaa     46500
     aggagtttgc caacctttca tcaacagttt gcaaaagaaa tggtgacgaa agtgtcactg     46560
     gaaaggaatc agttgtgttc atgagcatcg acggcatagc gggctccatg aactaatata     46620
     gtcaactttt gtgatcgtgc attatgtggt acaaccttgg caatctagca aactgaatac     46680
     ctgtcgtcga tttggtgcaa tcatctagcc tttggagtat ttggtccttt ccttaccttc     46740
     acgtcgcatg atgatgcctg tcttccacat gcaaagcatc tgtgaacaaa tccaacatgc     46800
     ccatgctgca aaaaagctgg agaaaaatca gcatctcgat ttgagcttct ctaaatgacg     46860
     agctactcac actccaaacc cggttccggg ccgtgccttc aagccccctc cctcagtatt     46920
     cacttttccc cttccaacca aaacagtcac aatcatactc aatcccagaa ccaacatggc     46980
     aaggaaatag tagagattga aacgccagtc gcgtaggagc caggcacaac gggtacggta     47040
     atgtttgact tctgctggat atttgcttgg gacgggccaa ggggggtaag gtccggggaa     47100
     tagaatggca aggcacagaa tgataaagta ggaaaggacc acaaaggggg ctaaggtgcc     47160
     ttagctcata ctgagatatt gggtgatcag aggggtacct actgatgagg atgggtatgg     47220
     cagcacctga caggacatgg gtgacagcac tagacaaaaa agtttgcaaa atacgaatta     47280
     atagtgtgaa agatcactca ctaaggtaac tctagttcat aaatggaatc ccaactgctg     47340
     tctgagtcgt ctggcagttt gtaaccagtc ttcctcgtac aaaccgcgtc acccgtccat     47400
     ctggagtttg tccattcaca ccatccccag atcccaaacc cataagcgtg aagcccccca     47460
     tcaccaccag aacccgtatc tgccgccctt tctttatttc tagccggtgc tgctaatcct     47520
     atccctcttc ctggcacctc tccttctcca gcatcgtagt accttttggt gcctattgtc     47580
     caggtaggaa aacttgatga cgtttcgttg acagtcaaga accacatcct gaggccaacc     47640
     ttaccctcca gcgttgagtg ggcatggtca atcggagcat tgtagaagac gacgaccatg     47700
     agtaagatga acgatattag ggtaagtagg agggagaaag agtgccacaa tgggttaaaa     47760
     cgcattccat cggaagaccg gaacaatccc atgatgatcc agcacttttg ttttcgtttt     47820
     gtttggatcg agagatgtct tcgctatcgt agcggttcct gatcaatcaa ctgatttact     47880
     gtaagaaggt gcaagtgaat aatctggata gaaaatagtc agtcatggtt ataccacatt     47940
     ggctacagcc ccggtactct cattgaagtt tcagagatgt aggtactaga aaaaaggatt     48000
     atcaaaggac tagttagccc atgttgatgc cgccaaaaag gatcttggat ctctgagcaa     48060
     gagcgcggtc gtcttgactt gtttgtttgt tgtgcaatcc cataaccagg gtttttaaat     48120
     ggaagacaaa tgtagatctg gcctcgcctc tgttagactg attgacagtt tctaaaaacc     48180
     gtgaggatga gcttgaacta gccgcatcac agggttcgat ggcgacttac tctattgtat     48240
     taacttattc cttccattgc tctgtattgc ttgttgtaca acgaaacaga ctgaaggctt     48300
     gctcaatttc ttccctcatg gttcatatct tacgcatacc aagcgcatgt ccaacaaaat     48360
     tgccaaggga ggatgcttct cgtcgcaatc cacccgaaaa cactaaaaac cgtcttcagc     48420
     aggaaggaga taactttttc ccgcctgcca agttatcgca ctcggcaagg acgcgggact     48480
     gttatttttt gttacggact gtttaaaaat gtaatgatag tccggatctg tttttatggt     48540
     gcctgggatt ttttggatga tgacgtcggt cgtgttgtgg gaaaggtgac ggcgggtagg     48600
     gacggggact ggcctgtggg ctgctgcttt tgtcgtcaat tgcctataaa taatctagcc     48660
     cgcatgtgca cttcccagca gtctcgtaaa cgtgtgatag cctcttacaa cgtcggaaag     48720
     ggttttaata caaacacagc aaaccgcgta ttaagtcttc atttcaatcg cctccgtcat     48780
     cctcttctct cttgctagga aagataggtg agctatataa agcacagata acatcgcaga     48840
     ttcagtacct gaccgcacag acttcccaga acgaacatca tggccctctc tcaacacgta     48900
     gacgccgaca agctcattga agagtgcaaa gaccacccta tcaagaggca ccttagtcat     48960
     aagtaggtgt atcggccatg aacatagcca tttcgtgact aatttctgcg cagggctgct     49020
     ctttatgata ttccctacac ttcccgctac gaagttgagg acgaggttcc gagatacagg     49080
     ctccccagta agggtgtcaa tggcagggct acataccagc tcttacacga tgagctgatg     49140
     cttggtgagt tttcatcatt attttttaga gttaaaggct gactgggaac tagatgggaa     49200
     ccccaacatg aatttggctt cgtgagtttt tcgcaccatt tgcaaacgat cttgagtcgg     49260
     ggaatactga tcaatgagat atacagattt gttcacactt gggttcctga tgagtgcaac     49320
     cgtcttgtcc aggaaaacat caataagaat ctggtcgacc aggacgaata ccctgctgct     49380
     caacagattc acgagcgatg tatcgtaagc tacagcagcc gcgacgaatg actccagctg     49440
     acccatgtgg tcagtcaatg ctctctcacc tctggcacgc tcccaaagaa gccacggcta     49500
     tgggcaccgc tactaccggt tcctctgaag ccatcatgct tggcggtctc gctctcaagc     49560
     gccgatggca ggaaaagatg aaagccgctg ggaaagatat ccacaacccc ggacctaaca     49620
     tcgttatggg tgcagaggct caagtagctt tggagaagtt tgctagatac tttgaggttg     49680
     aggcgagact tgtgcctatt aagcctgagg tgagtaaacg ccacgaaaga agaatgagtt     49740
     aaaggctgtg agttaaaggc tgatggaagt agtcgagtta tgtaatggac cccaaggacg     49800
     tcctcaaata cgtcgatgag aacacaattg gtgtctttgt gtaagtttta attttatttt     49860
     atttccgggt acaccaagtt gaccttttac agtatcttgg gatcaactta caccggcgcg     49920
     tttgaatccg taaaagacgt ggctcaagag ctcgacaaat acgaggccga gacaggtatt     49980
     agtgtcccta tccacgttga tgccgcttct ggtggttttg ttgcgtaagt ttagaatgac     50040
     tcatacggtc gtttcgaaat taacggttct ggaagtccat ttgcataccc tcattaccag     50100
     tgggacttcc aaattcctcg agtccatagg tgagaagctg ttaaaagaag agaaataatt     50160
     gctgaaaagc gggatagtat caatgcctcg ggtcacaagt acggtatgag cactgtgggt     50220
     gtcggatgga tcatctggag gtctatggag taccttccta aggagttgat ctttgagctt     50280
     cactatctcg gtgctgtaaa taaagtccta attttttatt ttaatcattc taactccggt     50340
     tctgtagacc gattattcat ttaatctcaa tttcagtaga ccggcacacc ctatcctcgc     50400
     ccagatgttc acttgtaagt ccggatgaag gcgggtggac cttgcagcta attctatcat     50460
     agtcttgaac ctcggtttcg aaggttacaa gcgtataatg gacaagaacc tcaccgtagc     50520
     tcgtctcatc tcccgagccc tcgagcactc tggctacttc atttgtctct ccaagatcca     50580
     ccaccccaag gctcttaccg aatcctccag cagcgccgaa caatccaaca tcctccctgc     50640
     cgtcgccgac gccgctaata ccgttttgca cggcaagaag actactgttg acgatgccga     50700
     gtattattgc gagggtttgc ccgttgtgtc gtttatgttt acggacgaaa ttaagaagaa     50760
     gtaccctggt gtgaagcagg cgtggatcca gatgcagctg aggtctatcg gctggatcgt     50820
     ccccaagtaa gtccggattt ttttggggca attgtggacc cagtattgac ttgtcacagc     50880
     taccctctcg ctcccgactg cgagaaaact gagatcctcc gagtcgtcgt ccgagagtcc     50940
     ctttctggtg acttggcgag gaagctcatc cacgacattc ttcaggtgta cgtcctcatc     51000
     ggttttcctt gttttaaagt tcgtgctgat tttttcatgg ctttacagaa ccgaagatct     51060
     cctaaatgac gctggacctt catactccat gtctactgct accaggcgtc acgagaattt     51120
     ggaccacggc aagctggata atattgatgc tgtccacatc aaggtgcgta tctgccctgt     51180
     cggcattttc agtctcgcgg gttagtcact aacatgatat gatttagcaa cacacttcca     51240
     cctattctaa gccctgttag agaaaccttg ttagagtatg ttaatgaaga agtagtccgg     51300
     tggatgggag aagatcttgt acagagaaag cgtaacaaat gactttttac tcggcttttt     51360
     gcgattagtc tggtttggat atgcaaaaat tggagcgtta tgctaagttg cgataagacc     51420
     gaaggaaaca aggtaatcga aagattagta gagggaatga acgacggacg ggaataatcc     51480
     aatggataag ttgtatatga cttacacccg gcaagacgga gaggcgtgcc tatgcgaaaa     51540
     gccatttcaa ctcatttcca caggcacgct tacagaagcc ccatcctcgc ttccctcgct     51600
     tcccatcatt tgattctgtt tcatttccaa aaacaggtgg cgattcgcgg tgctgaagtg     51660
     ttcttccgtc atcttactat cgccatcaaa gagttcctgc tctcgtttct gaatccgccc     51720
     cccctttgta ctccgccatt cacccttcac tcttaaccac gtctcccgcc ttcatccgcg     51780
     gctagccgat ctagtcgcct tccatcgatc gatcgcccaa tcttcctctt tgccgccttc     51840
     ttttcccagt cgcttcacgc cacttcattt ttctgttttg ctttgtttcc ttactcgatt     51900
     tcttcaccat acaccaactc tgcgtcagtt catcaatatt ttcttaaccc acgcataagt     51960
     ctccgaaata tcaactttat aatgcagccc aagcgaacgg cggaaacccg caactctact     52020
     acgaaacgag ctcgaaccgt ccaaagcggg aaagacgaga ctgctgatcc tccagtcgcc     52080
     gttgcggaag acattcggtc tattgactcc agactcaagg gcagagcgaa agggaggaag     52140
     gggaaaaaca aagcggaagg cacatctgat tctccacctc ctggtccgaa gaagcgggtg     52200
     cgcaaacctt tcgcagcaaa ggaagccaca tggagggata ttcccgattg gggggatagg     52260
     accgacgtac cgctgttcag gctcccagcg gaagtgcttg acctgtgttt tgggaccaag     52320
     ctcaatttgg gactacaggt aggtggaggt attgtgatga cgaggagctt ctgaaagcca     52380
     tcggctgatc cgtgtattgg atgacagcta cgagactatg tggctttagc tggagtatca     52440
     aggtacttca ggtttcattt tacggacgac gtgttccgag tgagtataat tctgatctta     52500
     ttcttgtctg tgtgctgacg agattatgcc aggaaatcta cctcaagtcc catcccaatt     52560
     acatgaagct ccgcccttgt gcccgtcgat cccctatcaa acactcccag ctcatcttca     52620
     ctcgtgctgt aaaagattgg cgtcaagatc cccctctcaa aagatttgac cacctcgaaa     52680
     ttcatatgcg ttccattcct ccccgtgaag agtggacaca gaaggattac gagtttgtaa     52740
     ttcgagccga taagataatt gcccaagcga gacagatctg ggcggacgct agggccgaaa     52800
     gggcgaacat caagaaggag aagatgaaga aaaggagagt gttgaggaag gtcattgtgg     52860
     acggtatttc acgaactgta cttgcgacag tacctggctt aaagcacggg gagactcagg     52920
     ggccgaagaa tgagttgggg gttccgataa tgacggatga gaacgggaag gaaattggtc     52980
     tgggtgcaag ccatgcagag gaagggaatg atggtcatga tgatgatgat gatgaagaat     53040
     ccgacgacga gcttaatttc tactcaactt tgcaagaatg ggaatgggaa gaatctgttc     53100
     acaataagga tggtgaacta tggcaaaaga tttacaaact ggaagacaaa atgagattgt     53160
     tgaggaggac gtatgataac tacgacaagg gcgaggattt cagcgatctt tcaagcgaag     53220
     acgaagcaga cgaaggcaag gaaggcgaca ggtcaacgcg caagaagggc aaaaagaagc     53280
     aaaccaaaaa gtttgttcgg gatccaaact gggtcttgcc tcccgaggaa aaaccaaaga     53340
     gaccccatgc aaccttggtc gagtatgatc cattgacggg agagagactg ccccatgacg     53400
     catatccaag cccatggaga gctagagctg ttgaagctgc aaataagaaa ttcatcaacc     53460
     gagcagtgag tacaaccgcg tcaagatagg ggcaacggta gctgataatg tgagaaggat     53520
     gcaataaggg tgttcaaagt aggagaagca gagctgttat gcttgaagca ctaccttgtg     53580
     gtgagtgaat ttttgttcgg gctcatgtat cgtgctgatt agatttcagc cgaatccctt     53640
     gaatcctaaa actccatcga gcatgtaagt gtagagactt cctaacgata atcgtagttg     53700
     actcagcaaa acagttactc ccttgcggcc atccaagctc ttgctcttcg ttctcatggc     53760
     ggtcctattg gccatcatta ccatgtgtaa gcatcaattc catactaata catgactgtt     53820
     cttactagac ttggccttta gtgaatctgc caatgaaaga gccttgaagt ctctagccac     53880
     ccgacaagcc aatgcggcca aacgcaaagc cgatcccact tacgttgaaa aagaaccgaa     53940
     atcgaggcaa tacccccaga ctaccgttga tcctgatgat attggcgcca agtatggagt     54000
     ggacaaggat tgcgggatct ggcattatca aggcacgttc atcgatttcg tcgctgattg     54060
     gagggagcac agggcggcca aagccgcgag gaaagctcag cgcgttgcca atggagaggg     54120
     ttctgagact tctgatgaag acggctcttc tcaagatgag ctgcttcctg ttccaaacgt     54180
     cccttggaat gatgttaatg aatacatgta ttcatttact gatgaagagg atgatctctg     54240
     gtagttatgt ataggatata agctatttgt ttgtataccc aaagggttcc gtgtaaatct     54300
     tattgttgga ccttttcaat gcatgcaatt atgtcgcaga gtggacattc attgagttag     54360
     aatggatgga tggatgatgc atacttgcgc acggaacgtg atgtgccaca ttgattttcg     54420
     tcgcggagaa ataaaacgcg atctttgtga tttttgccac ttgcggaaat gacgtgtgaa     54480
     ctttcctcaa gcgtgggtgt cttccgttga ttttccccaa gcagcacttt tccttttact     54540
     ttctccatcc cgcgattcgc cttctgccta ccggcataca ccccgttacc tcactggtta     54600
     gcctggcacc gcaagcgcca atgcaagcct caacaccgtc gccgactact atacagacac     54660
     cgacgctgtc tttccccgat accccacaga tggacgagac cccgaagacg gccgtattgc     54720
     gtactcctcg agcgactttc gatggtggtg aggtcagaat agaaggaagc gtctctggga     54780
     gcgaaagagg gagcattgat atgggtacag cgaatggaga aaggaaagac aagggaaagg     54840
     aaagagcagt tgagagtgcg gaagataagg atgaagaaga gactggattc gacatggaac     54900
     agctcacaag attacagtca agagtgaacg agttggaggc caatggaaag acaggggatg     54960
     agtgggtgca aagagatgag ctactgggaa tggtgggtta tcaatcactc gcattattca     55020
     aaggatgatt gccaactaac ttcgaaatca ggtcaagact cttttaccgc ttactctcaa     55080
     tcatttgcca tttctgcaag agcgtttagc agcgcagaaa agcactattg cgaccatgca     55140
     gcaacaggcc aaaatttcgg aacagctcat ggctaccgag cgagaacgac atgctgtcga     55200
     gagagattca tggcataaag agatgcgggc agtcatggtt tcaaaagagg aggaaaaagt     55260
     ttcaaacaaa cgaaaagtat tggatttgga tgttggttat cacaaggagc tcgaagcggc     55320
     gaacaagaga ctggaaatgg acaacagatt gatggcaccc agagtacgtt tggtcagtca     55380
     tccgatggct agagctgatt ttcccctagt tggttgacac ccaaagacaa atcgaccgac     55440
     ttgtcaacga actccgtctt cttagaccgc atgtcattct taacacctca gctcttactt     55500
     ccaagcctac agaattaaca cccgcaactt ctgcgccgcc cgtttttctc cctcagtata     55560
     tgcctcagct cgaaaatagc aagggtattc atcgatctag ccgtgcgact atgggggacg     55620
     ccagaactga acatcttctg ttagctgcca aggctatccg aagcatgcgc aagaccaacg     55680
     accgattagg ccgtttaacc atgggcgagc tgaagaaagc tggcgttgtt ggtccagagg     55740
     gaggaatggg ttacaaggaa ggctatggcg aacaaccaat gtcggatgtc gaggaggatg     55800
     ctagtgagga ggagccgctc atcgatcagc gagctagcgg gtccgtaacc aagggtaaaa     55860
     gcaaatccca ggccacacca cttctctctc gtaccaagcg aagtaccaag aagaatgtgc     55920
     aaaatgccag tataagcacc attccgcaaa ctccctctaa atcccgtacg accgggcagt     55980
     catccttacc tcaaacgacg cctggtggta gcaactttaa cgacctcctt cgtgctgccg     56040
     agatggcgac tcgtccaaac tcacctgtac atggagaacc catcttatcg actctttcag     56100
     ctacaagaag tacaactcgc ccaagaccgg atagcagtga tattgaacga gggagtccga     56160
     agagacggcg aggtgatgtg tggraaggtg gcgggtctca caaggcgcat cagcattcgg     56220
     cttcagcagg atcggcttcc gcgctcgact tattagcaca agcaagccag ctagatgtcg     56280
     ctagctctac cgctcccagc tccgtagtgc aaagcagtcc tgccgttcct ctcacatctt     56340
     ctactcccca atttggcgga ttgctcgaga aggactccag tccaagaagc catggttcaa     56400
     gtctgggcgc acctatcgac ctcactcctc gaaatcgaac aatggccaac gttcgtttga     56460
     aggcccaccc tgcatcagac gattttgtgg ttgatccctc attacaaacc cccactcacc     56520
     gcatacgggg ttcatctaca acttccgaat ccctaactcc tgccagaggc tacgcctcta     56580
     gtcaaattta cccaactccc ggtggcgagc ttgatgagcg gttacctccg gcaggtgcct     56640
     cttcctctgc gataaatcct acatctactc ccggcgttat ctctgaaggc ggcggtggtc     56700
     ccggtgccgg aaacggaaac tttgcgagtc catctggtaa ggtcgtgccc ggtcttggca     56760
     agtactggca ttacactagc gaaatgccga tcaagagggt caggtcacca tacttgaagt     56820
     ggactgtaga agaggatgag ctactagcca gggctgtagc gatacatggt gaaaagtggg     56880
     atttggtcag taaaggtgta cctacgagaa gttatcacca agttcgacaa aggtgagtct     56940
     tttagtcaat cggcttcgtg gcaaatatgc tgatgattgt tatagatggt taagaaaaac     57000
     tggagccttt gacaagaaaa atcaagctgc caaagcggag cgggaagcca agaccgaaag     57060
     tgccaacgag gccaaatctt caagcacaga gagagaagtg tagcgacatt gcaatcatat     57120
     attttaaaag agagtagttt gtgccgaggt tcatctagca ttttgggttc tttttgaata     57180
     tgtgcgaacg tgtcttgtag agtaaagcga caagttttga gctgtaattt ctcttgtata     57240
     gcatatttgg agctttcttg caattttata gcatgtgaag cagctggaac ccttgagttt     57300
     tcggactctt ctgtctttgc gctttcgatg catagtgctt tagatcttcc cttctgggtg     57360
     acgagcattc gtaagccatt tacagcggcg agtttctgga ggtctacgtc ggtttgagcc     57420
     attgactggt tccagcattc ggtctgcttc atcagcctac tttgaatctc acaactacta     57480
     taggagttac aggagttcca accttagctc tgctatattg cgcatctcct acttggatgt     57540
     tcgtaatcgg taggcttacc cgccgtcctt gctcggatca tcttgaggtt gaaagagagc     57600
     gtggtattat ctgagttttc tagcgtgtct gtctatgcta gtgcatcaaa aatgatgtat     57660
     ggctcagctt ggtagttaat ttaatcaaat ttcaacgtac atgaacctgt aatgacccag     57720
     gggcccaccg tgcgatcgca aggtaagagc ctccacggcc attcgaggat acctacgtga     57780
     cgacaatatt aataagtgaa ttggagcagt ttattctgga ttgaccaaca gtacgagatc     57840
     ctgtccaagt aaaaatcagc tatcaagact aaaggtactg gaccaaattg ctacagaaga     57900
     cgacccacag ttttttccca aagggcacca tgataatgtt tgagaccata taattcctct     57960
     ttggtaactc cgtaaacttc gatagcatcc tgtaaataga tacaattacg ttaaaaagga     58020
     actttttgcg acgacaagtt tggcaactca catcttcagc aacagcgtga gagttgatgt     58080
     tacgcgcaat cgtccttctc acatggcttg gccaatggtc gtgcggttcc ggctcaagaa     58140
     cgtactcgag aaatttcaaa gcaagagcct ccctttctgg atctccgggg agtggtacaa     58200
     cccagccatc gtccgattcc ggttcatcct tcgtctcctc cccttccttt ctcttttcat     58260
     acgcttcccg actatcacga gcttttatgg ccagcgtgcg gagcatcata agttcaagtt     58320
     tttcttggtt ctccgggact tcggagttga tctcgtcgtt ctttccttca gctgtatcct     58380
     cgttatctcc atcgtaacca tcaagcccat cttccgtctc atttcccagt tcgtcatcat     58440
     ttacgagttt ctgtaggtca tcagtgtcat acccactgtc gtcactactg gacaggtcta     58500
     atttagtatc tacacgttta gcaggctccc ctggccgact gctttgtttc cgcctatatc     58560
     tctttcgtct tcgcctccgt aatatctcct cagctttgcg gttccagaaa tcggactcgt     58620
     acgttacgtg atagttttcg acgattgtct tccacttgtt gagttctggy tcatcctcat     58680
     caatctccgt atccatgctc cagtctgagc aacaaggata aatactcttg tccaggacat     58740
     ccgcatggag acaagtggga tcttttgggt catatgtttc accgtctttg agcccaggaa     58800
     cagtactcga gtagtaaata ctcttgtctc ccatagtatt tgaatgagta taactaacgt     58860
     tgccgatcca tttgtttgtt cccccggagg ggcatcgatg gatctctcct cggaggtaca     58920
     taaccatata ccggcttcga taaaactttt gaagagctgt gtggtattcg tattcggcgc     58980
     gagtccattg gtcgtgaggc atagaagcga tatatatgga ttcactgatc tttggaaggg     59040
     gtttctcttc tctccagtct tcgacgtggg tggaaaatat gtgttctgcg tgtttatcta     59100
     aagattcccg acagtcacca gtgacgtgga gaaaaatcgc ctgcgtagca tagtggagaa     59160
     tgtaaggatt gatgaagttg aggttgtagt gaggagacga aaagactcac caggaacact     59220
     tcagaagtga attgctgtcg gaaatatcta gagacggcag ctagggctat gtattctcgt     59280
     agctatcgaa aacgcttatt atcagccagc tgattttcct tagcccacta ttcgttgaat     59340
     gacaacatac cgaaagatca ttgtcaagtt cagtaccaaa gcacaagtcc agtatttccg     59400
     gaggaagttt gaaaagggga cagtctgtac gatctcccca gtctggtata tcatgccaaa     59460
     ctggtctctt cgcgacgatc gtagccctct cagccagtag ttgtgacctt ttcttcaaat     59520
     gtgcccgtct ctgttcgatc cggcgttcct tttgctcctt gcgcttcaac ttccggagct     59580
     cttttccagg agtcacatac tctaaaccct tttgagcata tggattgggt atacgatgga     59640
     aatgatcgaa tacttaccgg tcgcatcatg tcagtactgc ctgtcttcag tgttaacaac     59700
     aaagactcac gagagggctg cctgaaggtg gaagtcatct ttgggtttta atatcatcaa     59760
     tctagacgat gatgttggga atctggaaag gaaggctaaa gtgatgtgca aataatcggc     59820
     gtcgcgtcgg catcggatat ctcaccatgt gataagcaga aatcggacaa agataagcat     59880
     ttgtgaggcc cgggcattcc tcgctgtctg atggcacctc gatcctgacc tacgcgacgc     59940
     gtttctattt acgtaatacg ggtggaaaag ggcgccgaga ttacagttag taaccgcata     60000
     gaaaacaata ggtaactgtg aagaaggttt catgttccat cctgatctgc gcgtcccttt     60060
     cacggtcatc acccaatttt cattcgccgc ccgccaagaa tgccgtcttg gcaagcacag     60120
     catgtaaaca atgggcggat gaaacgcaaa aggacgcacg ggccgacggc caagtggcag     60180
     aagaagctgg cgcctggttt tgcatgctca acaaacaaag gatgttgtcg tataccatgt     60240
     tctcgctgat ttcgttccat tatttattcc aacgcccgac cgataataac tcacagcctc     60300
     tatctttgct ccatcatcct gccactcttt ttcaatccac actcatttat tcacaagagg     60360
     tgcacaatgc ctgtcctttc aaaacttatc tcactcctcc cactcctcgc catcgctcag     60420
     ggagctacca gcgacgaatg gcgatcaaga tctatctatc agtgagcacg tcgctctcca     60480
     gcaaggcccg tattaaccct cgagcagact tattactgac cgtttcgcac ctccttctga     60540
     cgacacaaca tgtccgttag gcgctactaa ctactgcggt ggtacatggc aaaccatcat     60600
     ctcgaagcta gactatatcc agaatatggg atttgatgcc atctggatca gtcctaccgc     60660
     tctcaacatt gaaggtaata ctaagtatgg cgaagcttac cacgtaagta tccgacaagt     60720
     ttcaatactt gcgtccccca gcaagcagta atgacattca gctgtaggga tactggacag     60780
     cagacccgac taaactcaac ccccatttcg gccaagcttc cgatctcaaa gccctctcgg     60840
     ttgcggtcca cgaccgagga atgtacctca tggtcgacat tgctattaac gctcttgcag     60900
     ccacttccta ctctctcgat gcctctgcac tcgcttcaga tgccgatggt acccttctct     60960
     tcaaggaccc ttccgatttc cacacacgat gtgatatcag ctggggaaac cacacttccg     61020
     agcaagtctg ctggcttgtg acaggagatg acaacgggga tgtggcgctg cttgatctca     61080
     aaactgaaag cgactctgtc gctagcgtac tcaaggactg ggttggtggg tatgtcaccg     61140
     agtacgggat agatggtttc agaattgatg cgagcaagca tatgagcaaa gaattccagc     61200
     acgatttctg cgaggccgcc ggcacgttct gcatgggtga agtcgcaggt gacaacaccg     61260
     agtaagtctt acgaatgata tctagcttga tactaaagct gaccactggc agatacgcgg     61320
     gggaatacca aagtgctggt ggcattgact ctgtttgtgg tttcggcctc atgtacggct     61380
     ttgtcaacgt tttcaccggt ggcgacaaaa tgtccaccct cgaatactac atcaacctcg     61440
     ccgcctcatc ctatcctgat cctacagtca ttggcacatt cctcgacaac caagatcttc     61500
     ctcgattcaa ttctcttaca tctgacgctt cactcgttta caacgctatt gtcggtatgt     61560
     tcatgtacgg cggtatgccg attgtgtatt acggtttgga gcaagacatc tccgatggtc     61620
     ctacggaccc tcagaatcgg gaggcgcttt ggaattacaa taattatgcc actgatgggg     61680
     ttacctttgg gaggatcaca aacctcaata acattaggaa taggttgggc ggtgttggtg     61740
     agctgtataa tgctgttgct acagttcttg ccattcagga tcaggacatt gcccttcagc     61800
     gagaagaggc tttgattgtc ttgactaatg tgagtgatta tttgtgtacc tttccctatt     61860
     actttgttga tgatccatgt tagcggggcc agtctggtac cggcacttgg gctatcaaaa     61920
     acacccaatt tggcggctct gtctctgtca tcgagtaagc ctatttccgc tctttgtgtt     61980
     catatacatt gctcaccaac tattagtctt ctttcgtgct ctacttctac tactgacagc     62040
     gatggttctc ttaccgtcac atggacttcc ggccagcctt tcgtaagacg gcttcttctt     62100
     ctctgctcaa cgacatttcg atgatagcta atggtttgtg caggtatttg tcgcctctga     62160
     tgttgccgat aaggccggat tatgtggctc tttatccaac agcactaacg ctactactgt     62220
     ctcctcatct tcctctgctt ccacctctat cgacactgcc accagtagtg ccagtataag     62280
     tggcaacctc gccgtcatca ctgatggctc ctcctctccc tctttctctg caacaagctc     62340
     agccctctct tcaagcatta gctggtacac ccccaccagt gctgccagtt ccgtctcgag     62400
     ttccgagttg gtagtcgtcg ttgctgccgt gtcaactgca agcactgctg tgacttctag     62460
     cggaagcatt tgtcgcaggt caaagaagag ggctatgagc aagaggcaat tgtaaggctt     62520
     tcaattcggg aggctgttgg gtcagagtgt aatagtgatg ggaggtgatc aagaggatta     62580
     tggacacaag gcctgcctat ggaacgaacg atcataatta tcagcctttc aatcataatt     62640
     atcaactatt aatttattgt gaggacgatc tataaatcac ggacatatga atcaacccat     62700
     ttttgtacaa taggtgctta tattaacagt agatgagtta tcagcggaac cgtctttacg     62760
     acctgtagtg ctatgctgga tactaagact tggatcctat gcataatctc tcatttcatt     62820
     tcgttatcaa gcaatagagc aaattcccat gtttccgttt ctgttccatt tttcagatgc     62880
     aatttcgaag attgaagatc cttcaaaggt tcgtatggta cgtgacctac ggagtgatct     62940
     actttttgtc accgccggca ttgttaccgt agtaattgct tgactggccg gagggggaag     63000
     tgtatttggc gtacccatca cctgaaaagt tttcagaatt caagtacctt aaacaatcag     63060
     aaggacatgg cgtaccactg ttgtagtagg tagagccgtt agtgttgttg tagtagtagc     63120
     taccattagt gctagggaga gggattagtt gtcagcacaa gcctgcgcga gagggccttg     63180
     ctctgttacc gtgacaatga tacatggaat acggtcgaac gggatgggat aagagataga     63240
     gagaaaggag agaacgatac ttacttggag tagtggtagc ctgtctggcc agtggcggtg     63300
     tcaactcgac tgtcatagcg gttaccctta tgcaccatca ccgtcagtag gtgccgattc     63360
     atgagtgaag ttctgccagg tgaaccgagc gactatataa gagagcttac ctgtgagttg     63420
     gtacccctgt agtagatgga gtcgttgccg ggcattatta atcggttctg ttgcgagaag     63480
     atggaaagga taggatgtat ctttgttgga ctctaaaggg agagttgttc ttatgatgat     63540
     tgtttatgta agtgggaagt gatggccaaa tgtggcgtag ccgccagggg gcaggaggta     63600
     aaaggggtgt ggggcttgct ttaaggagat gggaaacaaa tgacagctca aaactcatca     63660
     aatctggacc caacaaagaa cgtaagaacg ggtgttaatt atcactaatg ggctttgata     63720
     agggcctgcc ggtttgaccg atggtcggtc tacattcaca taacttccca gggccttact     63780
     tggatctccg atgcattaac ccaagaaccc tgcatatggc tggtaatact cacatctaaa     63840
     taatagaatg atttatagga aaaggcgaag ccaaaagtcc gtcatcacta cgagtactat     63900
     tcctgaaagg gtttacgctc ccgaaacaaa accaagtaag ctcgatcgaa catcggcgat     63960
     gaactgcagc ttcatttgtt cgcgaaaacg ggagaacaga tcttccttta tcctgtttta     64020
     tgttacatat ttcatgggag acaacaacaa taccggtcga taataacctt ttgaccttgt     64080
     tcttaaatac acataataat aatatccgat cgatcacaac ttcctaattt tatcttccgt     64140
     tgaacaccaa ggattcaaca gcatttatta gactccaccc atcaaccaag gctccaccca     64200
     tcaaccaagg tcaatccacc gtcgtaactg atggtggatc tcaagctaat taatgatctt     64260
     taggcgtcaa attcccaatt ggaactcgga aaaaaccggt atcggccgtc acgagttccg     64320
     ccaggcttgt ataagctccg aagatggccg tgatctgcga tttaattatc agcaaaacat     64380
     gacaagagtg atgatgatag tgatgtgaaa agaagttttg gcaaaagcta cgacttacga     64440
     taccgatagc accgccagtt ttgatacatt tcgggctctc tgaaagatat ccagctgacc     64500
     tatcatccgc tcatcagtaa acgcctctcc catttagcca tcgatcggta gtggcgcgat     64560
     atccaactca caagataaaa aagttgagac tcaatgcccc aaaaatacaa atcaatacca     64620
     ccgacgacct gtgactagcg atgaggaaaa ggacggtgac tatgccccaa acgcagaggt     64680
     agaggcccaa ggcgttttcg agcatcgctg gattttcagc gtaggccgcg gccacaccaa     64740
     attgggggat atacaaagct agaagagggg ttacgggctt tgaagcggag caggaaacat     64800
     ggaacgtact tgataaggaa agccagaatg cgccgtacga gctgaacgtt acggcctgtc     64860
     tcgtcagaaa ataaacattt tcagctctct ttctttgcct gcacagagct ttctgagcaa     64920
     ggtgatgaaa catacgccaa acgtattccc gcatgcccat tccaggatcc ctgcaataat     64980
     ctgtcctagc ccgccaaatc cgagagcgat accaagaatc atattcggtt tggtgacacc     65040
     tcgagcttgg acggtgtaca agtttaaaag aaatgctcca cctacaaacc taaaagaggc     65100
     aaaacgatga tttttaacaa tcattgtgtt gagctatatg agtgtctgac actcacggaa     65160
     taaggcctac aggtgcaggg gttccaaact tccggtgaaa tactgggaac ccaggttgcg     65220
     aggtatcaat tggattacct ccaggtgtga tggaccgcga gatatcgtcg ccgccttggt     65280
     gcatcccatc ttgaataccg accttagttg cgctcaactg gctttcgtga gagaaggtgg     65340
     gatggacagg agacccgaac ttggtgaggt aagctaagcc aggtagtaaa ttctgttgtt     65400
     gggaggataa accgatgtcg gcgtctggga ctgcggtgaa gacctcttca ttcatcttgt     65460
     gaaagggatc aggtatttga tggtcggtga ctttatgaga actttggtga tctgaaggtg     65520
     aggagtggat gcgagggttc aggttggaga agagatatgt ctttatggct cagttgtacg     65580
     tgcatgatgg gaaaacaccg atcttcaacc ggctgaagta ttacctgtcg tccatagagt     65640
     atagcctgat ctacaagggt atataaatgt gatcatcgcc cataactatt cccaaatagc     65700
     cgatactaat tataagtata atcacagcgt tgctccaatc taacgaacga atcttaatgc     65760
     ctgttgatat tgtgctacgc ttccctcctc aatacctctt aaatctaaat ttcagtgtct     65820
     ctaaccgggt gttgctatat tttattacgt ggggtgtaca gatgacatgt cagctattct     65880
     tgttccgatg acttaatgta ctaacttgcg ataaagtcaa acgcatgcgg agttagaagc     65940
     cacagatgtc gcccccaaac tctttcccaa aggccagtca tagaccgcga tcgtaaggga     66000
     cggaagaagt ataattgtaa gacgatgata gataaagatc caattttagt acgacatacg     66060
     tacggcaaac atttgccgga acatgggctg aatttaaacg agcgaaagtg accaataata     66120
     attgagatga tagacacaga tatcgagata cgatgaagaa gagtcgcact tttcacacta     66180
     agtgactagc tggcaactgc tattctagtt gcagttgctg gtatcagagg aatcgtgtgt     66240
     tgagctgtgc cgtaaactgt ccaactaggt accgaatgcc gaagctcccc tggatcgcca     66300
     aagccgacag cagcatataa agcatactcc accggttaat tattagatct atattttatt     66360
     gctggatctg tctccagagt ctattctcca tgatattatc tccagtactc ttttgagtct     66420
     ggaagtttgg ggtaataatc tccaacttat ccgaaggttt tccgtcgttc ctgtttcccc     66480
     ttttttttca tcgtcgagtt tgttcggcat caattacatt ttgaggatgt tgatgttggt     66540
     cacttgtcat ttacttgttt tcctggtcgg gggttgtcgt tgttcgctga cggaagaagg     66600
     tcaaagcttc gaaaaatagg cggctataga agagagacac gccgagaagc atcgcgttca     66660
     ttgtccgaaa gtataaccac tatcgatgct attcatgtat ttggtggtct cttctttagc     66720
     agaggcattc ctgcatttaa aaacagaacc cacaattata gattagatcg agtgcggaac     66780
     gaagcaggtg actctcgttc gttcgtcgtc cggcaaagga agaagttggt ttaacgcgac     66840
     ggcgaacgcc gccgtctaca ctactacaat gatgtgttat taatcatgtt atcaaagtcg     66900
     tcgcctcaag aagcctcgtc tcccctttcc gacgaaccaa agctcaccta ttcaacaatc     66960
     acaatccatc ccatatactc ccgctttccc ttcttaatac cctgtagaca ctttctcaag     67020
     atggctgtaa gcatatctga ttgcgctgaa ttatgagcgt atgaactgac attgttatgc     67080
     gtagtctggt ttcggttact ctggcggtaa gttactcggt ctggcaatca agcaaatgtg     67140
     aagcagcgag gacagctcga taaaacgggt gagaagcagt gatcaggtga cggaatggaa     67200
     aaatgagtct gtggaatgga taagaatatg atgttgatgg tatggatagg tcgaacaaga     67260
     tgttttccct tctggcaaga gttctctaag gtgcgttcct ctaaattcgc aattcggtct     67320
     atgaactcac gaagcttgct ttgtcgtgac tttcccacat acccaaatac ctctggtcta     67380
     tctttgtcct tttcaaaacc acattatgct tcgaacgacc tatcaactct gaacttttgc     67440
     tcggcctcgt gtatgacctc cttaacactc caattcccat ccctgatccc ctccaatttg     67500
     cgaaattcac actcaaaaac tttgcaaaac ccaacaaagt gctacgccaa tgctgagaag     67560
     ccttccgact gcgttgcccc caaagatgac tacatggagt gtttgcacaa caccaaggag     67620
     gtgagtttct tggttttcag atgttttgaa ctatgtgaaa atgtggtctt tgcgttggga     67680
     tgaggtggat tttcaaagag ttttagggtt agcacaacaa gagaggtaaa agctctcgtt     67740
     gcggacttga gggcgtaatt gaagtgatac aagagatttt ggaaaggagg agactcttcc     67800
     tttaagtgat atgactgatg tttttgttct tttctgctgc ctatcctact tcccgaatca     67860
     catcccttgt caaattgaac ctcatacacc gatattccca aaacagattg cccgagccaa     67920
     gcaagtcaag tcccacttcg tccaaaaaga actgcaggag agccacgact ctcgcaaggc     67980
     cgcagagaag gctgcgacag gggtgatcgt ttccttgggg ttagtcgaag aggaaggaaa     68040
     gtagcggatg tagcatcatg catttggaga gtttagagaa ttgaagctct ggatcgtgga     68100
     tcaaggacta aatgggaggc aagggatgaa ggacgtgacc agcaggttgg gactgtgaat     68160
     tgtgcaggag gatgcttaca tattactaac cgacaagcga atcgttagat gtcctagtca     68220
     cataacataa ttaggcatca tagaccccta ttctaccctg taaacttgtc tccctccaat     68280
     ccaccgttgt cacttcatct aacccttcta aactcagaca ctccacatcc tttgcgcccc     68340
     atctcaattc catttcgtca aagacttgga catgcttgac aaccccaaaa ccgagctttc     68400
     tgaacagatg gatggatggg aggttggagg ctcctattct tgctataagg tgtgtgggtg     68460
     ggaaaggaag agccgttgtt aagtatgcga ggctagatta gattgcggag atgtttagca     68520
     ggtcaggcaa aagaaccgga gatctgggac gtacaaaagg gagagagctt cgatggcaaa     68580
     tcgttttctt cgatcgtctt ttgctattca ggtacaggac agcacagagg cacaagttct     68640
     cgtcagttgc ttcttttttt ccttctgagc ttgaaatgac atacacgcaa tcataatctc     68700
     acattcccca tcgccttcga gaccctccgg aaggaaaaga tttacgtcgc ctaccatccg     68760
     acaccgagca agacatgatg gtgggaggat cactttctga ttttgctccg ctgtaggggg     68820
     aagggaggac ggtcgttcga ggaggatgaa tgtcaattct acagcgcccg tcggtcttgt     68880
     cagtttcacc acgatattac tatgcccgtg tcctttagaa cgcactatct tcatcaatat     68940
     gccactttcc tgcccatgtc atgctatatc agccatcatc tctcccattc actgagccgt     69000
     tctgttactg gcagacgtac gctgcatatc gagctcttcc tcgtagctta acggttcaga     69060
     agctgtgagc tcaagtaatt ctgaagattt catccattca tgatatgtct agttattcat     69120
     tatccccgtg aatctttagt taggcttttg ccatggtctg tcattgcttt gcaaagtgaa     69180
     agtagcttac agggacatgt tcagcgctga aagaggtatt ctggttagtg gttgtggacg     69240
     gcgtgttcag atgctgcatg aactgttacg gaccggtatg ggacaaggat gactcgatct     69300
     ccgaagagga cagtattctc gttgagcctc atggtgatcg tctacgaaag caggtgtact     69360
     tggtatgtga ctgtatggct aatatgagtg ggttatagta attctggact tttgatccaa     69420
     gtgttactgc gcgaggagaa acaaagtccc ctcagaccta atgacgtgta aataagggtg     69480
     gaggacactt aattaagctt cttcttcttc ttacgccgcg cgtctctgcc acatattcgt     69540
     cactgacaac ctacgattat ctattctctc tatcatttca gctccagtat acaaacacaa     69600
     ccatcacaat gacctcaata ggaacaggat acgatctctc agtctccact tactctccgg     69660
     atggaaggct tttccaggtg agtctcagac gcggacaagg aaacaaagaa cggtgttgct     69720
     tatctcctgc tcttaggttg agtatgccaa caaggctgtc gaggccgccg ggtaagcacc     69780
     gctcatcttt tccagatgtt tcaggactga tatagagata tttgacagcg tcgctattgg     69840
     tcttcggtgc aaagacggtg tcctcctcgg tgttgagcgc atccttcatt ccaaacttct     69900
     tgtcaaaggc gcgaaccgcc gaatcgcatc ccttgacgaa catatcggca tggcgggcgc     69960
     gggtttgtta gctgatggga aacatctcgc gagtagagga agggatgaag cgagcaactt     70020
     tagggatacc tataatacac ctgttactgt tcaggtacgt ctctttcagt ctgttttgaa     70080
     tcatgaataa gtggtcgggt taaggagatc aaaacactaa ctggacgcgt gtaattctag     70140
     attctctctg accggctttc cgcatatctc caagcataca catcttacgg ttctgtccga     70200
     ccttttggtc tctctgccct tgttggtggt gttgacaaga ccggtcctaa actcttctgc     70260
     gttgagcctt cgggagtgta ttacggttac cgggcatgtg cagttggaaa gggcaaagca     70320
     ttggcgaaga ctgagcttga gaaggtcgtg aacaaggaag tggagactgg cgaggcgatc     70380
     actgtgcgag aaggtgttat ggagcttgct agaatgtaag tcatgatcta ttcacaccca     70440
     aagatatttt ccggttggag gattactgat gaggtgatat agtatatact tggtccacga     70500
     cgaaaacaag gacaaggact ttgagcttga gatgacttgg atttgtgaag aatctggcaa     70560
     caagcacgcg ctggtgccgg aggatctgct ggcagaggca gaggcgaagg caaaggcagc     70620
     tttggaagaa ggcatggaag aggattagat atactcgttg gagtagacag gattgtaggt     70680
     agatcggtga catatgtata tatcgaatat agccgttctg ctaaaagtga gacgggataa     70740
     aataagaagt gctttattta tattagcatg ttgctgcttt gtatggttgc cacttccgag     70800
     ttgaccttca aggcttacaa taagcaagct ggcatttgca caacaggtga acttttcaag     70860
     gctgtgcggt aagtggggga ggcgtgtatc aaaaattgcg attccacgtc tgccactatg     70920
     gcatggtccc tcatttaatt ttaaatacga aactcaatgt gacaggaaag caatgtacat     70980
     atttccctac gggtaatcta ctcgttcata agctccattt caccaccttc cccctcttct     71040
     cccccttgcc cctcatcatc cttcttaatt cccttgaact cttggtcctc tcccttcatc     71100
     gtccttcctc tttgaaacca cgagctcgtc tcctcccttg taatctccct aagcaccatc     71160
     gtcgcatatg tactagcccc cagctgcata tccaccttga ctgccctaaa cttgccttcc     71220
     ggatcattcg ccgccggcgg gttaaggctg aggatctcat cttcatccga ctggacaagc     71280
     ggcaaatctg ggtcggtgta ctgaagatgc gtccatgtaa gtgagagcgg gcggaggagg     71340
     ataaggcggt atgagccagg aagagagtac tctcgttgct cgcgtcgcat acggtccttg     71400
     tcaagaccgt cggctttgag gatgctgtcg tacagctcgc caacctcacc accggggtaa     71460
     tcgacgtcga atccaggaag gggcatcacg acgtcgaaga tagtgtgagt cttgttggta     71520
     atgtcctcgg cggtgaggcg acggacggtg ggggaagatg atgttttcca ggatttggtg     71580
     cggccgtgtc ggtctttgcg gtgagcagga acgttttcag gatctgcata gggcagaatg     71640
     agtaaaacag ttaaagggtg aaagacaata gatgtgatga cctaccgaca ggctcgtcat     71700
     catccgactt ttcgataaca agatcgccaa caagaggttc cgtagcagac atcttgatac     71760
     gttcagaaac gataaggttc caaacgtaac tctggtacgc atggacatac atcgtcctca     71820
     aatttcttgg gatcacaccc aaagccccta ccttatcctc cattcttcca cctcttttcc     71880
     aaaattccca aatgctcctc tccgccacag ctcgtctggg catcttctcc aatgccttga     71940
     cgtaatcgcc atcttccaac cacgccagac gagcggctac acaatcgggg tgttcaccct     72000
     cacggaggaa gaggagagaa tcgagggctg cagaccagtt ggagcggagg atgaagaggc     72060
     cagtaacatg ggttggcatg gaggaggtgc cgaagcgctg catacctgga cgagagaaca     72120
     tgttagcaga aaagagcgat aagaattggt gcaaagagag aaagcttacc ataaaagttg     72180
     ataaacccaa gatctctcac gctctccata gtccgatcaa tctcctccac actctccgcc     72240
     tctacatttc tcaatgtaat caagaatcta ttccccttca acatccccaa ttccaaatac     72300
     ttgtcagagt actcgaaatc tccaaccctg acacccctat cacctctctc ctcaaccgct     72360
     tgttgctcag tccgccaacc ttgtttgacg ccgttgagtg ctcgccagac tgtttggagg     72420
     ttacgtcctg aacgtttcag gcagacacgc tggacagtga cggctcgttt gtcttttgta     72480
     ccgcacacgg tgaggtcttt agcttggaca ttgaggagac gttggaggtg ggagagagca     72540
     tccatggttt cgcggttgga tttgtgcaaa gtaaagtgga tataggcggg taaacggggc     72600
     gcgtcttttg attcgattaa tcagagcccg aatgaaaaaa taaataaata ttgaaataca     72660
     cgcaccaggt gcccgacgag ctcctttgcc gtggaaactg ctttgtcccg caccactgga     72720
     ccacttgata accagccttt gtccttcttc gccctttact tctctggttg agctttcaaa     72780
     catcccagga aagacttcgc gcagaatctt gtgagccgct gcacgctctt ctttggaaat     72840
     gacaggctac gcaatttgtg tcagtttttt ggataatagc catgtgaatc gggtcagaga     72900
     tgcacctgtg agagaacctc gcgctcatct tcgtatgtca accaccaact gcctgaatcg     72960
     gcattgcgtc ccccgcctcg tccgcctctc ccgccacggc ctcttccacg ttctttcccc     73020
     cttccccttc cacgatccct gccttgccct cgtcccttac ttgcactatc attgaaggca     73080
     gcttcctccc cttcctcctt cttttcttcc tctctctcgg cattctcctc acttgctgat     73140
     tcggtatcct tcttccttcc gccccacccg gaatcgcctt tggggggtgc atcttttcct     73200
     tgctcaacga gttggtggag agagatgatg gtctcatctg aaaagtgggg acgaagcttg     73260
     agagtagtac ttgtgctcca ctgagggtgg gcagcaaaac gaaggttctc gggaaggtca     73320
     acggcgactt cgggttcttc gctctgggat gcgacttcag tagtggattt cgtttggcca     73380
     ttggcaattt cttcttcagt aacagtcgcg gcttctttat ccttttcatt ggatccgggt     73440
     tcttgtggct tggtgatgtc tttgagatgc aacaccttgc catcaaggcc gatttcgttg     73500
     accaggaaat ccgtaaacct tcccaaaaag ttagctcact caatttttca agttgtatac     73560
     cccctcagag atacttacgc accgctgttt gatcacaccc ctcacacctt tacccttccc     73620
     tacgaatcct cggattccac attcttcctc accgacaaac ccacggcgag caaccatgtc     73680
     agcttcaata ccagtgacca tcttcagact aggaggaagg tctgggatgg cgggtacgag     73740
     tcccatcttg gatactgggt tggggattgt tcggtgggga gcgttaaggt ggtctgtgag     73800
     agatggggtg ttggaggggg cgatttcttc tgccttgaat ctcttagcct ctacatcctg     73860
     cttctccgtg tcctctgctg gacgtttttg agtgttttct tgggcggaca ttgtcaatat     73920
     atgttttgga aagagaagat aagaattttg gaaatttatt tcccaaacaa aaccggcgcc     73980
     cccagctgaa aaaacaagaa cgacagagag tgtcgtaatt tggttccgtt catgtcccgc     74040
     cgctacgtat atccaccgac ttatacgatc gatatatatc agattgccaa gtcccattta     74100
     cattatttac tatcactata cgcaatgcta aaacggaaca ctccagcatg ggcagttccc     74160
     aaatcgccat cagtcaagca tgagctcaaa gatgaacccg gcgaggagcc agacacaaag     74220
     cggataaaga gtgtgtcctt gttgcgttta tgatgtggtt cccagcgctc atacgttcta     74280
     gctgggaacg tcaagcccat cctcacggct acacatggaa tgttcaaaga gaaccgtaca     74340
     gccgcttatg ccttattgaa tcagctcaag gtacatctac ccttccggag cccagaacga     74400
     atttttggct gacccccatt ttgaacggaa ttgtagaaat caatgacgat aggttgggaa     74460
     gatgctttct tctggatcca ggataccagc ccaggtagtg accccactga agcccttgaa     74520
     atattcaagg cccttgaaag agtagaattc aacaagatca atcgtgtatt cacatacatt     74580
     gttcgtataa acgctccttt acgccacttt cgagtgacca ctaaccctgc ctctttttct     74640
     tttcttagcc cgaactgact ctcaccacga ccaacgaaat ccgaaaccac atccgtattc     74700
     attccacccc tacttctggc atccccatca aaaccctccg tgaagccatg ccgaacggca     74760
     tcgagccgct caaagacctc gaagcgaggg gcgatatcct catcatgcgt ggtctgacgg     74820
     gcgcttggaa ggatatccct ttgccgagat tgggaagaaa gaatgtgaat gggcaagagt     74880
     tgatggaagg tggatcgggg agatggaaga cagttttttg ggatcatttg agagaggcgg     74940
     gaagggcggg aaagagggtc gatgatggta tgtgccgagt tatctcttga tgattatgtc     75000
     agtggctgaa tattttttca gagtttatct attcttgggc agatgttcct atagcagaaa     75060
     cggacgatgt cgcaaaattg cttgccgatc gtacgtctcc ttacaatcct cttctctttc     75120
     cgcggaagca cgctgacaat tccaactttt tttcccataa ttcagaggaa ctttctgctt     75180
     cctctgctat acccgccgcc ccaaaagcga ctgcaaacgc tgcctccaag aagaagaaga     75240
     agcgcacacg agcattgaag attacaaaca cccacatgaa agagcagggt attgacttct     75300
     caaaggacta tgtcaagcct gcgtgagcaa gttatcacgg tggcatcgcg aagcagaagg     75360
     agaagactaa aaggggagtg tattgcttgt atgtgttgta tctgtcttat taattaccat     75420
     gcatcttcat tcgtttcaat ccaacatgca agagcttaac attgtgaaat aaaaatagga     75480
     tgtaacatac aacttacaaa aattcttaca acaattgtcc acatctcatc ttatgccaaa     75540
     atggtccacg caaaaaaaat aaaaatagtt aaaaactgat atcctcgtaa ccctcaagca     75600
     tttcgatttc ctcatcgact tcatcgtcac tatttccttt ttttttcagc tctgccaacg     75660
     ccgccgcgtg tatcgcattg cctaccactt ctccgagggc ttccaagccg ataagctgag     75720
     tttgctccgg cccaagttcg ggttcaggcc ccagttctga ctctagctgt ttaggttgtt     75780
     caggctgttc tgctgttgta gggtttacgg agtgtataac tgcctgaggg ccctgagctt     75840
     gacgtgcaag tggtacgtcg cgaggttgag tcgaccttgt gggcaataga gagtttgaaa     75900
     gagattgggg aggtgcatgc tcggggttga tggcgttccc ttcttctccg tctcgaacct     75960
     ctccatctac attcccctca acgctttcga taccaattac cccctctgct ctctctccat     76020
     ctcccggcga tcctaatcct ggtcccaatc ctaatcctcg caacaacccc ccttccccta     76080
     ctatagacct cctcttccca tcccctgtca agctccccaa cgcaaactca tactccctcc     76140
     ttgtcctcat attctgcctc aacacccaaa gttccgccag ctgatcatca gataacaacc     76200
     tcggatgttc caaatgtttc gttacagagg tatacaattt gctatgctgt ggttttctca     76260
     gcaagtcttt cagtggaggg aggaggaggt cggaagggga aggaagaggg ttgggaggga     76320
     gagacgtggg aggagggatg gagttggggt tgatactttg gacggtgggg tagtcgatca     76380
     tgcctgggca agcccagatg gatggccaac cgggaccaga gcgggtgcgg ggcggtgagt     76440
     tagtgaaacg aaagctagag gaaagatcga ttttctcgat agggagatgg gcaggtggtg     76500
     ggcgttcgga tgagatgggg gagaggcgat aacattcgta cgctgtccat acagcccacc     76560
     gcatctatag agtatgtaat gtcagcgttt aacatgtcac tttttggaga tggggatatg     76620
     agagaggaaa acgtacaagt tcagaccacc accatacgtc gagagagaca taaaacggtg     76680
     tagcagcctc accccaccat gcatcagtgt atatctgaaa ctcatcaaat ggtggtatct     76740
     ggccacactc tcccatcgct tgttccattg cgctggccag cgtattggcg ccttgactct     76800
     cttcatcttc agcctcggcg tcttcaccat catactggtc ttcatcgaca tcgcccacac     76860
     cttcacgcac actcataccc gtctcatcaa ccacaccatt accgccccct ccgttaacca     76920
     cgtccctcct cttaacacgc acactagctt tggaatggct gaccgtcctc aacccatgtt     76980
     ggagtacttg cgaatgatgg acgatccgta atgtagcaag gataccattc ggcttgaacg     77040
     cttcgcgcaa taggctacgt tctcgacaat gcccgagggg tgtatcgtca aaattcttga     77100
     ctataaaatc ttgcagctga gttttggttt ttcttttcag ctataccact aaaaagcaaa     77160
     aaaaaaaaag atgatggata agagatgaga cccacccttc tttgtctttc ccttatagcg     77220
     cgtctatcgt tcttggcttc ttttctcttg ggagtctttt ttcttccttt atggattgac     77280
     tggatatact tttttactct gtccgtcaag atggaatcgg taatgctctc atgatacatt     77340
     ggatgattcc ggcatgcaat agtagcatgt actacaaagt tcattgtcct gatttcgcac     77400
     atgactgtca gcctttaaac ttttatataa acatggtaga atgacagatg ctggatggac     77460
     agatggacag atagacaaat gactcacgac aaagccccca actttcccca atcgggtctc     77520
     caaacatcct tcccttgctc gtccttcatc ctcccatctt tcgcgttgac aggatcaggt     77580
     gtcggccact tatcgggagc gaggtttcct tggtaattcg gagctggcat accgcacaga     77640
     atgcgaactg tttcgtgtac gattttctac tttccccccg tgagggaaaa tggtaccttt     77700
     ggtgagatcg agccaacatg catgttgtga agccgaggat aactgggata ggggtagaaa     77760
     gacgggagaa cttacgacaa ggtcagattc ggtaacatgt cctcccatcc caccgccttg     77820
     tggccctctc ttcgcacgct ttgtggtggg cgcattatgc ggtggagagg aggtcctctt     77880
     cccctcgggg agtgggacag gcggggtttc agacattatt tggtgtcttg cgatggtaca     77940
     acttattacc aagtatgtat tttggatgga ttgtggatga tgaatgttta caattaatta     78000
     ggagaatcaa cattgggcca agggatcacc ggctttcggg ggggaacagc gcagggaaaa     78060
     tatacggcgt acgccgcgaa atgttatttt gagttgcatc ctcgagccgg gtcgtggaaa     78120
     tgctgtcgcc aagacgtatg ctgcaaagcc tttagattgc tgttatgagc ctgccataac     78180
     acgaatgcca aatggaagat ccttgccaga aggtcgtaaa gactggcacg tttgtacagg     78240
     aggctataca acagaaatcg tcgcctttca aaacgagtta ttgtgaccag actgcatcgt     78300
     ccagatccta aacctaatat acaacaactc taaggaagcc ttccccccat cgtcccgtcc     78360
     tcccttcttc ccttttcctc cctcttctgc ctttctatct acagtatcaa gcagtaacac     78420
     caactctaac cgtctcaagg tacttatccc tactccccaa cttgtctgtc ccatccgctt     78480
     ttcgggagta cggtgtccat ttgggttcat cttggaagag tcgcatggct gttatggtgt     78540
     ttgcagagtc gactgtaaaa cggtggtaga tactgttttg tgggggagat ggcagtatta     78600
     aatcagcata cgagtcgtgg gatgggtgga aggggagatg gggatgggga tgagggaggg     78660
     aaatatggac gtacccagca ggaaggacga tcaagtcacc agcttcgagt gcgatcctaa     78720
     tccattgctc ttcatgcact ccttctgcac cccggatatc aaagtacccc gatcctgcga     78780
     ggatgtatcg aatctcctca tcttcatgca aatgcctgtc caacaaatat cttattagtc     78840
     aatcgtaaaa aactcatact cgtgcttatc ctccaggcaa agcaggagca gagagagaag     78900
     aaaagagcga cgcactcgtc aaagaacgac ttgatcttct cctcatatgc ctctcccaac     78960
     ccttccctag tcacagtaat ccggtccctg ttcttgtatc ctcgctcctt tgcaaattcg     79020
     tcaatcttgg attcccacgc gccctcagag tcgatgggta tacgctggta gacgacgccg     79080
     agcttggcga gggtgggttc ggggatgtcg atgccggtat cgtgagggag acgttggtct     79140
     ccactatgga ggtagagtca gaagggtgtt gaacagacgg gaataggata ggacgtacgg     79200
     cttgtcgtcg taaatgtacg ccttcattgt tcttatgtgg aaatcgaaaa cgaaatggta     79260
     tacgtacaaa ctggcgaata aaaacaagtc gaaaacatgg aaaataatga cgtgctcacg     79320
     aacgatcgtg tggcgaatca ggctcacttg agggtggagg tggaggcgcg tgagttatca     79380
     gtgtcatttg gcgtaaacaa atgcggcgtc tgcttttcga gagctcttca cctcgtcaga     79440
     aaagcgtctc tgcgagtgtc gtattttgtt actggttcta caaggtttta cagtctccac     79500
     agcgaagacg cataccacag cacaacgctg ctccttaaga attttcgcgc tgtatatcac     79560
     tctcctacac ccaccacacc cgcacactca gccacaagcc agcaccgggc tgaaccaaag     79620
     gcaagtttgt gctcgtttgc catgcgcacg gaccccctct gacctgtaat gctgcaggag     79680
     agagcgtgtc ttccccgcaa cgacgtcatt tcccttcccc actgcctata cataactgct     79740
     tattcgccac cgtgctatac acctctgttt cttcctacct cttctttccc aacacacgtc     79800
     accttccctt cccctgtccg agtagaccac cgtgactgtg ccacagtcaa accaaggaaa     79860
     cctcacgtca ctagttgtca ttcgcctttc ccttcttcct tacacctgct tgttcgttta     79920
     cagctccaat cccaacatgc catccccaaa gcaggcggaa aagctggcaa atcctgccgt     79980
     tgcatacact cttctcgaaa agctcggcgc cggcaacttt ggcacagttt ggaaagcgca     80040
     agtttgatac attcagtcag tgaacgatta ctgacgtcgg tgctagctcg cataatgata     80100
     cgaagcaaat agtagctatc aaaatgatag gtaaatcttc atccacatac tacagccgaa     80160
     acgagcgctg accccgctca gacctcgaat catcagacga cgatatctct gagatacaag     80220
     ccgagattgc acacctctct tcatgctggt ctgaccacgt tacaaaatac tatggttcat     80280
     ttgtcagggg cgcgaggcta tggatcgtaa tggagtatct agctggtggg agctgccttg     80340
     acttggtacg tcataaagtt gctacaatgg ggttgagagg tctgataacg aaatagttga     80400
     aaccaggcgt gttcacggaa gctcagatag ctattgtctg tcgggaactt ttgttaggtt     80460
     tagaatatct ccatatggag ggaaagattc acagagatat caaggctgcc aacgtcctac     80520
     tttccgcgtc tggggatgtc aaactaggta cgctcacgat ctcttcctcc atcatttggt     80580
     aagacttatt catcgtcttt tgatagccga ctttggagtc gccgcccaac tttcgtctca     80640
     caaatcccaa cgccacactt ttgtcggtac ccccttctgg atggcgccag aagtgattcg     80700
     tcaagccggt tacgactctc gggctgatat ctggtccctt ggtatcacgg ccattgagat     80760
     ggccaaaggc gatccaccgc tcagcgagta tcaccctatg agagtcctct tcctcatccc     80820
     taaagctcgt gcaccgacgc tagatcccga agaagggtgg agtgaagaat tccaagattt     80880
     tattgaaaaa tgtctccaga aagacccgcg tgatcgagca accgctaagc agcttcttca     80940
     acatcgattc atccgttccg ccaaaaaaac caccgatctt attcccctca tcacccgcta     81000
     ccaaagttac aagtcctctc acccgtcctc taaacccaat accaccccat ctaaaacgct     81060
     caaccgcctc gccgcgggtt tgggcggact gacgatagat gggaacgggt acggccaggg     81120
     gacgatgggg agtgaatgga attttgatga gacaataagg agtacaacga ggggtgtacc     81180
     cataaatctc aacttggagg acatggatga agggtttgat gaggatgagg gtgaggatga     81240
     ttgggacgcg aaaatggcag agatggaaag atgggatggt acggtaaaag agaatggggg     81300
     tgatttgttg gttgcggggg cgttgaccgg atcggaaatg tcttcgccga tgattgagag     81360
     gcagccgaat aggagaaatt cgactcctcc ccccggagca tcagcttcaa acacggacac     81420
     aagagaggag ggagagagaa aaggagtcga tgagccaaaa acgccgccga gctctacatc     81480
     tccctctccg tcccagagaa gtctacagtc ttcaacgggg agtgtctcgt cgggcaagtc     81540
     gacgtggaag cagaggaatg ataaagttag aggtactgtg gtgaaagagg gtgatgtcgg     81600
     tgatgggtac gtttttttca ttctctctgc ctcattcctt tgcccgctat cccttccttt     81660
     tctcactatg ctttcttccc ttcatgcacc atcattcctt gatacatacc atatactgag     81720
     catggaaact aacaagaaac gacgagaata ggttctcgac agtcaagcct atgaagaaga     81780
     ttgacgcagt tgcttcgcag aggctctcaa cgtcatatat cggtgcaggc tctgtccgtc     81840
     gcgccaacgt ttccggacct actcgtaact ccggttcaac aacggaatca cctaccaaat     81900
     ttcgaccttc tgcgccgcta gtctctgaga atatccctcg ccaaacacct caaaaccaaa     81960
     cacaaacaca aggaaaaggc gccagtgctg aacctgaccc ccggagtcta gctggtcaag     82020
     ctctggctga acaagtcata ttacccatct tatcctctac ctctgtatgt cctctccctt     82080
     tgcccaatca caatcgcttg atgtactaat tagaaccacg ccccactcaa cagtccaacc     82140
     ccaaacacga tctccccgca ccaaccctgg aatccctctc cctcctctcc aaagggtttt     82200
     ccgatctctc ggcctcttca cccgaactta cgtataggct cgtgatggat atactaggcg     82260
     gaatcagagg gaatggagtg gtaatggagt tggtgggaag gatgacgatg gggaaggaag     82320
     ttgggctgga tgttggagat gggcctgggg taggggctgg ggttgagttg gacggggttg     82380
     atggagtcag tgggatgaga gatgggcagt gcgtggggag agaagagata gaagaaggag     82440
     aagcaaaggt gaaaggggat ctggtgaaag aaagaagcgc gattgcggat ctattatacc     82500
     ttcgctgtaa gttttcctcc ctctctgcct cagaagcggc gatagacaaa ctttttttgt     82560
     ttttttaatg gctagagcat atagctgact gatcatgtcc ccgatgggac tatcacaggg     82620
     cttgacggga tgaggatgaa atggccgaaa gcttaagggg tgttacacgt gcacagggga     82680
     caactcgatc gcacacatct attcgcacat acctgatcca atcattcgac ctgctgtttt     82740
     tacaatcata atccatctag tctattgtca tcctcttaat aactcaagtt tacagaatac     82800
     aagatccatc gtccctccct ccccccaagc gtctcgtttc ccattattcc ttttcggttt     82860
     ccgaccaacc tagttgttct ctcacgaact acttttcacg acaaaaactt gatgacattt     82920
     actatggtcc cgattgtagt cccagttctc acttttgcac ttgacgactt aacgctgttc     82980
     atgacctgta atgaccccca cttttatttg tatacgctgc atgcaaaaca agctgcatat     83040
     ttctttgcta tacattagat gcattttatc attggtctgc tcacagctgt gcaaatccaa     83100
     agcagtcaac ctgaagccga aatgccaaca agtcgatcaa tgacatacta tgctctggat     83160
     aatgaataat tactggtatt acacatgcta ttccgagata tatccatcat atgcaaggtc     83220
     ttgaaacaag caaagaagga aagaaggctc atcaaaaata gtcgtaaagg acatcttcat     83280
     tggtttcagc gttcaaccgt tcaaccgcgc tctaatcatt ccttttaatt gtccccgacg     83340
     cgacggatca ggtcaagatc aaattgcacc cgcccactca ttggcgtagg caccagggtt     83400
     ctctgctatt tgctttgcaa tctctggttc ggacctccat atccgtgtca aggacccatc     83460
     tgaagttgcc gcgagctaga gatttaaatt aataataata ataaaacaag ttgtcagctc     83520
     tccgtatata ataaagtgga ataatagaag agcagcgcag caatgcggga gaccgaaagg     83580
     aaaggtgaga gacgaagagc agactcacga tatccttccc ccactctacc gcacaaacct     83640
     ctctatcctt tccccctatt tcactcattc ctacctcgaa ccccatccca agcttcttcg     83700
     ccaccgtcgt cgacgcatct ctccttctgt tcatgtcctg gcctcgttcc tgcgtatccc     83760
     aagtcatcag cccgccttta cagctcccag cagccagata ccggccatca ggcgagagag     83820
     aaagacggat gtaaaaattg gaaatgagca tggatgggtc cgagtaagtg gccggttgga     83880
     cggcttcggc gtatgtctct tcttctgtaa acgcattaaa cgctccagag gagtgggtcg     83940
     ggtggtgctg aatgagggcg gcagaaggac gtaaaacatg gaccttggaa tcaccgcaaa     84000
     gcgcataaac atccccattc accggtgatt ccaccattgc gtttatactt cttgctcgtt     84060
     ttgcgggcga ttcgccgctc agcgtggcat caggtaaact gccagatggc gtacacgtcg     84120
     gacgtgggtt ggaagagcgg ttggttgggg cagggaaacg gaggtcccat aatttgatga     84180
     taccgtcaaa tgagccgcca gaggctaggg tgccagggat ggaggagagg gcgaggaggg     84240
     aggttacgga tcgtgtggca gttcgctatg aaagaggttg gatgttaaag tgttcatagt     84300
     atgcaaggtg ggggattaac ttacacctga gcgtttaccg tccccgtgag ctcccttgat     84360
     gactatcacc ggatccagca cctcgccact cgtttgcggt gcaaatcccg gtataccatc     84420
     cctgtacctc tctcttgagc cttccctcct cgctggcccg gcgtcatact cgcccagttc     84480
     gggatcacgc ccttttgttc gaacatcata aatcagaatg ttcccatccc ttccgcccga     84540
     agcaataacc gatgactgtg aagggttgtt ggcggagcga gaagggtcga gaaaggtaac     84600
     ggtcttgaca gatgatgtgt gaccacggag tgtggcgagg agagtgggga cgggggtggt     84660
     cagagcatgt aagcgtgatg tctggtcgcc cgatgcagtg agctgtggta acattttcag     84720
     ttaaatctac tcgggacttt gaaggaaaga cgacttgcca ctttcgtatc gtccggggac     84780
     cattttaaat caaatatcgc attcccatgc gctctccacc accatccctt ctcttcccta     84840
     tgcatcccca gtccctcatc tacatctaaa atcctcaccc cgccttcttc tcccgcgata     84900
     ccgatcaacc ggcgtaatcc ttgactacgc gcgtcggaac tagtgtattg ctttgcgata     84960
     tggttgaacg agacggcgag aggaggagca aagtctcgag gacggccggt gggtggatgg     85020
     attgagggta acaggatgga agcgggaggc ctgaggggat ggtaaggtag gagagaatgt     85080
     aaaagtgtgg acaggtatgc ttggggcggg ggtatcacta tgtgctctgt cagcgcgttg     85140
     gccgttgaac agggcaagcc aaaagcttac gacgctggtt tgcaagagaa gacccctgtc     85200
     ccttgactcc gagtcttctt ctctttcgtt tccaaacgca ttcttccttg gtgattggct     85260
     caatgacgcg tgtgttctcc ttgtcctgcc gttcgtcctt gacgcgtccg tatcgagagg     85320
     tactgggcag gaagtagtca tgtatactct gcgatttgcg ctgtgtgtat agccggcggt     85380
     catcctcgga atccgactgg tcatcgctgc tctgcgaagc gtcttccccg tccgacgcta     85440
     tgggtgcgga gcgtgagcca gcggccagcg gggggatgga cgacggccca gccaggtgca     85500
     cgcgtttctt tgcagacaca ccccatgcgg tgttctcttg acgttccctt tccggcctgg     85560
     cccgcttggc caagaagatg ggtgcaagtt tcgggggccg tttggcggac gaggggcgct     85620
     tgggagtcgg agtgctgggg gcattggagg atgtggcgga ggggggggag cggttctgcg     85680
     ggatgggcgt gaggggggtc ctgtgctgca tggcgggatg tgaaatataa gcaagaaata     85740
     taaaggaaag agagatttgt gggaagaaat gagcaagtgg tctgtgcacc aaaacgcgtc     85800
     gcgtcagatt catctttctc cacctcacac aagaaaacgc gtcgcgtact cgctcggtac     85860
     aatgcatggc caagctatat tgatatatca gatactataa tccgctgttc cttccacgcc     85920
     tttaaggcta tccagctcct cgtctatgcc ctccctctga ttttttagga aatcctcata     85980
     gatacgctca gacaatgctc tcaggcgagc aatctcatcg tccaacgaaa gcgttgatga     86040
     agcgggaaga gcgaatgaac caagttgcga agcaaggtag ttgccatcgt cgtacgcttg     86100
     catagtgata cccgggatgt cttgcagctg ttgagcgtac cgaatgggaa gaagggctct     86160
     ataaagggag aagatgtctg tcaaagactg gatgatgatt gggcttgtag aatcaaaagt     86220
     aaaggaaggt gaggcaaaac tgcgatccac cgttaatatc caaaaaaaat cacttttttc     86280
     gcgcctgaag cctgttctta cctagaagat tgtaactcct ccacctcctt gagcagacct     86340
     cttccaatat ccaacaactt ttcgcatgca gtggatacaa agtatttctc ctcaataacc     86400
     cttttctctt cacgaagctc agtcctcctt ttttgggggg gtgccgtcat ctgtggagag     86460
     gtggacgtgg gatcatcgtc ccggctccgt ccatcaccat taccaccgcc gccaccttcc     86520
     actttatcgc ccagaacacc agctgtatgg tgaacactgc tttctccacc acctaaatcc     86580
     tctaccggaa tatctgtatc ccaaaaatct ctctccgctt ccttattcgt cttcttcccc     86640
     accttcttcc ccaacttctt ggcttcctta gggggttttt taataggtgg tatatcgtta     86700
     ttggaaggag tttccgctga cagtgcccgt gttgggttcg acagactcga agtcgacgct     86760
     gacgtgaatg tagaagtgga cgctgagagg gagttttcgt tatcaaacgg ttgatcccag     86820
     ggatcgtatt cctctgtttt gctctttttg gccactttct tgcccaaacg ttttgcttct     86880
     cgaagaggtt tagtaggtgc cgatgttggt gcaggtgctg atacaggttt aggttctggc     86940
     tgtggctcag actctcgttg aggttcgtgt tgaggttcgt gttgagatac aggttgaggt     87000
     tgaggttcag gtgcgtgttc agtcctagct tcgagctcta ccgagggatc aagctgggga     87060
     agagaagggc tagactcagg cagcgacgaa ctcgtactgg cggcgacgtc taggtcccat     87120
     ccatcggctt cgtcttcttc ttgtggggct tgatcagccg aggacgcggg tgggatagac     87180
     tcctcatcga atccccaccc gtcttcggct tcttccgcat cttcccggtt tacttgcttc     87240
     acccccgcct gctcaatttg attttcactg gtctctccga atccccagcc gtcgccctgc     87300
     gcctctcccg cttcaccttg ctctttgctt tgctccttca cgggctgatc ctcatcatca     87360
     ctactgacct ccacctcaac taccacactg acctctctct ctctcttctt ctccgtccct     87420
     tcccatcttc cccactcgtt taacacaagc accctcacaa ggtcggccgt atcatatcgt     87480
     ctcttattcg catactcctt ccctgcctgt ttctcccaga acgtcttcaa cggccgactg     87540
     tgatggagct gatcattagc tgacgagacg ggaagaacag tatcctcgat agcgacggat     87600
     gaaacaatta gattgagcca tccggggata gacgaagggg aagatggaat ggaggggatg     87660
     atgaggtgat caaggaggga ttcgagggtt ttgaccgtga tctcgcggat gaagggttcg     87720
     cgctctggag tgttggcttc ttcggggtac agggtacgag aggtaaagtc caaaacttgc     87780
     tttaagccag tcaaaacctc ttggtcctcc atgtctccgc tgacttggtc tgatttaaga     87840
     gagaaaattc cggaagatga agagatgctt attcggcgtt gagaggatac gacgggtagg     87900
     ataattgttg ttaataattg cgtttgaagc gcttggagaa gatttggtaa cagcgagagg     87960
     gacgataggg ctttgtagag cgatgaaaga ggatatggtg aagcagttgt ggtctgaagg     88020
     taatccgggc gcgatgcttg attgaccagg tcggttagtt gctaagagac atactgagct     88080
     tcatagcaga ctcaccattg gggctgctca acctgatttc ctgcctgaca tccaatttca     88140
     tcccatcctt ttgcaccacc acagcccgct tgaacccatc taccaactga tccctcagta     88200
     atgtcctcaa aacactctcc ttctcttcca acgccttgca aatagcggta gcttccagcc     88260
     catccactgc tatttcattt gcttctgccc cagtctcttt ctttgccaaa ggagcagagt     88320
     ccactaccca gtcctccacg ccttgtcccg cccacacaac ttcctccaac tttttcacct     88380
     tttccacctt ggctttcaaa gctttcaggg ctgctatatg tccttgcgaa gtatcgcgag     88440
     cggatatgga gttgaaatgc ttgttcaaga gggaaagtaa gggcggcatg aatgatgtcg     88500
     ctgggtccga gacatcgact tgactctcca gcgctttgag tttgattttg agttccgcaa     88560
     agtctgaaca gaggttggag gagatttgga tatggcttga tatggacgga agattgttca     88620
     tcaggatttc atgggttttc gtctaccatc accgtcagag tagattagtt cctgttgacc     88680
     ttgatttgga caagacagtg agggacgtac tttgttctct tcaattgcat tttcgaggtt     88740
     ttccttcact tttttgatct catcaacatt ccatctggac actttccttt tgcgctcatt     88800
     attacgtttg tcgctactat ctaaaggcgg ccgaagaagg ggttcgagca gatctagcac     88860
     ttttgattgc gcctgttcgc actgtgcctc cacggaaggt tggttgcctt gaacactgac     88920
     ttctgcctct gcctcagagg aaatatgttc ccctcctgac cggtggagat gtgatgggac     88980
     tgggaacatg gttatgtcct gtctggatct tagctggcac agaatgtgtt acgtgttgtg     89040
     gatctcagat gttgtgctgc agttgtgtct gtcgttgtgg gcatttgacg gctccgtcat     89100
     tcgtgccggc tgctgatgtt gtaccagtac acgaaacctt tgcgtcatga tttttgcatt     89160
     tcttcgggga tctcaactcg acgaatgaac catgcagaaa cgaagcacat aaacaatact     89220
     ttcatttagt actctcccac aacaactccc tcgtatctct caaggagcag attagtgctg     89280
     gtttggtgca atatctgctc cgtatgtttg ggaactatca actatcctgc agacaatttt     89340
     tcggtaaata caactacttc gaattcgttc aactttaagc tgataaagtt cgtacgctga     89400
     cccttgctct ttacccctta tggaatttag cgatgcccat ccagccattc cggcggagct     89460
     atgcgacagg gacggatcgg tcatacataa gtgggcggtg caggtatcgt ttctgcgaag     89520
     aaagttattc ctgcttcgtt tttcgaaagt cgactttaca ggccaatgac cttcctgcgc     89580
     tgtgagctta cgtgtagatc aactggctca tgttgggacg atgggaacta tgcgccgctc     89640
     tgcgcacctt cactgcatgc ccttgcgcaa gataaatatg ttgcttggga gacacccatt     89700
     ggcccatctc gttttttccc cgtcaaaaat gttcatatct ttggaagtga tcaagaacag     89760
     tttcttgcat ctacactcac gtcctcgact tgacacgaac aacggtctat aagttgatcc     89820
     acgaggtagg tccgttctgc cgcgacaacg taaatcctgt tgttgtagtc gagtacgtgt     89880
     gatgcggtgg aggctcaggg aaagcgagga cggattgggt tggttggttc gttggacggc     89940
     tttatacctc tttgcgcgac ctttttcttc tctttcttta cgtatcatag ataacctagg     90000
     aatcaacaaa tccccgtgag tactctattg tatactgtca tgaggacatc gtattacaga     90060
     gtctaaaaag ttgcgattgt agatatttcc tctgcaagca tttgttcttg ttgtacgagg     90120
     aatctgttga aggccctatg gactggttac tctttgtctt cacggcaatt cgacttcgca     90180
     aggccccatt ttgggacttc aatcagatta cagcgctttc gatcggcatc gagacagggt     90240
     tggactcttt tctcgaggaa gttaatgttg acgaagaaga cctgttggca acaacagcga     90300
     cgacactagc gaccttgctt tccccggcca tttcagcggc acaggcgtac ccgaattttg     90360
     cgttgacgat caactgagtt cattgcaaga acaggaactg tcagccaatg ctgagaaagc     90420
     tgtctcgaca tcgatggaaa tatccgcaat gtaccaagaa ctttcgatag cagctgctca     90480
     acaagcaaaa tgccaggagc tgatggttgc agaatattga aagaagcaag ctgaaggtgt     90540
     tgcataaatg tgtttggggg agaggggagg ttcggggatt gtggaatggg ataactatga     90600
     tgtcagatga agtaaccgac gatgtgctta tagttttgcg aggagaggaa gatgagggag     90660
     aagcaccgaa ggctaccaag ggggagatat tggggaagtg cttggaaatt aggaagtttt     90720
     gaatgatatg acggtcatag ccaaggaccc aaataggctt agtgggctac aaaggcactt     90780
     ggtggagtac tacacggagc cgcgatccgt gcactgaggc tccaggcaat tcaagacggt     90840
     ttggaaagca aggacggcag tgctgatgag atgagaaata ctttggagga ggaggaatag     90900
     tagatgaaag cggactattg cgagggatca ttctggacag ggtgctaata agggggaaga     90960
     agagggtgta cgatagggcg cctgtgtaca gtaagtttct caatccgtct taaagccttg     91020
     ctgaccaagg agtgtattga ttttctcata ccgacgctct tctctttttc atctatccat     91080
     atgtttcacc tatacatacc ccaacccgat taccatcatg gctcctctcc caaccatccc     91140
     atacaacacc aggtcggccg gtcagtcctc caacgaggaa ggaccaattc aatcccccga     91200
     ctcattacca actccccccc aaccccccag ttcaagaatc agcaacctct gttcccccct     91260
     ccacatccga tctcgtccag ctcaggatgc tggagatcct tgaaaggttc tcaacgaaca     91320
     ccacctctat cactaccaac tctagggcgc ccgaaaccag gcacctagcc aaagaacctg     91380
     actcgtttag tgggaatccc accgagttag aaaacttcct aacctcctgt gtcctttata     91440
     tggactgcta cccagggacc ttcaacagtg acaaggcaaa aatcaacttc attatcagcc     91500
     attgccggca taaggtaatg aaatccctcc gcccgctgat gaaccgtgca cagcaaccgg     91560
     aactcctcca aaattacgag gaattcctta agtacctccg tcgccattgg ggagacccag     91620
     acgagaagtg gaacgctaaa agagaaatac ggaaccggca agagcgacgt tacctctctg     91680
     gttacaagga tcctggtggt ttgaccaaca tcacccttcg attctttaaa cccaaccttc     91740
     ctgcccatgt ccaacccatg gacgcgggaa tcatcagtgc ctttaagtct cgttaccgag     91800
     ccaaggtcat cccgttcgct cttgcaaatt acgaagacgg tgtacctcca cacctttgct     91860
     acaaagtaga catcaagagt gctatggaaa tggccgatga ttcctggaat gagatcacgg     91920
     gcgagacagt agagaactgt tggaagaagg tgagtgggtg tatcagaggg cggaagagga     91980
     aatcattcgg tgtttcccat cacagtctga tactgattgc tacaacggtg ataggtcttg     92040
     cacgtcctca atttgggccc cgcatccctg agaaagaaca gccagtatgg agcgcctacc     92100
     acggcacaga gatcgaaggc cactgcgtct tcgatcgcta ccattatgta cgcgtcctcc     92160
     atcgtgaatg ggatagcgaa aattacgcca agagacttcc actaaccggt ttcaactcgc     92220
     cgctcaggta cattttgttc tgtctgtggc tccgaaaatc gacaatgtcg atatagccgt     92280
     acatgatacg gtttatcatt ccggcatttc cttttttcgg agtctggagg atgtcgaaca     92340
     gcaagccatc atagacttct atgacgagta agtctacagg tccatggcct tcctgtctgc     92400
     ttgttttctc tcactgactt ggatggatac cagccatgct cgagacgacc ggggagaagg     92460
     ggatgggagg attagcagca tgtggcagaa tttgtggaag tggaggtcgc agcagaggag     92520
     gggggaatga tggtggcgga tgaaatatgt aataatataa ccaatgtagc tatggagaat     92580
     gcttgctacg aagatggctt tgctcgacat tcaaaagttc tcctagcctg cagtgcagca     92640
     ttgaaaagcc agcagatggt tgttgaaata gtgacaaggc tatggtaatc caaaccaagg     92700
     tcctgcagca atcccagtca agcctagtca ccagttggga aagataagaa ccccaggcta     92760
     aagtgggatt gatggcacat tatttatgta tgcatataaa ggtggactaa aagcttggat     92820
     cggaattgat ggcagcttat gtatgcattt gaaggtggaa taagtccttg gggacgttta     92880
     tgaaaactgg ttgaccaggc ttggagctga gtttgggagc gtcgagagca ctttagaagg     92940
     tcaattcaaa ggtgcattcc caggtcccca aaggtagcct aaggcccgat aaatgttgct     93000
     gaaatttttc aggcattgga aaacagaacc ttctttttcg tcatcctcca gagggggaga     93060
     atcgagatcc ggaacccccc aaattgttgc acggccatat tcctccggat ctgaggaagc     93120
     caactgtatt taattaaaac gttgaaccaa acaaaactat gtaaaacaaa aagcaaaaag     93180
     aagcctccgg cggggctcga acccgcaacc gcacgattga gatgatggcc cgtaaccggt     93240
     tcaagcagac tctaagagtc gtgcgcgcta ccgattgcgc cacgggggct tttatatttt     93300
     gcttgactct agcactttga tggatgtgtt tagcttatct ttaagtaagt ggagttcctt     93360
     tctcaactcc ttgttacgta cgcgcatttc cgtcctctac atatagttcg ttaggttgtt     93420
     tcccgaacca ccatactaaa cgcaccgttt gtttttttgg tctacaattg actcgtctat     93480
     agaggagcta aatagacatc cggagcctcc aataacagcg cactactcct cctgcacttt     93540
     caagtagatc tccgcgatac acaagcaatt acctcccacc tccacctaca gccacaatgc     93600
     tgtccgccca gccaccgata gacccatccc cacctccatc ttcctcctcc tctcgcaggg     93660
     tagcatacta ttacgatcag gatgtgggaa actacaacta ctatctgggt catcccatga     93720
     agccccaccg aataaggatg gcgcacaatt tgattgtcaa ctacgggatg tgtgatgagg     93780
     aagggcagga gcatggcccc gcagaagtat ggggcgaagg aaagagggca gtgaatgatg     93840
     agattgccca aaattggggg ggaggcgaga tgggcgatgc agaagtgaag tgggaaaagg     93900
     cggcgcttag gggatcaagg agtaagacga tgcaggtttt tgtaagtgtt gctcgccttc     93960
     tttggagaag tatgaccaac caaatttttg tagaaacctc gaagggctac caaagaagaa     94020
     atgactcggt ttcatacaga tgaatatata gacctgctag aggcagttac cccggagact     94080
     gcggatgctt taacaggggg cggaacgagg tgtaagtctc tcctgcagca ttttcccgta     94140
     catttcagac cattgacatg ccatctaggc cttattggtg aggactgtcc cgcattcgac     94200
     ggtttattcg agttctgcac catctctgca ggtggatcgt taggtacgat tttgcccctt     94260
     ctgtactaga tttgagcact tatccgattg caataggtgc tgctgaacgt ctgaacgccg     94320
     gtgctgccga cattgtcatc aattgggctg gtggtctgca tcacgccaag aagactgaag     94380
     caagtggttt ctgctacgtg aatgacatgt atgttcctgc ccttttctta aggtttctta     94440
     gcttacatgt ttgcagtgtg ttgggtattc ttgagcttct cagaatacat ccccgagttc     94500
     tctacattga tgttgacgta catcacggag acggtgtaga ggaagcgttc tacgtaacgg     94560
     acagggtcat gacttgtagt ttccaccgat ttggagaatt ctttcctggt acaggtgatg     94620
     tcagagtgag ttctttgtta ggtgtataaa gatcttttgc tgataaaatc gacaggatgt     94680
     tggtatgaag aaaggaaaag gctacgccgt gaacgtccca ctccgagacg gtatcaccga     94740
     tgacagtttc caatcaatat tcaagcctgt gagtatccca tcgcgactct ttctaacaga     94800
     agctgatgtt aaatcaggtg attgaccgta tcatgtcaca cttccgaccc agcgctgtcg     94860
     tccttcaaat gggtgccgat tctatatcag gcgacaaact cggtggcttc aacctaactt     94920
     tggaaggtag gttttctttt gcatgtgctg cccgagaaat aagaataaat agctcatgtt     94980
     ctccttctga aataggtcat gcggagtgtg ccagatttat caagagtttc aatgtacctg     95040
     ttatgatggt tggtgggggt ggatatactg tgtaagtcca gctgatactc tgtgcagagt     95100
     tacgatagct gatgaatgat atagtaaaaa cgttgcaagg gcttggacta aggagactgc     95160
     cattatgtgc ggtgtggacc ttgctgagga cttgccttac aatcaattgt gcgtcttaca     95220
     ttcatctctt gtgatgagga aaatgttaac agataaaata gcttggaata ttacggacct     95280
     cgatacaagc ttgaagtttt gcccaccaat gccgtagacc ataatccccc cgaatacctg     95340
     gagcgtatca agtaagcttc cggttccttc tggtatgagc agcagctaac attttgtgaa     95400
     tcaggaatca agtgtttgag aacctccgaa gtcttccatt tgctccttct gctcaaatgc     95460
     gttctgtccc aagtaagact attggccagg ttttgggtat aacggatggc ggtgacgagg     95520
     aacccgaaga tgagattgat cagcgtataa agagtgagcc aaccatcccg cccgaaacca     95580
     catcttcatc agaaaactca tgaagatctc cgtttttata gaactgttga aacggcgccg     95640
     agccaatgtc ctagatgtcg acgcctcttc atcttccgaa tccgaaaccg acaccccagc     95700
     cttctcccgt cccggacgag ccagacgtca aggtggcaat ttttccggcc gtggtcgctc     95760
     atcccgtctc gcccaactgc aacgtaaccg cgaaagaagg gaagcagcgc aggaagcgtc     95820
     caatgaagtg gaagatgatc cttgtggggt gttggggaag aagaagagga gtttcttcaa     95880
     ggtggttccc aagttgaatg gtgtgggagt tgagccgata gacgcgacgg gtttcggaat     95940
     cggtgtggtg accaatggac tcaatggtgt aggaggattg aaggatcggt tggggatacc     96000
     ggtggtagag cagtggaaag gggacgggat cgtgtcgagg ggtggtacgc cagcgagtat     96060
     agcgtgaaaa ggcatgtgcc tcatatcaaa atgagggatg ttgcaatctt tttttggttt     96120
     cagttttgcg ttcatacttc atggtcagta tgcattatta gtcttgttgg tttcattatt     96180
     cggaacatga tgtcgtgaga gtggctttct tcttacaagc tcccgatgtt tctcctttct     96240
     ctctcgtttc aacatacgaa gtctcttttc tcgaccaatg gtctctcttc attttttgcc     96300
     tgatcatatc gatctgcatc tggtgaaacc gcacccagcc gtaaggcctg ctcgttttgg     96360
     aacaatagga ggagtcgatg atgtcaaagg cagttctgaa gcagcctcgt aatttgcctc     96420
     atagtaattg tattcgaaaa gatagttgtg agtgggtcct ccaaggaatt atattcagaa     96480
     aattccctgt cgatagggtt cgagaagctg ctgggaggaa gaagtcggta agtagtagaa     96540
     attttgaggg attagggctc gtattcacgg atagagaaac cgtgaatagg agtacttttt     96600
     atttatttcc gaggaacaat gatttgattg atgtgaagga gacttacctg gctggcataa     96660
     tcatgaagaa gattgaaacg cgctgcctcg gcccatttaa gtgagtggtg ttatcttgaa     96720
     ttttggctct tctcaaatat ccaagcttga ccggccatgt ggtagcgggc cagagaagtt     96780
     tccaattagc acttcagaga cctccgacca gggtcattgt aggttttact agcaatgatg     96840
     gtcgcatcct gctaaaccga ccaagaagtt attggccaaa tccgacgtcg caaatttgtc     96900
     aatggtattt gatgcaatca tttcctccca tagcgaaacg acaagggtgt ccccaaagat     96960
     ctcgtatgtg ggcttgcacc aatcgcactt gagcatgggg gaaggccata cggggatttt     97020
     gccaggatct cctcctccta ctaataccgc cgtttccagg ctcatcttgg ttgagaagtg     97080
     acaggcaatc attgctcctc attttcttta acagtttctt atcacacgca gctttccctt     97140
     cgccattttt aaaaacttca caaacaaagc catttctcac gacatgctgg attcctcagc     97200
     agatgtcatg tcgttcgatc tgcggatcga cgtcgacaga tctccatgaa gtttctttac     97260
     gtaacgatgt tcccaccact ttgtttctta attggcggca gcaacagcat cgccgtgctg     97320
     cacagccgcg ccattcacat acttttccat aatctatccc actgctcagc tttacctttt     97380
     ctcttcacct aagccgcaag tatccccagt acccagcctt taaccatgta agcatactgc     97440
     tcctagtccc agaactgcga gtccaacgtc cactccgccg tgcgctgata tcaagactta     97500
     ggtcttctga accttacgac ccctacatcc cctctggttc ccaaccccca gctggccctt     97560
     cttctagcgg caacaatgct caaagtacga aggtgggtca ttaacgtcgt gttctctggc     97620
     cttgggcgct cagaacacct gttctaggtg aacgaatggg agtatgagaa cgccgaaagg     97680
     ttaattagct gatcacgtcg acgtgtagat ccaagcaatc caatcgcaaa ttgacgagac     97740
     aatcgacact atgcatgaca atattacaaa agtcgctgaa cgaggagaaa ggttagatgc     97800
     tttgcaggat aagactggtg agttggacac ttttggaatt gctgttagtc ggaagtcgag     97860
     ggtttgatgg ctcgtgagac agcaaaaggc aggaagtgcc atgctagaaa ggctgcagag     97920
     atggtacagt agggacgttg aggttgtctt acctcacagt gtctgcgttc ccagaaccat     97980
     tgccaaagga aaagcactgc ttgaagttga agacttttgc tctagtgaac ctcgttaatc     98040
     tgctacgatc ggtctttttg cctaaattga acacacttat tgcaaccccc ctcccccccc     98100
     ccctcccaat atgtttatca tatagcgtcc acaggccttt gagtcaactc caagcgtctc     98160
     ctcctaacct cgcgctcgca tttatcctat ccttgttctg aaatgcgatt gctaacttcc     98220
     cctgtcttta gacaccttag ccgtctctgc ccaaggtttc cgccgcggtg ccagccgtgt     98280
     acgcaagcaa atgtggttga aggacatgaa gatgcgaata attatcgctg tcggtgtctg     98340
     cgtccttatc gtcatcatcg tcgtgcctat cgtcaaggcg taagcgtacc ccacgatatt     98400
     cttattaaca ttccatgacg ctgacaatct cattgcgtgc ccacagcgtt cagaagtaaa     98460
     caatctgcct tcatccccaa atttttggcc tttgttgaaa tattcgaaat atcgctaccc     98520
     acaactatgt gtataccctt ccgccctggt attttagggt ccccagttcc gttttttcgt     98580
     gtatatccta gcttcattta cggggaaaac tgcgaagaat ggtatttagt ggacgctcaa     98640
     ggaatttctt actttcgctc tcaatcttcg atactggatc gggatacgga aatgaatgct     98700
     tttacgactt tatagggcat ctgctggtaa gaagcagact gattgtaact gcgactgatt     98760
     agataaggat ctttggttct gaattttgcg gtaatgtctt gatgccccgt ggctgatcgc     98820
     aaagaaacca tcatctgtga caacagatat ttgcgcaata atgtataaaa agcttaagtc     98880
     ctacccaaaa acagactgaa atacgcactg ccttcgtgga caagcaagag atacggagat     98940
     agtatataca aaaagacaag tcaggataga cggtcgataa aatccagcca acatgacatg     99000
     ttgctgacat cactcattag gaccaacgag atattacata tccaactctt cctatatatc     99060
     gctgccatct aaaaaacagg tcaatgtaag gaaatggact agcagattct aaaagagaag     99120
     ggcgtcagcg gcgtcttgta ctggatgaag agcacgaaga cggagcagac cttgggggga     99180
     ataagtggat gattatccac atttatcaga gctgggtcag ccggtgagtg ggtacatgcc     99240
     tgtcctcttg aaaatgaagt cagacaggca tactataaca tggggtatgt tttcttgtca     99300
     tcagactcat gcctcgccgg catactcact ccagcaccag tcttttcaag acagcaatca     99360
     tttaaccaat ggcaattcac tcagtttact gacatttttt atgatgacat gatctaggta     99420
     ttcactgcat cttgggaaac agttgtagga gtgataaatg cgaagagggt gacgaaaagg     99480
     aaaagatgtg agcgggaggc gagacacaag ataggggtgg gaaaacttga caagaggaag     99540
     atacaggaaa ggattctttg ttggtaagtt atatcatatt gggagtaatg acccaagtag     99600
     cagtagaaga aaagttgatt atatgttttg tggtcagaag tggaaaggga tgggagaatg     99660
     ctcaaatcat catggaggat gcatctcaag atcccaatta ggagctgtat tatttcaatc     99720
     ttgtacgaat agaagaaact taagaagaag tcaaggaaac actctcaaag aagctattct     99780
     agttttgctg cgatctcact acgaggggtg cttcgcgcaa agctgactag atgtcagtct     99840
     atcgcttaga gcagaagagc gccaccgatg acagcggaga cgccgatggc aacagagccg     99900
     aaggcagcgg cgttgccaaa gacggaggcg gcaccggaag aggcactaga agtttcagcg     99960
     gtggaggcag atgaggtgct tgctgcagca tcagagctgg aagactgaga cgaagctgtg    100020
     gaggcggcag cggcgctgga ggaagagctt gtggtgttgc acgcgtcttc tgaaaggtca    100080
     taccacacgg ggacgtcggt agaacagtca gacctacggt ggatgtcagc ggctagctaa    100140
     attgaagggc aggaaataag attgttggcg tactggtaaa ggcagttctt aacgtaggta    100200
     atgaaatcgt cggaacagag acaagaggtc tcattgctag tgaatggcgt gagtgaccaa    100260
     ctcgcatgag atgaggaaat gagaagacta actaagaaga agcggaaggg caataggtag    100320
     gctgctgctc gctcatacaa gtgagcatac aggtggtata gctaggctgc cgtgtcagtc    100380
     cactgaactt ggagaaggaa attgacgaag gaacaatgat tactcacgcg ttaaccatga    100440
     cggcagggac aagagcaact gcagcaacga agaacttcat gttgatggct tccgtgattg    100500
     ggactgtctg aaaatgagcc gagtgatgga ctttgaaaga aatttgttgt tgagggaacg    100560
     tttatcttgc agtctttgac tttataccat tgcttccaca agcccttatc tgaggacatc    100620
     cagtcaggaa aaccagtcag aaaaaagacg catacaagac gctgaatcgg ccgaatatcc    100680
     agatcagtca catatggaag aaagtcctta cacttgaata aagaacagac agtacacctt    100740
     ttccttcgac aaaatgctcc caaaatatgt ggtgaaattt actgcgcttt cgttcaacac    100800
     tccgaggcac accgaaaggt ttgtaacggc attatcaaac atcgtaagta ccgtcaagaa    100860
     attcaccgcc cggccggttt cgcgttagtc tgtaactaaa ttggaacctt tcctgattcg    100920
     agtgaaagtc ttggctccga cacgccaatt aaatttcacg aggcggaaca tatgggccat    100980
     ggggggcgat gggcaaaagg cagagaagag gaagaggagc agagagcaaa aggaacacga    101040
     ggtcgtcaat tatctgtagg tgccaagggt agtgactaag gttattatgt tcagtaaaat    101100
     ggcaggtcag ttaggatcga ctctggatgc tcggatatgg cccccatttg aaaagctaat    101160
     caaggatcga ggacaaatag aaaacgtaat taaataccct gcacttcccg aacaaaattc    101220
     cgctttttgc tcttattctt cgacttatca gattacagca tctgccaagc tcttccaccg    101280
     tccacaaagc tttcatgtac gtatggcagg cagatcagaa gacgggatag actagaaaga    101340
     ctgccggcaa ctgcgcacgg ctgcaggcac tcgtcggcgg caaaatgcgt aacgagcagc    101400
     aacggatttt tagtaaatcg tgcctggccc ctgacattat cagataacta ctatcgggta    101460
     ataaaatatg tacgaacgac tattactgcc gggtggcatg agaccacagt ccatactgca    101520
     gttcgaccaa agttcgtcca caggtcgcgt gcccgtttag tgtgttgtct tgagtaaatg    101580
     ccttctggac ggagtagcca aaggtgagag gcacgtgttg gtattgttcc tcatcaacag    101640
     ctacccagaa aaaccgctat ggcttattct cgatgcatga acaagcaggt gggtgactcg    101700
     agcttagccc cgtccttcct tcttccctct cgttgctcca cgtataatat tataacaggt    101760
     gcagaatgaa agccggtcag cgtaaacgcg aaaacaattg ccggtaaccg ggaacctcac    101820
     atttacattc aacatttcag cttttacggc cgcaatcggc cgactgtcgg taacctgtct    101880
     tcttttcttt acttctcttc gcccgcatgt aacttccatt ccgacaactt caaaaagtcg    101940
     ccgcacatca tctaaaagac taatacttgg tgcctatctg ataactggaa tattactcct    102000
     aaatcggccg ttatctgccg agcgcagcag tgttcgatac cttagtagtt gatcttcgca    102060
     aggatttgtg agacagaatc aggtttgcgc cattttcttt tggatacgaa atctcatgga    102120
     aatagtacgt gaacaggcta cattataaac tgatgaaaag accttctcaa agaaaaaaac    102180
     tgcttttaag cgctcatttg tccttcatct ggctgttttc actcttgctt gtctttcctc    102240
     tagctatact tcaatcgatc aaagcagttt ttcgtgtagt cacaatgctg agcctcactc    102300
     atatccttcc tttggcatta gctgctgctt ctggagcctc ggcttccccc accactatcc    102360
     aaaaaagaga catcagctac ccgggtgttc ttggattttt ggtgagaaac agatcgaacg    102420
     atcaggttct ggaaaaatgt taactgacgt cggcggaagg aacctacacc acgaggatgg    102480
     gattactcca caatgggtac ctccccgtgt ggtggcttca ccaccgtcaa ccaaacttac    102540
     tacggcctta gtaagtaatc tggttggtcc aagcagttct taagtaccga tacatgtctc    102600
     ataggtactg gtatggagtt ccaggtctcc aacgatgtca gcaacgtcgt tatttcctac    102660
     tccacatcat ctgatatgtc caatgcggtc actttggcca ctattgaatc ggcgaccgct    102720
     ggtactatgt gtttggatgg cgaaaatctt ttcggtttgt cggccttgtt attccttgtg    102780
     attatttcca acttacgcat tgcagaggat gagggcttta atttcggcga cgacatcaca    102840
     ttgcaagttt tctatcacga cgaagttacc ggtaagtgct gcttgatgac tagcttaggg    102900
     aatagtatct ctaaaatgat tgtttcctgc agaacaagat ggttaccaat gtgccgatat    102960
     ctctttcact tccgatcatg tcatgagcgt tacctgctcc aacacctcta ccagtatgtt    103020
     tgatcctaaa actgtcagtt gccagaactg actgtcatct tagtcatcac caaaaacggt    103080
     ggctcttcta cttcttctga ttctaccacc accgtcaccg tcaccgccaa gtctggtaaa    103140
     gtcactcccg taagccttgc ttttcctccg gccaagccga tccaaattca tgccttgcta    103200
     atacaggttc tcaatagctc caagctggtt ggattggagc ctgtgttact attgccgttt    103260
     tcggctttgc tctccttgct ctctggtact ttggtgcgat ctttttctcc cgtaatgccc    103320
     tccgacgatc cgaaattcaa cttggtagcc accgaatggc tgaacactct ttggacgaca    103380
     tttccgtacg ctacctgcca gaaaacgtcc ccaagcaaat tgctgacagc tagctagctg    103440
     caccggcgaa cgactgttga ccacaaaacc cctctttaac ttataagcaa aagaagggaa    103500
     tctttattgt ttagggagta tgttggagtg acgagaaagc acatgttcgc ataatagtat    103560
     aatatttttt catcctatca tttcttaata cacattattg gatgcaggtt agtgttggca    103620
     tacccgaacg cactatctcc aattaacact cattagcccg tttaaatttt gagaatcatc    103680
     actctacata gaacataatt atccaacaat tttcctgcta tgctactatg tatgaatcgt    103740
     accttactga acaacatgac cgaaatctct tgttttgtac acatgtttca accgctcctc    103800
     tcccatacac gattacgaca gccaatcaac gtccgttacc gaaccgctgt aaccatcttg    103860
     agccccttcc tccttccctt tgagcgcccg cgctcgatga cgatgaccca tttgcacctg    103920
     gacgatgaga caaattcggg acttgagtca taggttcttc agcaatatgc gtacgcgcca    103980
     tcccgacttc tgcatctgat gctggtggta gccggccctc cctcgaccaa tatgatgcga    104040
     actcattagc atatgaggga gacacattat acgagtctga cggcactcta ggtccagacg    104100
     gtctatcccg tctactcggc gcatctgggc ctcggctgcg ctcagataaa acttgatgtg    104160
     gaatgaacgg gaacctatcc ccgttcgagc tcatgctgga cgatctagaa gattcctgag    104220
     acgggggtac gaggtaatcc aaatgggtag gcaaggtagt accaccatag gcaaagcgat    104280
     tatgtaagct aggacttgag ctgatattga aatatgatgg agcggcggat gtcgggttgg    104340
     gagtgagcct agcagatgac gaagacgtga aagtgggagg tgaggtagac gtcgacgcga    104400
     tagggaaggg agcgccttca ccaggttgga cgctttgata ttggatcgat gcggtgagaa    104460
     tgtgcggtgg ttgaggtcga gacatagggg tgggagagat aggggatgga gcgtcttccc    104520
     aaacatcatt cagattcgac aatgactgcc tatacacaag attgctgtgt tgagcaacgc    104580
     tgtttgaaat tgatgaatga tcgggggtgg gtgcagccct ggggatggtc agggatgagg    104640
     tactggaagc cgcaccgtca tggcccgaat cttcagaggt gtcaacttcc attgagggga    104700
     gatagtggtt attgagataa tcgcgaaggt cgacaactct tgagccggag aagacgcaga    104760
     atgcagcccg ttgatgatcg ttgaagaact aacgtggaaa tgagcttgat aatgaaagca    104820
     tatctttaaa ggatactcac atctgggggt ggacggcaga attcctggag ttcagggact    104880
     ttgaaagagc tcacacctgt aagactcagg tgcttaatgt gagcaagttt gttgagaagg    104940
     tatgcaatcg ccttaacgct aagctggtcg cagtacgata aatgcacccg ctccaacgaa    105000
     gtatgctttc tgacaagaga atatatcgct tcgtccgtga tattggtgac ctgttgaaaa    105060
     aagttcagca cttcagacac tgactttact cattgagata taccttgacc agaccaaacc    105120
     tcttcagctt tggcatgttc tcaccaatct cagccacgca agcatcggtc aacaaagtgc    105180
     aacaagccaa gtcaaggtag cgcagtctgg tacatgatct cgctaggttg ataaccccat    105240
     catcggtgat cctgtatctc gatcagtttg tctatactgt cacgcccgcc aagctgaatg    105300
     ctgaatactc acaagctgac atgtcccaaa tgcaagttat gtaaatgctt ccccagcttt    105360
     ccaatacttt ccaaactctt atctgtcaac gcgggacatt tgttcaacgt caactgtctc    105420
     aattttggcg cattggtaat taggttatca acagctttat cacccagatc cgtacaccca    105480
     gtcatatcaa ccactctcaa atactcgaaa gtggtcgtca ccggtcgcca catcgttacg    105540
     ccttccgcag gttcgatttt gatccccacg tcttctgaca ctttggcaac tccgtcgtct    105600
     tgcatttcgc tcaaatcgag caaattgggt atacaatttt cgttgaggga gacgcagcca    105660
     ttcacgcgta tttcgcggag atgagaggcg tgcaggaaga cagtgtgaag gacagaagag    105720
     gataaagaaa tgacatcttg aaagtcatat tccaaaacaa gggggcacgc gcggataaga    105780
     gggatgagtg atttttgtgt tattcgatga catttttcaa acttgatcta ttgccagagt    105840
     cagcaatttc ctgataacaa ggggaaagta cgcaccctgc ggagcgctct gctttccttc    105900
     gccagtgcca agacaccctc atccccgacc aatctacatt cagacagatt gatagcttgc    105960
     agcttctggc aggtttcacc cacaatcacc aggacggcat catcggtgtt gatgacacct    106020
     gtcaaatcca aggataccag attcggcata caggcgatga catttcgcaa agccccagaa    106080
     gtgagcttgt cggcaccact gatattaagc ctctccaatc ttgaacacac taatagagac    106140
     gtgaatagct cgtcagtgag agtcggacct agttggatga gaggcagccg tctgatggcg    106200
     ttggcgtaag gtagggatcg ggtaggagaa tgaattacac gaacaatcga ggcgagttgc    106260
     gtgattgttg gaagagtggg tttgtaccat aataatgaaa aggcacaaag acaccaaaaa    106320
     cgggagacca aaaggacaga caggagatcc ttgtttccag gtaggtaccg gaatatctga    106380
     atcaggattt cgggcggcag ttgattcgtc agatcgttct tgatttcacc ccttttgttg    106440
     acactcttgt attttccgat tctcttccat ccctgtccat cacgtagctc caaccagctt    106500
     ttcacctcct cgtctatacc accccttcca cgctcatcct gatcatcttc atcgtccgtg    106560
     ctcgccgcgg acggtgttcc gctcgtattt ctaagcactt gggttctttt gtgacgcgtg    106620
     tatttggggt cgtgggtcac ctgaggtgca agtcgggggg ccttaggtgg agtgagagat    106680
     ctttcaagag agagttggtt gaaagtatta atgggtgatg tttctctttc tctgatcgat    106740
     gtagggcggt aggacgaggc cagggatgag tttgtcacat agggtataga agaatccgag    106800
     ttgctccttg acggtcgtac gggcatgttg aggtcgttga tagaggaaat gaatgggaga    106860
     caattgtcta tatatcgtac ggcggcgaat gagtgcggac cgccggcgga aagatgaata    106920
     ggtagtgatt gcaagtctag attgcagggt atttcccgct ctccaagtct tctctttgta    106980
     ctgcgtggac cgttaggata tcaggatgga ctggccattg tagatggaag agacgggtta    107040
     gaagcaaagt acggatgaag atgaggacga ggatgaggat ttgagacaaa ggagaagatt    107100
     aataaattgc aaagttgcta ttctattagc cgcgaccggc gatgactgca acggcctcaa    107160
     ataaacgaca actcaacaat ctcttttaat tagttatcca aacgtatctt gtgatcatat    107220
     gcatgcgtat cctcaagaat agctgtatca gagtccatgg gcttcggtat cttccttttg    107280
     tacatgtaag catatatgtt gaggtttata tccaaattat gatggccttg aatgagcaat    107340
     cgctcgacag ccaaatgcct ctattcttat aacgtgtaga ccgtactcga cgaggatgga    107400
     cgacgacgac gacgacgtcg tttctatcac aaattccgcg tcacttcttt tctctcctat    107460
     cacgtacggg tttttgcgct tctcgctgta caaaagaagg atctgatgcc cattaggcga    107520
     catagagtat acaaccagct atctggcatg cattgttact gtttttaatg gcatgtgcag    107580
     tgcgtcgctc gtttacttat gtcgcagcat tggtcaaacg caatgatggt tcgtttcggt    107640
     ttctgttgct tttcgacgaa gtgcgctgat accaactgaa acagccgata ataaaacatg    107700
     cctgctgatt gattatatga tcaaatcgcg caactatcca aaatgtagtc aactgcaata    107760
     agtttttggc atgcggccta ctcgctatta tagtgacggt ttttcgctct tccattacgc    107820
     gcgtatagtc gggtggctat accgcaccca atcaatcatc catcaacaac gaataacgtg    107880
     agattgccta aggagaaaac actgtaacat cgctgctatc ctctgttctg caagtgatcg    107940
     aagtaaaata tgtgatgcgc aggataacct tcagatcttc attcactccc gacctgtgcg    108000
     agtactaatg ataacggtac cttgttggta acagctttgt ttacaagatc tcatcttctt    108060
     cgacagagga tcaaacaacg ccggagatac caaagcaact ctccgagtct ccgaaacaat    108120
     acatcaaaac atgataaaac aacaccatgc cacgaggcta gactgttggc ttctccattt    108180
     aactaccccc actttcttta agtaagtaga aacccaaggc ctctaataca cgtgcaacgc    108240
     ctttgacatt tttagttccc ccggatccct tgatattacc aaataagcca acaacacatt    108300
     caaacatcca accgaccgtc tgctggaagc cctacacgag atgttccata tggatattca    108360
     atctcagcca gaatacttct gcaagggttg tggccacgtc tatgaagaca gcccagacca    108420
     tcccgcgcat ggcgaaaaat gcaccaaatg cgacgtaagt cacactgcag tttaaggtgg    108480
     cgggtggaaa ttacaactag cacttactaa tgaccagtta tctttccaga aggtgctgtt    108540
     tgacagggtc aattggatca agcctggtga aagacctata gtaaggaaca catatacctt    108600
     ttgcaacttc agaagttcat actgtacgga agtgggatct tactggcagg acgaagaaga    108660
     aggattagaa gacttgtgtc ggataatgat cgataacagc gaagtaccag aaaacacagc    108720
     acggctttcg cacaattgtc gtaataaata atacaacagc atgagaaatg gcaagtccat    108780
     tagagttaca tgtaatcccg ttatcaaaga gtattctctg cattaaaatc ggtaaaaaat    108840
     gaatggaagt gatgatcgag aaaacgcctc tatttaccag tgcgaccata agagtcttga    108900
     gctcaacgtg aacttccaca ggacgttggc tgatcctcct cgatctggaa gtgtggacct    108960
     tcttatcaat tgtgttaatg cggccatctc atccaataaa caaccaaaat gcatgcaaat    109020
     acagactcat cctctttgtg ttgcgcccgc tcatatccca gccaccttct tatatgccgc    109080
     tgggttcagt cgttgatgtg cggctttgat tacatacagt gggaaggatg aaacagcgac    109140
     gatgactgtc accttatata caaatgtaga agagaggacg aatgccaagt ctgttttcca    109200
     cattagcgcc tacacactta tgcaaattgc ggtacaagag gatgttataa aaaatggaag    109260
     ttgtaactta ccaaagtact cgggcaatac agccatactt ccaaagtaga ccaaggctgt    109320
     tcccaactca ctcagcacca tgtaactgtg ccatgtggta acctcaagag cgaccatgat    109380
     aagttcattg atgactaagg cggtgaaaga gatggcgacg atgtgaagga attcagactc    109440
     gaaaagaaga agagacagaa gcatgattat acc