(data stored in ACNUC7421 zone)

EMBL: AE017354

ID   AE017354; SV 1; circular; genomic DNA; STD; PRO; 3397754 BP.
XX
AC   AE017354;
XX
PR   Project:PRJNA22;
XX
DT   27-SEP-2004 (Rel. 81, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Legionella pneumophila subsp. pneumophila str. Philadelphia 1, complete
DE   genome.
XX
KW   .
XX
OS   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
XX
RN   [1]
RP   1-3397754
RX   DOI; 10.1126/science.1099776.
RX   PUBMED; 15448271.
RA   Chien M., Morozova I., Shi S., Sheng H., Chen J., Gomez S.M., Asamani G.,
RA   Hill K., Nuara J., Feder M., Rineer J., Greenberg J.J., Steshenko V.,
RA   Park S.H., Zhao B., Teplitskaya E., Edwards J.R., Pampou S., Georghiou A.,
RA   Chou I.C., Iannuccilli W., Ulz M.E., Kim D.H., Geringer-Sameth A.,
RA   Goldsberry C., Morozov P., Fischer S.G., Segal G., Qu X., Rzhetsky A.,
RA   Zhang P., Cayanis E., De Jong P.J., Ju J., Kalachikov S., Shuman H.A.,
RA   Russo J.J.;
RT   "The genomic sequence of the accidental pathogen Legionella pneumophila";
RL   Science, e1252229 305(5692):1966-1968(2004).
XX
RN   [2]
RP   1-3397754
RA   Chien M., Morozova I., Shi S., Sheng H., Chen J., Gomez S.M., Asamani G.,
RA   Hill K., Nuara J., Feder M., Rineer J., Greenberg J.J., Steshenko V.,
RA   Park S.H., Zhao B., Teplitskaya E., Edwards J.R., Pampou S., Georghiou A.,
RA   Chou I.-C., Iannuccilli W., Ulz M.E., Kim D.H., Geringer-Sameth A.,
RA   Goldsberry C., Morozov P., Fischer S.G., Segal G., Qu X., Rzhetsky A.,
RA   Zhang P., Cayanis E., De Jong P.J., Ju J., Kalachikov S., Shuman H.A.,
RA   Russo J.J.;
RT   ;
RL   Submitted (16-AUG-2004) to the INSDC.
RL   Columbia Genome Center, Columbia University, 1150 St. Nicholas Ave., New
RL   York, NY 10032, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-3397754
RA   Russo J.J.;
RT   ;
RL   Submitted (24-FEB-2009) to the INSDC.
RL   Columbia Genome Center, Columbia University, 1150 St. Nicholas Ave., New
RL   York, NY 10032, USA
XX
DR   MD5; bf10eabbf10fbedfc0f3619ba126001e.
DR   BioSample; SAMN02603156.
DR   EnsemblGenomes-Gn; EBG00001225179.
DR   EnsemblGenomes-Gn; EBG00001225180.
DR   EnsemblGenomes-Gn; EBG00001225181.
DR   EnsemblGenomes-Gn; EBG00001225182.
DR   EnsemblGenomes-Gn; EBG00001225183.
DR   EnsemblGenomes-Gn; EBG00001225184.
DR   EnsemblGenomes-Gn; EBG00001225185.
DR   EnsemblGenomes-Gn; EBG00001225186.
DR   EnsemblGenomes-Gn; EBG00001225187.
DR   EnsemblGenomes-Gn; EBG00001225188.
DR   EnsemblGenomes-Gn; EBG00001225189.
DR   EnsemblGenomes-Gn; EBG00001225190.
DR   EnsemblGenomes-Gn; EBG00001225191.
DR   EnsemblGenomes-Gn; EBG00001225192.
DR   EnsemblGenomes-Gn; EBG00001225193.
DR   EnsemblGenomes-Gn; EBG00001225194.
DR   EnsemblGenomes-Gn; EBG00001225195.
DR   EnsemblGenomes-Gn; EBG00001225196.
DR   EnsemblGenomes-Gn; EBG00001225197.
DR   EnsemblGenomes-Gn; EBG00001225198.
DR   EnsemblGenomes-Gn; EBG00001225199.
DR   EnsemblGenomes-Gn; EBG00001225200.
DR   EnsemblGenomes-Gn; EBG00001225201.
DR   EnsemblGenomes-Gn; EBG00001225202.
DR   EnsemblGenomes-Gn; EBG00001225203.
DR   EnsemblGenomes-Gn; EBG00001225204.
DR   EnsemblGenomes-Gn; EBG00001225205.
DR   EnsemblGenomes-Gn; EBG00001225206.
DR   EnsemblGenomes-Gn; EBG00001225207.
DR   EnsemblGenomes-Gn; EBG00001225208.
DR   EnsemblGenomes-Gn; EBG00001225209.
DR   EnsemblGenomes-Gn; EBG00001225210.
DR   EnsemblGenomes-Gn; EBG00001225211.
DR   EnsemblGenomes-Gn; EBG00001225212.
DR   EnsemblGenomes-Gn; EBG00001225213.
DR   EnsemblGenomes-Gn; EBG00001225214.
DR   EnsemblGenomes-Gn; EBG00001225215.
DR   EnsemblGenomes-Gn; EBG00001225216.
DR   EnsemblGenomes-Gn; EBG00001225217.
DR   EnsemblGenomes-Gn; EBG00001225218.
DR   EnsemblGenomes-Gn; EBG00001225219.
DR   EnsemblGenomes-Gn; EBG00001225220.
DR   EnsemblGenomes-Gn; EBG00001225221.
DR   EnsemblGenomes-Gn; EBG00001225222.
DR   EnsemblGenomes-Gn; EBG00001225223.
DR   EnsemblGenomes-Gn; EBG00001225224.
DR   EnsemblGenomes-Gn; EBG00001225225.
DR   EnsemblGenomes-Gn; EBG00001225226.
DR   EnsemblGenomes-Gn; EBG00001225227.
DR   EnsemblGenomes-Gn; EBG00001225228.
DR   EnsemblGenomes-Gn; EBG00001225229.
DR   EnsemblGenomes-Gn; EBG00001225230.
DR   EnsemblGenomes-Gn; EBG00001225231.
DR   EnsemblGenomes-Gn; EBG00001225232.
DR   EnsemblGenomes-Gn; EBG00001225233.
DR   EnsemblGenomes-Gn; EBG00001225234.
DR   EnsemblGenomes-Gn; EBG00001225235.
DR   EnsemblGenomes-Gn; EBG00001225236.
DR   EnsemblGenomes-Gn; EBG00001225237.
DR   EnsemblGenomes-Gn; EBG00001225238.
DR   EnsemblGenomes-Gn; EBG00001225239.
DR   EnsemblGenomes-Gn; EBG00001225240.
DR   EnsemblGenomes-Gn; EBG00001225241.
DR   EnsemblGenomes-Gn; EBG00001225242.
DR   EnsemblGenomes-Gn; lpg0069.
DR   EnsemblGenomes-Gn; lpg0302.
DR   EnsemblGenomes-Gn; lpg0303.
DR   EnsemblGenomes-Gn; lpg0304.
DR   EnsemblGenomes-Gn; lpg0309.
DR   EnsemblGenomes-Gn; lpg0310.
DR   EnsemblGenomes-Gn; lpg0311.
DR   EnsemblGenomes-Gn; lpg0312.
DR   EnsemblGenomes-Gn; lpg0313.
DR   EnsemblGenomes-Gn; lpg0315.
DR   EnsemblGenomes-Gn; lpg0524.
DR   EnsemblGenomes-Gn; lpg0545.
DR   EnsemblGenomes-Gn; lpg0555.
DR   EnsemblGenomes-Gn; lpg0569.
DR   EnsemblGenomes-Gn; lpg0570.
DR   EnsemblGenomes-Gn; lpg0571.
DR   EnsemblGenomes-Gn; lpg0576.
DR   EnsemblGenomes-Gn; lpg0797.
DR   EnsemblGenomes-Gn; lpg0881.
DR   EnsemblGenomes-Gn; lpg0972.
DR   EnsemblGenomes-Gn; lpg1185.
DR   EnsemblGenomes-Gn; lpg1272.
DR   EnsemblGenomes-Gn; lpg1330.
DR   EnsemblGenomes-Gn; lpg1600.
DR   EnsemblGenomes-Gn; lpg1601.
DR   EnsemblGenomes-Gn; lpg1856.
DR   EnsemblGenomes-Gn; lpg1857.
DR   EnsemblGenomes-Gn; lpg1863.
DR   EnsemblGenomes-Gn; lpg1864.
DR   EnsemblGenomes-Gn; lpg1865.
DR   EnsemblGenomes-Gn; lpg1866.
DR   EnsemblGenomes-Gn; lpg1878.
DR   EnsemblGenomes-Gn; lpg1879.
DR   EnsemblGenomes-Gn; lpg1880.
DR   EnsemblGenomes-Gn; lpg1929.
DR   EnsemblGenomes-Gn; lpg2054.
DR   EnsemblGenomes-Gn; lpg2055.
DR   EnsemblGenomes-Gn; lpg2056.
DR   EnsemblGenomes-Gn; lpg2174.
DR   EnsemblGenomes-Gn; lpg2290.
DR   EnsemblGenomes-Gn; lpg2291.
DR   EnsemblGenomes-Gn; lpg2292.
DR   EnsemblGenomes-Gn; lpg2362.
DR   EnsemblGenomes-Gn; lpg2575.
DR   EnsemblGenomes-Gn; lpg2715.
DR   EnsemblGenomes-Gn; lpg2746.
DR   EnsemblGenomes-Gn; lpg2747.
DR   EnsemblGenomes-Gn; lpg2752.
DR   EnsemblGenomes-Gn; lpg2753.
DR   EnsemblGenomes-Gn; lpg2775.
DR   EnsemblGenomes-Gn; lpg2790.
DR   EnsemblGenomes-Gn; lpg2973.
DR   EnsemblGenomes-Tr; EBT00001793952.
DR   EnsemblGenomes-Tr; EBT00001793953.
DR   EnsemblGenomes-Tr; EBT00001793954.
DR   EnsemblGenomes-Tr; EBT00001793955.
DR   EnsemblGenomes-Tr; EBT00001793956.
DR   EnsemblGenomes-Tr; EBT00001793957.
DR   EnsemblGenomes-Tr; EBT00001793958.
DR   EnsemblGenomes-Tr; EBT00001793959.
DR   EnsemblGenomes-Tr; EBT00001793960.
DR   EnsemblGenomes-Tr; EBT00001793961.
DR   EnsemblGenomes-Tr; EBT00001793962.
DR   EnsemblGenomes-Tr; EBT00001793963.
DR   EnsemblGenomes-Tr; EBT00001793964.
DR   EnsemblGenomes-Tr; EBT00001793965.
DR   EnsemblGenomes-Tr; EBT00001793966.
DR   EnsemblGenomes-Tr; EBT00001793967.
DR   EnsemblGenomes-Tr; EBT00001793968.
DR   EnsemblGenomes-Tr; EBT00001793969.
DR   EnsemblGenomes-Tr; EBT00001793970.
DR   EnsemblGenomes-Tr; EBT00001793971.
DR   EnsemblGenomes-Tr; EBT00001793972.
DR   EnsemblGenomes-Tr; EBT00001793973.
DR   EnsemblGenomes-Tr; EBT00001793974.
DR   EnsemblGenomes-Tr; EBT00001793975.
DR   EnsemblGenomes-Tr; EBT00001793976.
DR   EnsemblGenomes-Tr; EBT00001793977.
DR   EnsemblGenomes-Tr; EBT00001793978.
DR   EnsemblGenomes-Tr; EBT00001793979.
DR   EnsemblGenomes-Tr; EBT00001793980.
DR   EnsemblGenomes-Tr; EBT00001793981.
DR   EnsemblGenomes-Tr; EBT00001793982.
DR   EnsemblGenomes-Tr; EBT00001793983.
DR   EnsemblGenomes-Tr; EBT00001793984.
DR   EnsemblGenomes-Tr; EBT00001793985.
DR   EnsemblGenomes-Tr; EBT00001793986.
DR   EnsemblGenomes-Tr; EBT00001793987.
DR   EnsemblGenomes-Tr; EBT00001793988.
DR   EnsemblGenomes-Tr; EBT00001793989.
DR   EnsemblGenomes-Tr; EBT00001793990.
DR   EnsemblGenomes-Tr; EBT00001793991.
DR   EnsemblGenomes-Tr; EBT00001793992.
DR   EnsemblGenomes-Tr; EBT00001793993.
DR   EnsemblGenomes-Tr; EBT00001793994.
DR   EnsemblGenomes-Tr; EBT00001793995.
DR   EnsemblGenomes-Tr; EBT00001793996.
DR   EnsemblGenomes-Tr; EBT00001793997.
DR   EnsemblGenomes-Tr; EBT00001793998.
DR   EnsemblGenomes-Tr; EBT00001793999.
DR   EnsemblGenomes-Tr; EBT00001794000.
DR   EnsemblGenomes-Tr; EBT00001794001.
DR   EnsemblGenomes-Tr; EBT00001794002.
DR   EnsemblGenomes-Tr; EBT00001794003.
DR   EnsemblGenomes-Tr; EBT00001794004.
DR   EnsemblGenomes-Tr; EBT00001794005.
DR   EnsemblGenomes-Tr; EBT00001794006.
DR   EnsemblGenomes-Tr; EBT00001794007.
DR   EnsemblGenomes-Tr; EBT00001794008.
DR   EnsemblGenomes-Tr; EBT00001794009.
DR   EnsemblGenomes-Tr; EBT00001794010.
DR   EnsemblGenomes-Tr; EBT00001794011.
DR   EnsemblGenomes-Tr; EBT00001794012.
DR   EnsemblGenomes-Tr; EBT00001794013.
DR   EnsemblGenomes-Tr; EBT00001794014.
DR   EnsemblGenomes-Tr; EBT00001794015.
DR   EnsemblGenomes-Tr; lpg0069-1.
DR   EnsemblGenomes-Tr; lpg0302-1.
DR   EnsemblGenomes-Tr; lpg0303-1.
DR   EnsemblGenomes-Tr; lpg0304-1.
DR   EnsemblGenomes-Tr; lpg0309-1.
DR   EnsemblGenomes-Tr; lpg0310-1.
DR   EnsemblGenomes-Tr; lpg0311-1.
DR   EnsemblGenomes-Tr; lpg0312-1.
DR   EnsemblGenomes-Tr; lpg0313-1.
DR   EnsemblGenomes-Tr; lpg0315-1.
DR   EnsemblGenomes-Tr; lpg0524-1.
DR   EnsemblGenomes-Tr; lpg0545-1.
DR   EnsemblGenomes-Tr; lpg0555-1.
DR   EnsemblGenomes-Tr; lpg0569-1.
DR   EnsemblGenomes-Tr; lpg0570-1.
DR   EnsemblGenomes-Tr; lpg0571-1.
DR   EnsemblGenomes-Tr; lpg0576-1.
DR   EnsemblGenomes-Tr; lpg0797-1.
DR   EnsemblGenomes-Tr; lpg0881-1.
DR   EnsemblGenomes-Tr; lpg0972-1.
DR   EnsemblGenomes-Tr; lpg1185-1.
DR   EnsemblGenomes-Tr; lpg1272-1.
DR   EnsemblGenomes-Tr; lpg1330-1.
DR   EnsemblGenomes-Tr; lpg1600-1.
DR   EnsemblGenomes-Tr; lpg1601-1.
DR   EnsemblGenomes-Tr; lpg1856-1.
DR   EnsemblGenomes-Tr; lpg1857-1.
DR   EnsemblGenomes-Tr; lpg1863-1.
DR   EnsemblGenomes-Tr; lpg1864-1.
DR   EnsemblGenomes-Tr; lpg1865-1.
DR   EnsemblGenomes-Tr; lpg1866-1.
DR   EnsemblGenomes-Tr; lpg1878-1.
DR   EnsemblGenomes-Tr; lpg1879-1.
DR   EnsemblGenomes-Tr; lpg1880-1.
DR   EnsemblGenomes-Tr; lpg1929-1.
DR   EnsemblGenomes-Tr; lpg2054-1.
DR   EnsemblGenomes-Tr; lpg2055-1.
DR   EnsemblGenomes-Tr; lpg2056-1.
DR   EnsemblGenomes-Tr; lpg2174-1.
DR   EnsemblGenomes-Tr; lpg2290-1.
DR   EnsemblGenomes-Tr; lpg2291-1.
DR   EnsemblGenomes-Tr; lpg2292-1.
DR   EnsemblGenomes-Tr; lpg2362-1.
DR   EnsemblGenomes-Tr; lpg2575-1.
DR   EnsemblGenomes-Tr; lpg2715-1.
DR   EnsemblGenomes-Tr; lpg2746-1.
DR   EnsemblGenomes-Tr; lpg2747-1.
DR   EnsemblGenomes-Tr; lpg2752-1.
DR   EnsemblGenomes-Tr; lpg2753-1.
DR   EnsemblGenomes-Tr; lpg2775-1.
DR   EnsemblGenomes-Tr; lpg2790-1.
DR   EnsemblGenomes-Tr; lpg2973-1.
DR   EuropePMC; PMC1828979; 17108074.
DR   EuropePMC; PMC2257941; 18194518.
DR   EuropePMC; PMC2293231; 18281405.
DR   EuropePMC; PMC2441800; 18502777.
DR   EuropePMC; PMC2493147; 18502936.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2621349; 19165328.
DR   EuropePMC; PMC2639597; 19077205.
DR   EuropePMC; PMC2683564; 19492077.
DR   EuropePMC; PMC2725597; 19429621.
DR   EuropePMC; PMC2937693; 20592144.
DR   EuropePMC; PMC2976443; 20833813.
DR   EuropePMC; PMC3040669; 21390206.
DR   EuropePMC; PMC3096851; 20880356.
DR   EuropePMC; PMC3457500; 22820326.
DR   EuropePMC; PMC3536254; 23135949.
DR   EuropePMC; PMC3564684; 23350929.
DR   EuropePMC; PMC3565101; 23246344.
DR   EuropePMC; PMC3661481; 23717549.
DR   EuropePMC; PMC4126679; 25105285.
DR   EuropePMC; PMC4287661; 25135817.
DR   EuropePMC; PMC4579539; 26413191.
DR   EuropePMC; PMC4872527; 27196677.
DR   EuropePMC; PMC4974328; 27491976.
DR   EuropePMC; PMC5199130; 27986836.
DR   EuropePMC; PMC5812946; 29247056.
DR   EuropePMC; PMC6497169; 28714967.
DR   EuropePMC; PMC6540132; 31086119.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02057; STnc40.
DR   SILVA-LSU; AE017354.
DR   SILVA-SSU; AE017354.
DR   StrainInfo; 108917; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3397754
FT                   /organism="Legionella pneumophila subsp. pneumophila str.
FT                   Philadelphia 1"
FT                   /sub_species="pneumophila"
FT                   /strain="Philadelphia 1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272624"
FT   gene            654..2012
FT                   /gene="dnaA"
FT                   /locus_tag="lpg0001"
FT   CDS_pept        654..2012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="lpg0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /function="Replication and Repair"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0001"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26109"
FT                   /db_xref="GOA:Q5ZZK8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZK8"
FT                   /protein_id="AAU26109.1"
FT                   /translation="MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQRLILLAPNR
FT                   FVVDWVRKHFFSRIEELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKS
FT                   APKKAVDYKSSHLNKKFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGK
FT                   THLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQTNSINEFKRFYRSLNALLIDDI
FT                   QFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEP
FT                   PELETRVAILISKAEQSNIELPYEVAFFIAKRIRSNVRELEGALRRVIANAHFTGKPIT
FT                   IEFVHEALRDLLALQDKLVTIENIQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALS
FT                   KELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLMRILSS"
FT   gene            2026..3129
FT                   /locus_tag="lpg0002"
FT   CDS_pept        2026..3129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /function="Nucleotide Metabolism, Replication and Repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0002"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26110"
FT                   /db_xref="GOA:Q5ZZK7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK7"
FT                   /protein_id="AAU26110.1"
FT                   /translation="MFELTIKKEDLLTPLLTVSGAVDKKQSLAILSHFLLKLSDGLLYI
FT                   TATDLEIEMSAQVACDSKNTSGSITVPAKKFIDIIRSLDENASPSIVFDKALVTIKQNR
FT                   STFKLATLPAENYPSSEDECNDVELTIPRLVLLQLLQSTHFAMSQQDVRIFLNGLLLEF
FT                   DSNIISAVATDGHRMAISRYSCNNIAQTKLLIPKKGVQELLRLLNCINDEQVLLAAGKS
FT                   HIKLITNQFVFLSKLIEARFPPYTKAIPREQDKCIVIDCASLKRALSRIVILAHEKSKA
FT                   VLLHLQQGQLTLIANNNEQEEAIETLSAETQGDELKIGLNATYLLDVLTHFSEGQIRLS
FT                   MSNTESSILIESLVNDNYQYIIMPMKI"
FT   gene            3126..4187
FT                   /locus_tag="lpg0003"
FT   CDS_pept        3126..4187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0003"
FT                   /product="DNA recombination and repair protein ATPase RecF"
FT                   /function="Replication and Repair"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26111"
FT                   /db_xref="GOA:Q5ZZK6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK6"
FT                   /protein_id="AAU26111.1"
FT                   /translation="MILSEVRIHNFRNIASTSLILNPNFNCITGPNGGGKTSLLEALYM
FT                   LSCAHSFRSREITPIISYGQNQLNVFAHAYDESTISVQKSITDGTQIKLNNQFCCTTSQ
FT                   LAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLK
FT                   SRATYDHFIPWDQQLSQLANQLDKARNDYFLQWQPKFYQVLSDLTNISCTVEYYKGWDR
FT                   KNAGQNMEELLQKSFDSDRKKLYTQYGPHQADLIISTEQYRVKHTLSRGQQKIILIALK
FT                   LAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDS
FT                   GLFEVNCGAIKNL"
FT   gene            4482..6902
FT                   /gene="gyrB"
FT                   /locus_tag="lpg0004"
FT   CDS_pept        4482..6902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="lpg0004"
FT                   /product="DNA gyrase subunit B"
FT                   /function="Replication and Repair"
FT                   /EC_number="5.99.1.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0004"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26112"
FT                   /db_xref="GOA:Q5ZZK5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK5"
FT                   /protein_id="AAU26112.1"
FT                   /translation="MMSVDASYDSNNIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFE
FT                   VVDNSIDESLAGYCKEIFVTIHSDESITVKDDGRGIPVDIHKEEGKSAAEVIMTVLHAG
FT                   GKFDDNSYKVSGGLHGVGVSVVNALSEELHLLVRRHGKVYEQHYRHGVPESPIAETGEA
FT                   NSTGTQIWFKPSAETFSNIEFHYDILAKRLRELSYLNSGVCIHLFDERTQKKDTFHYEG
FT                   GIKAFVEHLNKNKTPVHPVVFSMTSEKDGIVIELAMQWNDGYQETIFCFTNNIPQRDGG
FT                   THMAGFRAALTRTLNNYIENEGYAKKAKVSPTGDDAREGLTAVLSVKVPDPKFSSQTKD
FT                   KLVSSEVKPAVESCVAEKFNDFLLENPTAAKSIVAKIIDAARAREAARRAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPSLSELYLVEGDSAGGSAKQARDRKFQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVATLITALGCGIGPEEYDPDKVRYHRIIIMTDADVDGSHIRTLLLTFFY
FT                   RQTRELLERGYIYIAQPPLYKVKRGKQEQYVKDDEALFDYLTQCALDGATFYPAKEVPP
FT                   ISAKSLEELVQHFRRVEKIIKRYKRRYPSDILKRVAYMPMLHQEDFNNLPKIENWCRQL
FT                   HLSLQQVDSKTEQYKVDTQKLTEGNQYTPKITVYQHGLENDIPMQVEFFLSKDYKEMVD
FT                   LGHKLSNLIEEGAYIQRGDKSLPVENFEQVLNWLMDEAKKGQTIQRYKGLGEMNPEQLW
FT                   ETTMDPEVRRMLQVSIEDAVAADEIFTTLMGDNVEPRRDFIETNALDAENIDI"
FT   gene            complement(7271..8317)
FT                   /locus_tag="lpg0005"
FT   CDS_pept        complement(7271..8317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0005"
FT                   /product="peptidylarginine deiminase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0005"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26113"
FT                   /db_xref="GOA:Q5ZZK4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZK4"
FT                   /protein_id="AAU26113.1"
FT                   /translation="MNMNTAPKQYGFYMPAEWYPHERCWMAWPCHHETWSKIGLDKAKM
FT                   AYARVAKAIAQFEPVTLLVNPGDEDSAENLCKGHNIEIISLPINDSWTRDTGATFLINN
FT                   ERQLAGVDWIHNAWGGNYADCSLDNLIASHLIKYTEAQYFHAPLVMEGGSFHVDGEGTI
FT                   LTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIGDETDGHVDEIATFIAP
FT                   GKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATYLNGERLTLSY
FT                   INFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQIDALDVFSGGGGIHCITQQQ
FT                   PKSHKLVE"
FT   gene            complement(8314..10206)
FT                   /gene="speA"
FT                   /locus_tag="lpg0006"
FT   CDS_pept        complement(8314..10206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="lpg0006"
FT                   /product="biosynthetic arginine decarboxylase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="4.1.1.19"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26114"
FT                   /db_xref="GOA:A0A572"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A572"
FT                   /protein_id="AAU26114.1"
FT                   /translation="MNNNTLSDDNLYNIENWGEGYFRINSKGNIEISKKPGKPGVELQT
FT                   IVDAADRAGLHLPLLIRCSDILHDRVHRIYQAFTQAREDTCYAGNYQLVYPIKVNQEQS
FT                   VVRELLKSPDNQIGLEAGSKPELMAVIGMLGDHQSTIVCNGYKDTSYIRTALIAQQMGH
FT                   KVFIVIEKKSELDIILKESARLQIKPTLGVRIRLVSKSAGKWENTGGVKSKFGLNAKQV
FT                   LELILQLKANDMLDCLQLMHCHLGSQIANIHDIRHCMQEVARYYIELRQLNAPIGTIDV
FT                   GGGLSVDYEGTRSNKGCSMNYSLVEYATHIMLALKHLCQEAEISEPDLISESGRALTAH
FT                   HAVLISNITDVEIINKAPVLPEISEDDSHVIRDIYDTYQAITDSSPTEIYNYAAHSLNE
FT                   AHSLFKHGVISLQEKAKVEAFYTNICMEIKDKLDEENPSEKALLMRINECMAAKIFCNI
FT                   SFFQSIPDAWAIGQIFPVAPISQLNRTLSMHSILQDLTCDSDGTIKQYPGSSCVTTTLM
FT                   LPSYDINNPYNIGFFLVGAYQEILGNLHNLFGDTNSLDVKLSDDGQFELDDLVSGDTVT
FT                   NVLNLAHFDTKKLIQSYEKQLIKSELPKEKALSYLNELRSIFSQLTYLDGNIAQ"
FT   gene            complement(10226..11083)
FT                   /locus_tag="lpg0007"
FT   CDS_pept        complement(10226..11083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0007"
FT                   /product="probable hydrolase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0007"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26115"
FT                   /db_xref="GOA:Q5ZZK3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK3"
FT                   /protein_id="AAU26115.1"
FT                   /translation="MGTLMKENKLTVALVQEQWYENPKEHQDKLASGIFSATQQGAKLV
FT                   CLQELTLSPYFCTRSDVDPAPYMEDIATGPTAQFVSQMAKSNQIHITASLFEKAGYNTA
FT                   VAFNPQGELIAVTRKQHIPSGEKYHENFYFKPGNSNYPVHTIAGHYLGLPTCYDQWFPE
FT                   LSRIYGLKGAEILVYPTAIGGEPTAPGFDSQPMWQKVMVAQGIMSNTFIIAVNRIGCED
FT                   GLSFYGSSFISTPMGEILVQAPRNEPAVLVAELDFSQRELWGRLFPFPQQREPETYHEL
FT                   VKSR"
FT   gene            complement(11612..12871)
FT                   /locus_tag="lpg0008"
FT   CDS_pept        complement(11612..12871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0008"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26116"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK2"
FT                   /protein_id="AAU26116.1"
FT                   /translation="MTFTCDELKGLEHPYEVLGNGDALAENREELNKLSNDEKLVLASR
FT                   LVLECPVNELKDFSHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNKNPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLNNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRTDVVMKIKGFCAEDSELAIKVQSALALRRDIERNLLGDNPEQFFNSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVVLPSTEEIVPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIVSD
FT                   SEEEEEKQNCWTSFCGLFGK"
FT   gene            13059..13316
FT                   /gene="hfq"
FT                   /locus_tag="lpg0009"
FT   CDS_pept        13059..13316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="lpg0009"
FT                   /product="host factor-I protein for bacteriophage Q beta
FT                   replication"
FT                   /function="Signal transduction / other regulatory
FT                   functions, Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26117"
FT                   /db_xref="GOA:Q5ZZK1"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZK1"
FT                   /protein_id="AAU26117.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
FT   gene            13329..14588
FT                   /locus_tag="lpg0010"
FT   CDS_pept        13329..14588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0010"
FT                   /product="GTP binding protein HflX"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26118"
FT                   /db_xref="GOA:Q5ZZK0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZK0"
FT                   /protein_id="AAU26118.1"
FT                   /translation="MGIRVVFERPQGGERAVLVQLALPGVDADKALAEFEELALSAKAE
FT                   VLDCVLGARATPDAKYYVGKGKAEEIAHLVNMLDADLVLVNHELSPSQERNLERLFGCR
FT                   VVDRSGLILDIFAQRARTFEGKLQVELAQLQHLSTRLIRGWTHLERQKGGIGLRGPGET
FT                   QLETDRRLLRERIRYINKRLEKVRCSRDQNRQARRKASMPTVSLVGYTNAGKSTLFNVL
FT                   TGEHTYVADQLFATLDPTMRKLELPGSSAAILADTVGFIRDLPHHLVEAFRATLEETQQ
FT                   ADLLLHVIDISDPNWRETVFEVQKVLDELKVNNIPVIQVFNKIDLQEGWQPKIDYTEDS
FT                   CKVWLSATTGAGLDLLKEAIATQLHGMILIEDIVIKPDQAKLRAQLYQLGAVLKESVDE
FT                   NGDWLMKIRITADQKRRLLS"
FT   gene            complement(14693..15163)
FT                   /gene="resA"
FT                   /locus_tag="lpg0011"
FT   CDS_pept        complement(14693..15163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resA"
FT                   /locus_tag="lpg0011"
FT                   /product="thiol-disulfide oxidoreductase ResA"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26119"
FT                   /db_xref="GOA:Q5ZZJ9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ9"
FT                   /protein_id="AAU26119.1"
FT                   /translation="MKRLIPTFIYLLVLAITPFSTHAEALLKDTFGHNIPFSSLKGKWV
FT                   FINYWASWCETCVDEIPEFNRFYKNHKNEAVALYAVNYDALPLPEQKLLIKKFNINYPN
FT                   LLKDPAQDLQLGDITGVPVTFVFNPKGQLIKKLYGGQTAKTLEKVIAENRTS"
FT   gene            complement(15332..16909)
FT                   /locus_tag="lpg0012"
FT   CDS_pept        complement(15332..16909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0012"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26120"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ8"
FT                   /protein_id="AAU26120.1"
FT                   /translation="MNTTEHTELGNGLLMDKIEGNPYLRIDEFGVLHLRLQRFGENNLP
FT                   EPMELEMSAGEIIAMAGDYFTQANWTMDLDLPKCELFNSPAELGKHLIRKPIDPKEENA
FT                   LITAYNNLAAPDVTRKEIDRIYSINNANYVPFSPTLNFYAQQLMYYFRVKDYGEMLVRN
FT                   QTHFTPWSIRVYILGHAIALRYARLSYELKQLATDRNYQSDNPDLSTLKISLQNKNETL
FT                   SSNTLLDLANRYHAQAYSIELFTFHYYSDHFATGHMSMIGDLRVVLKERFGVWGNILAN
FT                   NLHDEVNRVGVYTVRPYDPTPNTTEAPSRARGDGKFDTCLNQFNRLACLNGMTASLKDI
FT                   NQVLSGGVIPEQKKFGGLVHMPDVDFNSRQHQPLLVLSKGKVYYRNNLSQIHIISPSEY
FT                   EALRENPEKHGYKELTSKWAAFKLVTKLRLFPYLYDGSVMPVSDEKLAEIIADEKRRNP
FT                   QRAPIPTPSCLPESEPTVFDWRTKASWRNNKDSLDILDGLKKHSILAAKQTHSAIQEEE
FT                   EVRLNLGV"
FT   gene            17043..17894
FT                   /locus_tag="lpg0013"
FT   CDS_pept        17043..17894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0013"
FT                   /product="pirin-like protein"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26121"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ7"
FT                   /protein_id="AAU26121.1"
FT                   /translation="MVIKMKAMEVEQLIQGTLIRDGGGVKLRRYIGADKTNHFEPILLF
FT                   DYFDSSDPLDYLAGFPPHPHRGFETITYLMEGSITHEDNKGNKGVINAGGVQWMTAGKG
FT                   IIHSEMPSSSTDRLHGLQLWLNLPAAEKWREPRYQEKSSDQLPIEVMESGATIKVIAGR
FT                   IDQGLSSPIVEIATRPLFLDITLPANATIQQTIPDDYQAVLFVIEGTVNTGGQQITAGT
FT                   LASLTNGERIQIEGKDKENRNHCLLIAAAKLHEPIVRYGPFVMNTQEEIMQAIHDFRTG
FT                   HF"
FT   gene            18331..19542
FT                   /locus_tag="lpg0014"
FT   CDS_pept        18331..19542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0014"
FT                   /product="transmembrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26122"
FT                   /db_xref="GOA:Q5ZZJ6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ6"
FT                   /protein_id="AAU26122.1"
FT                   /translation="MSLEVEPKPHGNNPYANRFDNLPLKDQGRFPRVAYVLQGGGSLGA
FT                   YQFGVVKGLLEAGYEPDWIAATSIGAIQAAIIVGNPPEKRVEKLERFWDEIAPGNFFDF
FT                   LGESDITLDFYNKLSAACALLFGQPEFFFPKWCTGTIPLWGDPTTLSYYDTTPLRKTLL
FT                   DLIDFELLNSCPIRLSLGAVQISNGHLIYFNNINYRIEVEHIMASAALPPGFPAVNIDG
FT                   ELYWDGGVHSNTPLEVILEAIPAENTLCFLIDCFGGRSFIPKNMSEIEERRKDISYGTH
FT                   AQRTIYNYLQRQKMRNSMMELSRILTDEQKKESAHLLDIGSPHHCTLVHLAYSSRIVKA
FT                   ASKDYNFGRVVIKKRMEAGYSDAKAVLAEESQWGYLPEDGKSRLYESPNNLSRLFRKRK
FT                   KEVF"
FT   gene            19643..20716
FT                   /locus_tag="lpg0015"
FT   CDS_pept        19643..20716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0015"
FT                   /product="multidrug resistance protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0015"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26123"
FT                   /db_xref="GOA:Q5ZZJ5"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ5"
FT                   /protein_id="AAU26123.1"
FT                   /translation="MKEKFATWYKIVTKHIRFFFSYSIPMFFKKAKNYINLPIIVVGLA
FT                   LIIGLFHLFSYLIPFTDNAFVVTNVTPVAADVSGFITEIYVKNGQKVKKNDPIFSVYRV
FT                   PYELAYQQAMADYKEGLKKIDVFQKQIERTVALIKATDAELEKAQFALGLKKNKNVAEA
FT                   VSVLELKNLGYDVSTLSNKRNALQQEVAVLQAKIEQQRHTVASLKAKMDNAKVNLDLTI
FT                   VRAPGDGVIDNMYVSPNTPIEIHKPVFSFIDTANYYIQANFNETDLRNVRQGDKAYIIL
FT                   RMYYFDKIFHGVVVNSLWAAERQSTAPKSQIQVVTNQNEWLLLPQRFPLQIKILDPDPD
FT                   YPLNPGASAYVYISTKR"
FT   gene            20676..21623
FT                   /locus_tag="lpg0016"
FT   CDS_pept        20676..21623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0016"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26124"
FT                   /db_xref="GOA:Q5ZZJ4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ4"
FT                   /protein_id="AAU26124.1"
FT                   /translation="MAPVLMFISQLKDKLASYDRYKEHRINGLKAVFVLELMIIFYFFS
FT                   SIDNPYFYYFYAPITCFTVEAAGTTLKEKYMLLLYTLLGSILSIFLFGIISVYNVLFIF
FT                   FVFFYTLALYFLVLHHFKKMLVIVPLMLSLASYSLIYGVEADSNFYIAINNALYTLAAM
FT                   AVIFAGLFIFPKKYYFDIWERAFLEVITGLESLSAKICKGEVKTIAIFSGIIVMERYSK
FT                   MLPRNIKCYSILKITILSFELILTMSYLLSFQKQLRKEYVIVLHHYLERLCQSCKARQP
FT                   LILSDQELPAFKETHELEILYQLILSWNYLCADG"
FT   gene            21596..22513
FT                   /locus_tag="lpg0017"
FT   CDS_pept        21596..22513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0017"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26125"
FT                   /db_xref="GOA:Q5ZZJ3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ3"
FT                   /protein_id="AAU26125.1"
FT                   /translation="MELLMRRWLGVQAFSYVELRSIQISTVFAFTIFVQEWLRYPRAGW
FT                   TGFAVMMIYAGFDNGTTIFRTYHRFLGVLLGLFTGYLLWFVGHLDYRTLILIMPLMVFF
FT                   AFFLVGRAYSVPTVFTVNVSVLGSGYFSTEDTLPVTYFIIDYTLCTLIAFTIILGFEYF
FT                   WFRHYGLMQRFIKSTQAEVIDDLYRLVRLLNQGKIKKTEWFQACIKLTDSLFEVNKLIT
FT                   NSQFLISSEHAVGDEFNQFVELANRIFIGLKALYMAYYTKHYHTFDYYQLFQQVQKDLV
FT                   RLKDFVAGEQTIDLSEGVKHATSG"
FT   gene            22497..23882
FT                   /locus_tag="lpg0018"
FT   CDS_pept        22497..23882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0018"
FT                   /product="outer membrane efflux protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26126"
FT                   /db_xref="GOA:Q5ZZJ2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ2"
FT                   /protein_id="AAU26126.1"
FT                   /translation="MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDS
FT                   KNIPYIAWWRDFKDPTLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLM
FT                   TGYSRNPATGFPGVLIVFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQIA
FT                   ASYFTYLAEIERKEFLQTLANDLTQLAKVASKVYQGGLSSEIEQEELYSQVNLIQGELE
FT                   VTERNIVISRNALRYLLNQNPGEIKTVKKLLQLKNRKLIPGSLPLTVLENRPDMQVAEN
FT                   RLRASHEGIGVAESNLLPTIQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVL
FT                   GAVAKAKGVNKVSYYNYIDTLQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLN
FT                   DRLYQTGIQSYIETLNSKISLDKINISLNQDKLQELLSIVRLYQELAGGYRANLESEIK
FT                   SSV"
FT   gene            24111..25793
FT                   /locus_tag="lpg0019"
FT   CDS_pept        24111..25793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0019"
FT                   /product="hemagglutinin/protease, zinc metalloprotease"
FT                   /function="Toxin production / other pathogen functions,
FT                   Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.24.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0019"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26127"
FT                   /db_xref="GOA:Q5ZZJ1"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ1"
FT                   /protein_id="AAU26127.1"
FT                   /translation="MCMLKKTMFFILSISASSIFAADNVDLYQAPLNSINKYPILQTPK
FT                   NAIILKSSSAVIDNSLQKLNQTKEDNQMIVRYQQLYKGIPVIGAQVMITKGTDSGVQSN
FT                   DNAEVNGHLLENIELNTKPAISAQQAKEYAKKSYFQFSSQSNIQQETAELQIRPDHNNQ
FT                   LKLVYLVSFKSVQQDGKPDWPFFVIDAQTGALIKQWNNIKNYLDTGPGGNEKVQEYWYG
FT                   KDGLPALDVTQNGSQCVMENSKVKLVNLHSQWDWENTINTPFEYVCNNNIEENINGGFS
FT                   PGNDAYYFGHVIVGMYKDWYGLNALQHSNGAPMQLVMRVHFGQNYDNAFWDGQAMSFGD
FT                   GLDFYPLVSLDVAGHEVTHGFTEQHSGLEYHDQSGALNESLSDMAGQASRAYLLEKNPQ
FT                   LYNKAYLQPNEVTWGIGETIVRDSYGKALRFMDYPSSDGSSADCLDKGIAQNNGSYCAI
FT                   SYDEVVAYANTHIALPQERQSFIVHTASGVFNKAFYLMSKDMGIKNAYHIMVVANTKYW
FT                   TPTTDFKNGACGVIYAARDLNTDINKVKSAFGQVGIDTAGCVI"
FT   gene            26016..26927
FT                   /locus_tag="lpg0020"
FT   CDS_pept        26016..26927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0020"
FT                   /product="integral membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0020"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26128"
FT                   /db_xref="GOA:Q5ZZJ0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZJ0"
FT                   /protein_id="AAU26128.1"
FT                   /translation="MAFFLITLCILILSFFCLAVMVLKFIQQPSLPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIYMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
FT   gene            27119..27598
FT                   /locus_tag="lpg0021"
FT   CDS_pept        27119..27598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0021"
FT                   /product="alpha helix protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0021"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26129"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI9"
FT                   /protein_id="AAU26129.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   VDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSVTASFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
FT   gene            27595..29718
FT                   /locus_tag="lpg0022"
FT   CDS_pept        27595..29718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0022"
FT                   /product="hypothetical protein"
FT                   /function="Nucleotide Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0022"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26130"
FT                   /db_xref="GOA:Q5ZZI8"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZI8"
FT                   /protein_id="AAU26130.1"
FT                   /translation="MNYSLFISCSKGLEYLLEDELKGLGLHVTQVSPQGVYGEASLPVI
FT                   YNLCLWSRLANRIQLILFSGHATKEQAVHQLCTDFHWQTVFTHDKTIAIEFHGASEQIR
FT                   NTMFGAQIVKDGIVDHFRRLNGSRPSVDKEKPQILIHAHLKNDILTVSFDLVGYSLHQR
FT                   GYRKKAGKAPLKENVAAAMLLRAKWPELAAQGYSLHDPFCGSGTLVIEAAMMAAHIAPG
FT                   LLRQDQSLQYWARHQSSLWEKLRTQALQQVKPLAVKLIGTDADSKIITLARSNAERAGV
FT                   LPLVEFNTLSLNACRPGTKRGLVVCNPPYGERLGEVTQLVPLYQELGTTLHTCYQGWQA
FT                   AILTSSPVLAKALGLRADKQYTLYNGPLECKLYCLTLSAANKLKNTPNAPLSDNAQMLF
FT                   NRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYAVLQEYAPPASIPVHKA
FT                   EKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGSEQYQKIGKTSQRLIVTEGKAKLIVNL
FT                   YDYLDTGLFLDHRLMRLKFAQLEPGTRFLNCFCYTASASVHAALAGALTTNVDLSKTYL
FT                   LWAEDNFRLNDINLSKHQFLQYDCKEWMKTTRDKFDVIFLDPPSFSNSKRMSDILDIQR
FT                   DHVSLINMAMRLLNPDGVLYFSTNLRQFKLEPMLKEKYAVQDITPQTIDQDFKRNSKIH
FT                   HCFKIVMPHFADN"
FT   gene            complement(29788..30330)
FT                   /locus_tag="lpg0023"
FT   CDS_pept        complement(29788..30330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0023"
FT                   /product="transmembrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0023"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26131"
FT                   /db_xref="GOA:Q5ZZI7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI7"
FT                   /protein_id="AAU26131.1"
FT                   /translation="MKSFIEQAQFYATYHQNQATRYTHMAGVPLIMLSIMIFLGFVKIV
FT                   IPGVYATDLACLATLATLIYYFLLNWQLALALTPILIFLLWLASWFNYDGPTKFGLWVF
FT                   IITFVVGWGLQFYGHFIEGKKPAFMVNFTQALIAPLYLTAELFFMAGLMNSLREQIYGN
FT                   EEVNTEEISKTKTKSKS"
FT   gene            complement(30477..30902)
FT                   /locus_tag="lpg0024"
FT   CDS_pept        complement(30477..30902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0024"
FT                   /product="hemin binding protein Hbp"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0024"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26132"
FT                   /db_xref="InterPro:IPR032540"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI6"
FT                   /protein_id="AAU26132.1"
FT                   /translation="MMLKTQLTAFIGAVILAGSSLANPIKPEVCPSVPSIQSEGMSMSS
FT                   EILEGMYITYNLSHYNTSSSWVFIVGPIAAENDDMALAESNKLLSTMSGSPHPEDDGEG
FT                   NWICQYTTKSKDIIAFAIEADDMLSPLKMMRYLRTIR"
FT   gene            complement(31042..31614)
FT                   /locus_tag="lpg0025"
FT   CDS_pept        complement(31042..31614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0025"
FT                   /product="Rcp"
FT                   /function="Toxin production / other pathogen functions,
FT                   Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0025"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26133"
FT                   /db_xref="GOA:Q5ZZI5"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZI5"
FT                   /protein_id="AAU26133.1"
FT                   /translation="MKRLISCLTIICALNASAAAETTSNPCSRWISFLKPVCQRIHQTW
FT                   TEGHDDMYFSGYAWHNRYVYSNEKIKSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDS
FT                   HRHLEPAVGYAYLKTASVNKDLKAGLGYSVLVTSRVDYDNVPIPGALPWAALFYKRITI
FT                   AATYIPGSSREGHENGNVLYMLGKISL"
FT   gene            31774..33165
FT                   /locus_tag="lpg0026"
FT   CDS_pept        31774..33165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0026"
FT                   /product="amino acid permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0026"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26134"
FT                   /db_xref="GOA:Q5ZZI4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI4"
FT                   /protein_id="AAU26134.1"
FT                   /translation="MDLFRKKDIKGSLDNESHLAKCLSVFDLTFLGVGAIIGAGIFVLT
FT                   GIVAATISGPAVIFSYVVAGFACAFAALSYAELAASIGGCGSAYGYAYAGFGELIAWIV
FT                   GWDLLLEYSIAVSAVSIGWSGYANDFLMALKIFIPTHLLHGPADGGDLNILAILIIAVL
FT                   TTLLIVGVKSSSRFNNIMVLVKLLVIFIFIAIAFGEVKVENWSSFMPYGWAGVMKGASI
FT                   IFFAYVGFDAVSTAAEEAINPQRDLPIGIIASLAICTVIYILVSGLLTGIAHYTTLNVS
FT                   SPISHVLLVLGYKTAAGLVGVGAIAGLTTVMLVLFYGLTRVFLAMSRDGLLPRFLSKTN
FT                   EHTKTPIRIILLCGILMASLASVTPIGTLAELVNIGTLFAFIVVCGGVLYLRRTHPDME
FT                   RPFKTPFMPYVPILGIISCFYLILNLPWVTILRFIIWMAVGMAVYFAFSRGNSALSVEG
FT                   DCAAE"
FT   gene            complement(33175..34170)
FT                   /gene="pit"
FT                   /locus_tag="lpg0027"
FT   CDS_pept        complement(33175..34170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="lpg0027"
FT                   /product="low affinity inorganic phosphate transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0027"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26135"
FT                   /db_xref="GOA:Q5ZZI3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI3"
FT                   /protein_id="AAU26135.1"
FT                   /translation="MDYNTIFILFVIFIAFVFDFINGFHDAANSIATIVTTGVLTPRQA
FT                   VLWAAFFNFIAFLIFNLTVAQTIGYGLIDTDLVDTYFILAALMGAIFWNLVTWYYGLPS
FT                   SSSHALIGGLAGAAIAKGGLSSLKITGFAKVAAGIFISPVLGLLIGLLFTHIFSLFLRH
FT                   KNEEELNTLFKSFQLISSALLSITHGGNDAQKTMGIIAVLLFSASWLDGVFYVPFWVVI
FT                   SCHGVISLGTLAGGWRIVHTMGTKITKLNTLKGCAAETGAAITIFAATEFGVPVSTTHT
FT                   VTGSIAGVGLISGIGGAHWKVLRRIFYSWLLTIPAAALVAAAIVNIAPTA"
FT   gene            complement(34187..34900)
FT                   /locus_tag="lpg0028"
FT   CDS_pept        complement(34187..34900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0028"
FT                   /product="ubiquinone biosynthesis protein COQ7"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0028"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26136"
FT                   /db_xref="GOA:Q5ZZI2"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZI2"
FT                   /protein_id="AAU26136.1"
FT                   /translation="MINDFKLHTNQVNIETLHFIFKVSMRTSSFLDRLIGEVDSALRTL
FT                   VLPQKRITTRQSPAENLADTVLSAQEKKHISGLMRVNHAGEVCAQALYQGQALTARLTH
FT                   IKEQMASAAAEEVDHLAWCEERLYELGSKPSLLNPIWYCGSVLLGALAGLAGDKVSLGF
FT                   VAETERQVTAHLQRHLHYLPEKDKKTIAILKRMQEDEEHHAHTAMEAGAVELPYIIKQL
FT                   MNAVSKLMTQSSYYI"
FT   gene            35024..37981
FT                   /gene="rre41"
FT                   /locus_tag="lpg0029"
FT   CDS_pept        35024..37981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rre41"
FT                   /locus_tag="lpg0029"
FT                   /product="sensory box (GGDEF/EAL domain) regulatory
FT                   protein"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0029"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26137"
FT                   /db_xref="GOA:Q5ZZI1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI1"
FT                   /protein_id="AAU26137.1"
FT                   /translation="MIGVGLNWHMIDKMRKSKKPHPLNHIASGDNFSHLNLLERGLISQ
FT                   LIELSYDENTLHTLSLSGLKLLGKHPLLKNTITAVWHHDGSHINILASNGLKFDAPKEL
FT                   EKFLAVVSDWHFLKIYKTKLKKHCEEKLKQRIDICLDKYQDNLFCISFWFDSIDCNFEM
FT                   LMPFFKDILGLLNLSLAKLMNKKREKLLTTILEKAGDSVEITNEEAVIQYVNPAFENIT
FT                   LYNAREAMNKTVASLLRSPVEDAQLFEEINQTLKSGNTWKGQIRSRKKDGSYWVAQTII
FT                   VPVMDDELGRITQHIAIKQDITEQVHRFNQLKISEERYRNLMNAVADGIFIHNLQGAFL
FT                   EVNEAACLSLNYSREELINSYVWDIEVGFSQESLNQLWENVQKGPINTEGMHRRKDGTT
FT                   FPVDVRLAVFNATGEKLVLAIVRDITLQKRSEATIRKLTRALEQSPVLVIITDKTGTIE
FT                   YVNAKVIEQTGYRKEELVGGNTRILRSGQTPHEIYKTMWEHLANGEEWHGELLNKNKSG
FT                   EHFWVSAIISPIRNDNEEITHYLAVMEDVTQKKSYEEMLKHQATFDNLTNLPNRLYAVN
FT                   KLERAISKSHINNQKLAVLFLDLDEFKQINDSLGHAIGDLLLKALSERFLSMIRQTDTI
FT                   ARLGGDEFMMILENIMQDKDAESIAKKCREICSQPFVIESQELLVSTSIGIAIYPEHGK
FT                   DAKTLMRNADTAMYQSKIRGKNNWTVFQNTMIEGANNHIRIKTELHQAFTRNELYICYQ
FT                   PIIELKENKVVAAEALLRWQNTTLGQINPDQIIPLAEETGMIIPLGYWILDKVCTQAKE
FT                   WEFITGSKIKVAVNISTLQLKQKDFIHKVQLILKRTKLSADSLIFEVTESAFIDDSKFI
FT                   LSQLNKLSDMGIHFSLDDFGVGYSFLQYIKSYPFKNLKIDRVFIQGVNTNHNELSLINS
FT                   IITMARNLKLSVIAEGIETAEQLELMRSMNCDMVQGWYFSKPLSGDKFLFYLMNK"
FT   gene            complement(38093..39007)
FT                   /locus_tag="lpg0030"
FT   CDS_pept        complement(38093..39007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0030"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26138"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZI0"
FT                   /protein_id="AAU26138.1"
FT                   /translation="MLCNGSLLMKTEALLSWLNVESNESYDSIRIKYQLRLEALEKEER
FT                   IKKMGGINPFAPKIPLNNPRIITSKEIQEAWAAIDSLSKYQQFKGLVAQEENLSTIPNK
FT                   KMDSKREETKLTHFVRERAQGPRGRRLPAHLQAKIKRVSLDKPHSKLITEGAEQQINAI
FT                   LDKTTLSVSDLQSAVYTAVQNYTNYHMKSENKNNPKYNRGQGDGFFSFFRHGSFGITTA
FT                   NNLYTSINAKNATLDETIEKLKDFLGHSSRAYHHHSFTSYLADALAEKGLLTSHPASRY
FT                   KQEDVVNQLDQWIAQNSTVNFLK"
FT   gene            38113..38232
FT                   /locus_tag="lpg0031"
FT   CDS_pept        38113..38232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0031"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH9"
FT                   /protein_id="AAU26139.1"
FT                   /translation="MSFVLSIGQADSLRLLVYTGWQDGMLIVPSQQVHQPGKM"
FT   gene            complement(39042..40235)
FT                   /locus_tag="lpg0032"
FT   CDS_pept        complement(39042..40235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0032"
FT                   /product="leucine aminopeptidase"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0032"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26140"
FT                   /db_xref="GOA:Q5ZZH8"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="PDB:5GNE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH8"
FT                   /protein_id="AAU26140.1"
FT                   /translation="MVFKSRLVGIILLCFSSITGWCLSQSPEEDRIIVSNCLYEQLKDK
FT                   ARLIAQSDHFSFIAIPIDENITNTLQKMRPVCGNYLNAEPYIQQTSNRFLDSKKLLDKL
FT                   TSYHSISTANPYPINHEAQVHSLFEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWF
FT                   KQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMP
FT                   GADDDSSGISVELEMARVVFSSNFELNRPIYFIAYAAEERGLIGSGYVVQDFLQKKIPV
FT                   KAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKTPVGYTKCGYACSDH
FT                   VNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN"
FT   gene            complement(40298..41323)
FT                   /locus_tag="lpg0033"
FT   CDS_pept        complement(40298..41323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0033"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26141"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH7"
FT                   /protein_id="AAU26141.1"
FT                   /translation="MGWTDRFWNAYRVVTNTVIEGAANSLNAAGSLACLLGGAGVSLSY
FT                   SMSETIKAGYFGSVGVAGTVNLDVTAVEFNYGFNQTIPFRRDLLEKSDGGSYALNDFAN
FT                   PGTIFMISSLAILSGTTLRTFGANLKKWQQNREDKHHFITKYGTDLEPPSYKEYLHVNA
FT                   ESFFNSLAIASFSSLLAKNVLDFSIKDLSKYHFTYPFNGTNITGSVKTPDYTGPVTSEF
FT                   FPLDFFVSQNTTIHTDYLNLIVNEKVKANAMTNVTYGGGVHLEPNHQSSAPLLAASATI
FT                   GISTYLAGTFFGKKILRERDERLQHSRSSSYSIVSGTFWDNKHDIEAKGDTKFEHSHSL
FT                   Q"
FT   gene            41587..42348
FT                   /locus_tag="lpg0034"
FT   CDS_pept        41587..42348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0034"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0034"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26142"
FT                   /db_xref="GOA:Q5ZZH6"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH6"
FT                   /protein_id="AAU26142.1"
FT                   /translation="MKLHSISTNKMRLIISMWLIYLFAVLFLVASLFTMLILMMEYTLV
FT                   CKNKQYHLAKECVLHSRIYNLYHSSTELGDLKAAVVKSSRSSKGNTLYYVDLLTAQGPV
FT                   NLTGSSSSGRDDKEIAANSINNYISNSLETTFKVSYPASWWMYGLSVFFLLVGALLLTV
FT                   RGAITDFDRILKTIVIKRKGLFKTEETKLSFSDVDKIIVEESLGSRGTKTYRLAIALKD
FT                   KPPIPLVTTYDSSFAKKEKIANQLNQFIHEN"
FT   gene            42476..42832
FT                   /locus_tag="lpg0035"
FT   CDS_pept        42476..42832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0035"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26143"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH5"
FT                   /protein_id="AAU26143.1"
FT                   /translation="MSKFFTLLICISIGLLSFPTYAQKTIRLSPNETKTLKNSTLWTLN
FT                   ATCNVQSSTKVNGKIKIIVLKNNGKVNGKSLSTGQGTFITIKNNSSISVSAESGTQINL
FT                   INLGNQELQAVCST"
FT   gene            complement(42891..43613)
FT                   /locus_tag="lpg0036"
FT   CDS_pept        complement(42891..43613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0036"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0036"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26144"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH4"
FT                   /protein_id="AAU26144.1"
FT                   /translation="MNYQYSPNLKKKFLLALTTLFIVQMFYFATVRASTRDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRVGENISQLSQLILRPGIGYELLPTTTIWLGYDRIYTAQ
FT                   PFANPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRATHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFHLNDFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSMALLLTE"
FT   gene            complement(43827..44570)
FT                   /gene="artJ"
FT                   /locus_tag="lpg0037"
FT   CDS_pept        complement(43827..44570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artJ"
FT                   /locus_tag="lpg0037"
FT                   /product="arginine 3rd transport system periplasmic binding
FT                   protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0037"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26145"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH3"
FT                   /protein_id="AAU26145.1"
FT                   /translation="MVRLRIYLCSLLLVIPFYRAYALNLTIGTLSYNPPFETQVNDSSK
FT                   KNEFYGFEIELMDEICERINAKCQYKPLLFEQILAEINSGAINLGIGSINITPERSERF
FT                   LFSLPYKASYHQFLIPSNSNIKKIDDLKGKTIGIHLGSPTADYLKAYFNNNIQFKYYET
FT                   FMDLLNGLTDPQVSAIVTNSDQAQYWASSTPDCKLLGDSFPFGVGFGVVARLDQAELIE
FT                   KINQALIEIENDGTYLKIYNLFFQP"
FT   gene            complement(44731..46254)
FT                   /gene="legA10"
FT                   /locus_tag="lpg0038"
FT   CDS_pept        complement(44731..46254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legA10"
FT                   /locus_tag="lpg0038"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="4921520G13 gene product; conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26146"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH2"
FT                   /protein_id="AAU26146.1"
FT                   /translation="MLMAATIPHIETITFTDWFLAIIDTPDIPIDEIEIRVAEGFKRKL
FT                   TERQFQQLTELIHLISFIKHKKISNPTLALRIYVDENTSSLSRTALVEAVRMLPPEDNK
FT                   TYELAAYLAQKNKLERYTNITKVPPLQIYQGDGVFEQYDEWILLFELFGLTQATPSDFI
FT                   PAIAHLLITKNLGIPDLRALSKFMSTTHKLGILSQSFMNNMTPHLCNGQIIEKYESLLL
FT                   KLQINDLLTEEILEVIYPLLNQPDALDAFFSLYHEEPSHDSALSFLREILPSFCAMSLP
FT                   SKESYDDQVPTNTPLHLAVIESDKGNLERTLAFANRNLLIKCSYENTALLLACKLADKE
FT                   SARLILAKMQELGCDVNQRDHHGMTALHWANFYHFDELIRELEIAGADPQLKAANGKTC
FT                   EYFYQHQFTLKDLKLNGKEIIDGEFKLSDCALTDIAFHMDKIALNLKLTTPSEIAELYA
FT                   RDEIAQIRSSNRFYLFFKLFRPKLINWLEKQNDLEPQVTYRFSGQSSSA"
FT   gene            46638..46994
FT                   /locus_tag="lpg0039"
FT   CDS_pept        46638..46994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0039"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26147"
FT                   /db_xref="GOA:Q5ZZH1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH1"
FT                   /protein_id="AAU26147.1"
FT                   /translation="MLVFGLPEILIVLAIALLGKEVYGLIEQKIKNILFKEKVSKTRYR
FT                   LGLVFFAFPLVIGLLEVFVKEITLAYGSYYYWVEIIWTTMFALSFFICGKQFWDKFKSL
FT                   FIYDSYVVFEKNKK"
FT   gene            complement(47016..48011)
FT                   /locus_tag="lpg0040"
FT   CDS_pept        complement(47016..48011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0040"
FT                   /product="integral membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0040"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26148"
FT                   /db_xref="GOA:Q5ZZH0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZH0"
FT                   /protein_id="AAU26148.1"
FT                   /translation="MDPITHGALGAACAQAALGKYDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLIVALFLLCFSQYRQYWKITIGASLVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVIASLFFCI
FT                   LFLIFNTILHNRAVDGIHQYATTNNFKINHPRALPKLASSTYWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRQALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDNPIFSLWGIEILPGQEHINKLSLPKINEYCESPDSERYKEDGLN"
FT   gene            48185..50431
FT                   /locus_tag="lpg0041"
FT   CDS_pept        48185..50431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26149"
FT                   /db_xref="GOA:Q5ZZG9"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG9"
FT                   /protein_id="AAU26149.1"
FT                   /translation="MILLNLMGFTMIRTFLTAFLMLLCSLALAQEKVVTQFFKEVNSSI
FT                   AISEGKANIQASRYRVVDIDVNQLYAELENAPHRDGISTGIPLQLELPQPDGTVKRYQV
FT                   MENSTLAPELSTKFPEIKTYDAYGIDNPGELVKFDLTPQGFHAMILSPGRDTVFIDPLI
FT                   KGNTQYYMIYYKKDFITSKKMKCGVKNQNQPLINAASKRDFTDFNPCVLKKYRLALAAT
FT                   AQYTQFHGGTVPQALAAEATTVNRVNGIYEIDMAITMQIIANNNLIIYTDPNNQPYTSG
FT                   DPDKMIGENQANIDKEIGAANYDIGHVVDAAGSGLAQTPSVCINGEKAMGVTGQSNPVG
FT                   DPFDVGYVAHEIGHQFGANHVQNNNCQRNNPTAVEPGSGSTIMSYAGICDPNVQDDSDP
FT                   YFNGISLQEMGNFVSDATHTCPVKTSIPSAPVIQGTNGGVKIPAQTPFALTATATKSGG
FT                   NEALTFAWEQQNNEASQQPPVSTSRVGPNFRSFSPQVSGTRYFPNLNALANNGPFTWEV
FT                   LPSVSRTLKFRVTVRRNTPGGSCNAYTDTTLSVESKAGPFVVTNPTESGITWTGISPRT
FT                   VTWDVANTNLPPINARFVNILLSIDGGQTFPFTLLSNVDNTGSEVICVPNLNSSTARIM
FT                   VQASNGTFFNVSKNNLTIIPVPPRPPELTRADRNPMDTSKAFILYANCIPTGNDVYTVN
FT                   GLPPGATVRFDANNRRFIIENINTPKRVRNVTITATDENGVSRTSNAITIPSIL"
FT   gene            50444..51145
FT                   /locus_tag="lpg0042"
FT   CDS_pept        50444..51145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26150"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG8"
FT                   /protein_id="AAU26150.1"
FT                   /translation="MNRYSIFFLIFCTLSLESHASLYSGINLGINAVKINKNLVYPLED
FT                   PVPTTSSFNSAYTDFHGQLIAGYDFSLAPKISAAVEANIDLFTGKAKHRITEWYFNEDV
FT                   YAEEQLKVGYSLFLLPTYHLNNMVQFFVGPGVSSSRFNIAFSNTAGNVGVSDSLNEWLT
FT                   GISIKAGSITKLTRNIDLLLTYQFTQYNSVTGVQMEPLSEDTLRGSYKPNVNTVLIGFK
FT                   VHPSDEITKDT"
FT   gene            complement(51460..52320)
FT                   /locus_tag="lpg0043"
FT   CDS_pept        complement(51460..52320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0043"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26151"
FT                   /db_xref="GOA:Q5ZZG7"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG7"
FT                   /protein_id="AAU26151.1"
FT                   /translation="MVSYLFSEVHFTHALKKVLGISVLVGVYSAIIYFWFEQDNLHSSN
FT                   WLSYSQSVFGIILGLLLVFRSNRAYERWWEARTLWGQLVNASRNLAIKIRILLSPNADE
FT                   AKKFSELINTFCEVLAIHLRQKSTRDDFKKFLKMVSLPNHVPSYVAQELYRELSEKTKA
FT                   SKRLNLWLLDNEFSKFMDICGGCERIKNTFISLSFRVFVKHVFIIFILFLPCSLIDTLG
FT                   VWAIPATIIITYLIIAIEGIARNLEEPFGLTEDHLNLSAITESIRESVNEVLLGQKSNE
FT                   ESNSI"
FT   gene            53049..53924
FT                   /locus_tag="lpg0044"
FT   CDS_pept        53049..53924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0044"
FT                   /product="hypothetical protein"
FT                   /function="Lipid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26152"
FT                   /db_xref="GOA:Q5ZZG6"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG6"
FT                   /protein_id="AAU26152.1"
FT                   /translation="MDSLDLDFYAITRAFLFFSLIGLMVVLEYFFSFHRLGKAGVRRRR
FT                   VSNWYLGIVNIIVALPLSTLTTAAYCEYYQIGLFNLLKVPFGLVFILWFIIYDLYVYLF
FT                   HRLSHATFLWHFHKIHHSDKSLNVTTSFRFHPVEYILFNALKIVLIILLGPYFFVILVS
FT                   DFIQAILVFWGHSNIALNAKLEQALSRIIITPRYHVMHHTQDECRRNYAAGLTLWDYLF
FT                   HTQTEPLWNKDDINKLTLGVQTKTNWSEFKNLLLINKLIHFLGRLQFVYFKFPLITIGV
FT                   AVIFGIVEFY"
FT   gene            complement(54060..54272)
FT                   /locus_tag="lpg0045"
FT   CDS_pept        complement(54060..54272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0045"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26153"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG5"
FT                   /protein_id="AAU26153.1"
FT                   /translation="MKSTNNMQKKETDKPTSEQEQKKEVRRNNAPDFIPGASPYYNLYC
FT                   FFYKLCHGEDTSRQHQPATSFQHGK"
FT   gene            54482..54880
FT                   /locus_tag="lpg0046"
FT   CDS_pept        54482..54880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26154"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG4"
FT                   /protein_id="AAU26154.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKIFSVFPAGTSINKTTVKEICFTDI
FT                   FCDTHPFVWYYYPEHNLAIWTSRLAGTTQEYPADYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQGHQMIPIRNNESWRYIKSSSFSMS"
FT   gene            55046..55741
FT                   /locus_tag="lpg0047"
FT   CDS_pept        55046..55741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0047"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /function="Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0047"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26155"
FT                   /db_xref="GOA:Q5ZZG3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG3"
FT                   /protein_id="AAU26155.1"
FT                   /translation="MSSFKFLNEQDMKPTDKKHWSKIEYLHQSVKNPNIHIKGKHSYYS
FT                   DAWTGSFEETVVRYLYGDEYSLQTWQPQWQIDQLYIGDYVCIAAEVIILLGGNHNHRAD
FT                   WFCLYPFADKYVEAYQGKGDTIIKDGVWLGMRAVIMPGVTIGEGAIVAASSIVTKDVEP
FT                   YSIVAGNPAKPVKKRFAENVIERILALGIYSWSEAKFNLLKDYICSNNIDKLEQASRSY
FT                   DQNHTIESK"
FT   gene            55738..56616
FT                   /locus_tag="lpg0048"
FT   CDS_pept        55738..56616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0048"
FT                   /product="acetyltransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26156"
FT                   /db_xref="GOA:Q5ZZG2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG2"
FT                   /protein_id="AAU26156.1"
FT                   /translation="MINIRKLRLGDESTLETFLKSHADESMFLRSNLYHSGLSYHDKPF
FT                   HGDYFAAFDTNKKISGVLAHYWNGNVIVQCPDFNVLTALVGTFQKAATREIAGILGEDQ
FT                   QADVVMKQLQLEHVDYAVNYPDGLYALNLQNLAMPGNQDRYQLKVAKDCDKCLLYEWLR
FT                   AYQIEALGAEEDSSILKEQVESEVKSTLEGNDRWVLEENGTPVSLCSFNARLSDIVQVG
FT                   PVWTPVTLRGRGYARTVVALSLSAAQKSGVSRAVLFTNNQAAVRAYQAIGFNKVGNYRL
FT                   AILKKPILLTR"
FT   gene            56651..57964
FT                   /locus_tag="lpg0049"
FT   CDS_pept        56651..57964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0049"
FT                   /product="amino acid transporter, permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0049"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26157"
FT                   /db_xref="GOA:Q5ZZG1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG1"
FT                   /protein_id="AAU26157.1"
FT                   /translation="MIGNKTMDMDIKHKPLKRELSLFGATMMGLGSIVGTGVFVSIGIA
FT                   AGVTGPSVILAIALAALVATCNAFSSAQLAANHAVSGGTYEYGYRYLHPAFGFTAGWMF
FT                   LCAKSASAATAALGFAGYFIHLSGLETVPVIPIALAVSITLILLVLSGLRRTNTVNIII
FT                   VMITLITLTVFIISGLPDFMQRGTANLRPFFPVSKQEGLSHFFYATALMFVAYTGYGRI
FT                   ATLAEEVKNPGKFIPAAIIITLMVSAVLYILVGLVAIGAVGVEKLAQVTETNATPLESA
FT                   ARAIGIPGLSVLVSIGACTAMLGVLLNLILGLSRVALAMGRKGDLPKMFCYVSETRHVP
FT                   VSAVIGVGVVIIALVLTGSVETTWTFSAFTVLIYYAITNLAALHLPKEEQLYPPLFAIG
FT                   GLLSCLFLAFWVPIGVWITGISLLFLGLLWKVVANRFL"
FT   gene            58028..58894
FT                   /locus_tag="lpg0050"
FT   CDS_pept        58028..58894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0050"
FT                   /product="integral membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0050"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26158"
FT                   /db_xref="GOA:Q5ZZG0"
FT                   /db_xref="InterPro:IPR025509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZG0"
FT                   /protein_id="AAU26158.1"
FT                   /translation="MIDGIMVLWFILLMLSLAFIAYDVREMPIDWVQKLGWVLVVAYTG
FT                   PLGLFFYFLTCRSPGKGLHALYTKAQWKQAVNSEVHCLAGDATGIIFAAIFLSFIDLSN
FT                   GVELILEYISAFFFGWVIFQAGMMRSMYSSYGEALRKTFFAETISMNFVMMGMIPVMMI
FT                   LMNTLDYGRNPAHLQFWFIMGMATVVGGFLAFPINNWLVKKKLKHGCMTLPEGDEQIEG
FT                   HMTHHHGGHEEHLQAQAKRIGSKVIHGHTHEMGSLPLNIQLKYIGISFGVLLIIVLIMA
FT                   FFVPLKI"
FT   gene            complement(59382..59864)
FT                   /locus_tag="lpg0051"
FT   CDS_pept        complement(59382..59864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0051"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26159"
FT                   /db_xref="GOA:Q5ZZF9"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF9"
FT                   /protein_id="AAU26159.1"
FT                   /translation="MWLDYLHNINSDPNLLYLFIRTFIIYVFAIFIIRVGNTRFNFETA
FT                   FDYIFVFVIGAVLSRAINGNSTLISAMAGSSLLIFLHWIFALCSFYSHGFGKLVKGKSV
FT                   LLIQDGQLIWSALKRHQVTEEDLRQVFREKLNASDLTTVKEARLERTGRISFITYK"
FT   gene            complement(60077..60970)
FT                   /locus_tag="lpg0052"
FT   CDS_pept        complement(60077..60970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0052"
FT                   /product="carboxyphosphoenolpyruvate phosphonomutase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="4.1.3.30"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0052"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26160"
FT                   /db_xref="GOA:Q5ZZF8"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF8"
FT                   /protein_id="AAU26160.1"
FT                   /translation="MSNFRYSQGKKLREALMNEKPLQVVGTINAYTALQAKRAGFHAIY
FT                   LSGAGVANASYGLPDLGITTLNDVLEDVRRIMSAVDLPLLVDIDTGWGGAFSIARTIKE
FT                   MIKAEAAAVHIEDQVQAKRCGHRPGKALVEKEEMIDRIKAAVDAKTDPDFVIMARTDAL
FT                   ANEGLNKALERISAYIEAGADMIFFEGVRKLEEYQALTEQCNVPVLANITEFGVTPLFT
FT                   LEELEEVGVSLALYPLSAFRAMSAAAEKVYDTIRKNGSQNDILAEMQTREELYQVLNYH
FT                   FYEDKLNELFMKEKTT"
FT   gene            complement(61096..61830)
FT                   /locus_tag="lpg0053"
FT   CDS_pept        complement(61096..61830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0053"
FT                   /product="transferase enzyme"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26161"
FT                   /db_xref="GOA:Q5ZZF7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF7"
FT                   /protein_id="AAU26161.1"
FT                   /translation="MLNKLMWLTGKAQEDWIEKILHLRQKIWPDYQRIKNDTLFKLYSH
FT                   YPLYQWLSHYNGEVVAVINSLPVALDQSLDNLPQEGLNWVLSHLESTTPLTQSNYLAAV
FT                   SVTVNPAYQRLGLSKLLLNRLKASAQEAQYKALIVPARPSQKENYPLISLEDYLKWKRV
FT                   DNTIFDPWLRVHAQLGGKIAYPCQRSRVITANVAQWEQWLGHPLLQTGQYLVKGGLNPI
FT                   TINKEKDIGIYIEPNVWVIHDL"
FT   gene            complement(61823..62557)
FT                   /locus_tag="lpg0054"
FT   CDS_pept        complement(61823..62557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0054"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26162"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024477"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF6"
FT                   /protein_id="AAU26162.1"
FT                   /translation="MELILILTGGFMIREYMDKRNNQFTTEILNYFSDLKKFSTSYLEW
FT                   ITMEHYQFSLNNTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLD
FT                   VTNRIPYVATRQFFMRLEALIVINASKTLGVMYATETAAIFEHILFKEISAELCQRKGL
FT                   DFENSRIKQFHDLHLDGVEQAHKDELGKFMDHTLAEEHVDPNIFLQEKEIMDGAYAAID
FT                   IMEDWWSGLINAKAHLLEQAHA"
FT   gene            62628..63536
FT                   /locus_tag="lpg0055"
FT   CDS_pept        62628..63536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0055"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0055"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26163"
FT                   /db_xref="GOA:Q5ZZF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF5"
FT                   /protein_id="AAU26163.1"
FT                   /translation="MINFSQIQVFITIVESGGFIAAGEKMHRSQPAITNAIKKLESSLG
FT                   FELFDRKVYRPQLTAKGKAFYQKAREVVAQFMQLENSAETLRSGVETQFSIDLDIALPL
FT                   PGYAPLIQSFIRQYPETCFSLSNNTFVRCLERLERRECHLCIAASHIRSPQIEYLRMPS
FT                   IRMIPVASRDYYDQHKERINNPKLGIYCMQIMIAGTQQELYQLKIEPLSHSMPKWLVGD
FT                   MYIRKQLILSGMGIGRLPDHLVEKELAEGSLVQLNTRDYVAVTMDIYAMRLNNQEHGMV
FT                   SNYAWQSLKSYAEDTVSPDLK"
FT   gene            63669..64400
FT                   /locus_tag="lpg0056"
FT   CDS_pept        63669..64400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26164"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF4"
FT                   /protein_id="AAU26164.1"
FT                   /translation="MDIIMIDFKINSQPDDESCGPTCLHAIYQYYGLDISYEEVANQVE
FT                   SFLSGGTIAPMLGKHALQLGFKVTLYVNNLQLYDPTWFNSDGSSNTDVLREMLMQQMRY
FT                   KRNQYLARGTHAALDFLTLGGAIYFRCLTAEILKEYFARQIPILTGLSSTYLYNCSREL
FT                   FNNEGKSRSDPIRGLPCGHFVVLCGYNQKHRLVVVADPYKKNPVSGDNYYTVSIHRLIN
FT                   AIMLGVVTRDGNLLIIEPKNS"
FT   gene            complement(64673..65077)
FT                   /locus_tag="lpg0057"
FT   CDS_pept        complement(64673..65077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0057"
FT                   /product="putative regulator, MerR family transcription
FT                   regulators"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0057"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26165"
FT                   /db_xref="GOA:Q5ZZF3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF3"
FT                   /protein_id="AAU26165.1"
FT                   /translation="MNNKKIGEFAKLCGVGIETVRYYQRQGLLHVPLLNKELGAEKIRR
FT                   YGDDDISRLKFILLAKKAGFTLKEIKELLEFDAKNDRERVRDMAERRIEKLNLKINELT
FT                   EARNRLSLLVTKCIETSSSPCPILMTFEKS"
FT   gene            65147..65890
FT                   /locus_tag="lpg0058"
FT   CDS_pept        65147..65890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0058"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0058"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26166"
FT                   /db_xref="GOA:Q5ZZF2"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR009908"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF2"
FT                   /protein_id="AAU26166.1"
FT                   /translation="MNHTSIKKAVLYRMVIEHHVCPYGLKARDLLRRQGYEVEDNWLTT
FT                   REQVEAFKDKHNVKTTPQTFINDERIGGYDDLRRYFGKKVRDPKEKSYRPVIVLFAITA
FT                   LMAMAVSYTRFANPFTPHALSWFIAFSMAVLALLKLQNIESFSTMFLNYDLLAKRWVPY
FT                   SYIYPFAEALAGILMIAGALNWLSIPIALFIGTVGALSVFKAVYIDKRELKCACVGGDS
FT                   NVPLGFISLTENLMMIGMALFMLLM"
FT   gene            66075..67181
FT                   /locus_tag="lpg0059"
FT   CDS_pept        66075..67181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0059"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26167"
FT                   /db_xref="GOA:Q5ZZF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF1"
FT                   /protein_id="AAU26167.1"
FT                   /translation="MQFCQMSKEIKKNLQNNNSAFVYLRSTGLATNSLSSILQYMTRII
FT                   VLTESAGIALGILGVLFSVIGFVSSTIARILDPTASKLSRVMSAGILIAAAAGAIPLIY
FT                   LGTLFPAMWVYLGIGIMGFGILNSSYYLYSDVRKESALINQYKDNPEQYVESIKEKRQA
FT                   KYEKLLNTRLDDKQARVLLVFKLYQLDKKLAFAKQEGPARLYDIVCHRKHTRSLERFID
FT                   LGTSLTSLIVGVSGLFWGIAAWPIGPILLGISLAVFSVSLSKSAIQFYRKVNKNNALLK
FT                   EVLSNDRYVSLIDANLDNPYDIEEMGTVEKTQEKVCTHELSQESALSKDQEHKEHYTKL
FT                   FQPVNKTALRPNDEETDELSCKPVLLQR"
FT   gene            68096..68767
FT                   /locus_tag="lpg0060"
FT   CDS_pept        68096..68767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0060"
FT                   /product="methylase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26168"
FT                   /db_xref="GOA:Q5ZZF0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZF0"
FT                   /protein_id="AAU26168.1"
FT                   /translation="MYLVNEPITKQWIERYSKLSESLDPIYFAENDRQISYDKIRDKIL
FT                   TELETHNFITVVLYGHPTVFADPGLQSIIIAQKKSIETIVLPGISVENCLYADLKIDPG
FT                   QFGCFHVEATELLLYDKIIDPTVHLCIWQPGMIGNRSVPKPNQKSNHLELLRIKLKKYY
FT                   PDDHISILYEASMYPGVEPIIHKFPLYDIEDQNIGTLSTLYIPPLPQRKPNLDILKQIT
FT                   S"
FT   gene            68797..69975
FT                   /locus_tag="lpg0061"
FT   CDS_pept        68797..69975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0061"
FT                   /product="multidrug resistance protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26169"
FT                   /db_xref="GOA:Q5ZZE9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE9"
FT                   /protein_id="AAU26169.1"
FT                   /translation="MLSVLSYRLSLLPKLSKTCYLLLLFSFLECVAGGIAYYLSLYLGT
FT                   STPLTKLQIGQVGSIVGFGALAGALCSTYITDKLNNKNIIIASFLFLGLGFFCLPQSMS
FT                   FLLISGCVFIIGFATSIFLTTNNTLLLQNAPQDQNSLRFIQSMKIVSENLGNSFSILLI
FT                   MFFAAQYYGQIFEVIGLFFFLFALNTMKYLNVKQNSLEDSSYEEKETNQQGNNKRLYVT
FT                   ISAVFIVGIIYAQQRIAYPLFLHEAFSSFTITAILFWLDPIIVSLFQVKITKIVSPLKI
FT                   SHQLAIGGLLLGTGLFALLIVDSIGGAIMACLTFILGEMLFMPTSFVRCYESAGNKRKG
FT                   MVAGAWRSAYSSGLIVGPVLSGFLMEYYSYNACWILAGILGFFLFILFSVKK"
FT   gene            complement(69976..71334)
FT                   /locus_tag="lpg0062"
FT   CDS_pept        complement(69976..71334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0062"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26170"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE8"
FT                   /protein_id="AAU26170.1"
FT                   /translation="MIRIGTYYLISCTKMLAIKKVFWTDIRNIMKTINPVFFELVDKLS
FT                   PDNKFAMYLVDYGYGDLVGDDDGIFLPTKTGQYVRLDSEYTPPSILNDLAYGLTNSPLG
FT                   VFFNKSFEWFLNTSDEQINRTFPIYIDPPGTFFSIGHIINYGYTATHLPNGVLFVTAGS
FT                   KSNFMIPKIGCGIMHSRIQKNHNITKSAPRSYHEHADIFQDIVKGNRDNNGWSASVLYF
FT                   SENWIEKISKDSAWQEVRDYFYRISNHRSEYAVNSDYYNHVYRVTNKRNNLKSNLLIYE
FT                   TARHLFEILLGAKLGFAPAMDDELLPLSIIQEVYSECYKLEYLPIIAIPAYYNYRDPKP
FT                   VYYSLQYPSLCSYSPKARNASTTLSDLIALIDVVHKYQKDFTLPIRECKNTILEEVSKI
FT                   TSFNFYHPATEENSIIKSPEIIPYQDERFRGEKRFPINASFFKGCVSIFSNSI"
FT   gene            71489..72676
FT                   /gene="aroH"
FT                   /locus_tag="lpg0063"
FT   CDS_pept        71489..72676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="lpg0063"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="2.5.1.54"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0063"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26171"
FT                   /db_xref="GOA:Q5ZZE7"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE7"
FT                   /protein_id="AAU26171.1"
FT                   /translation="MFKSVQQRTIQNGQVIPFYHSTNELAHIQNILQSQTPLVSLKEIN
FT                   KFRQLIARASVGEYFLIQSGDCAENFYECDKDTTHAKLDFIRHLATFFHQKTGCSVIQV
FT                   GRIARQYAKPRSNQYEICQNKRIYSYFGGMINQSQETQRRPNPWRILLSYNCSASIYRK
FT                   INQWNRGINPEQKIYTSQEAFLFNYEQSLTRWDERTGLYYNLSTHFPWLGKRTVSSLQH
FT                   INHLKKIANPIAVKIGPDTPIKNLVKVINELDPSYIPGRITLIPELGAQNVYHILPQLI
FT                   DAVKRTDRTVLWSCDPMHGNTETLSSGIKIRKLSNIVEEIKNSFFIHRKMGSQLNAIHL
FT                   EATHQNVTECMDYKSSHCESISDLKKNYKNLLDPRLNYAQTLHVIQCVAKYYANS"
FT   gene            72782..73708
FT                   /locus_tag="lpg0064"
FT   CDS_pept        72782..73708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0064"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0064"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26172"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE6"
FT                   /protein_id="AAU26172.1"
FT                   /translation="MSSLKNEYYKRTQKEKDFQNYNGKELKKIHLFMNKIYHQILFGDK
FT                   PIDNKVFHEFKKYESSWMANEKNYFLTKYDCNVIVKDESLVRGVLQKQEVFNHPIFDYL
FT                   MHDASIEDLKKFAYSESIMNLEFFDYLALAVIGVSAQAKVEIMANLWDEAGQGCAEKFH
FT                   TVLFQNFLNDLGITYDRKQILEDLSWEGVAGINLFNYFSIYPFNKTKYFGMLAATEMLD
FT                   PPHYNKLIKGIMRIFSSHNIDHSYYTEHELVDAQHASGWLNHVVIPELARKPYKTQDFW
FT                   LGFYMRLDSTKKYYDQLLNSLIMKKAA"
FT   gene            73714..74535
FT                   /locus_tag="lpg0065"
FT   CDS_pept        73714..74535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26173"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE5"
FT                   /protein_id="AAU26173.1"
FT                   /translation="MMSYMLVSNEKVIAEEWKKYAGYTVRPLPSTCAYYKDLIQSNSNK
FT                   DSFLIYGGTPEIRSLFQESNLKVTLTDQSELIIRAMGYLTMGAASIAANEELVVTNWLN
FT                   LEGIANDSCDFLIGDDAINMVEWTQFDLFLSNANRVLKSNGLFICHLLVKPQECFITNT
FT                   IDDVRREYKEGVIRTKYDLASRLNFICYDTNSYAMGWQNTIEQLGINQLDQFKPSFDFV
FT                   GTFGRCNSKFYCPPQDAFERLLNNYFHIEEVFYPHEYEYCQFEPVYVLRKK"
FT   gene            74426..75856
FT                   /locus_tag="lpg0066"
FT   CDS_pept        74426..75856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0066"
FT                   /product="phosphoribosylglycinamide synthetase ATP-grasp
FT                   (A) domain protein"
FT                   /function="Amino Acid Metabolism, Nucleotide Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0066"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26174"
FT                   /db_xref="GOA:Q5ZZE4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE4"
FT                   /protein_id="AAU26174.1"
FT                   /translation="MHLSVYSITISILRKYFIHMSMSIVSSNQFMYYVKNSIRNLHMSI
FT                   HLINYTTQPEFIKLIVQEYKNFDLTKKTILFIEPYGAVLSLLRRGLEKKYNIIVLTANS
FT                   DFRVVPEEFLNQAALNINIDTANNNSVLELAGTLQQHMSIDAVIPGFEYFVPIASRVSA
FT                   LLKVPGIDCKHVLNLRRKDLMRAALNKAGLNSPRYYLVTSLDDINEAVDYIGFPAICKP
FT                   IDAAGSVHVKKVKNKKELLEAANRILNGNDVLWGHKLSSSLLLEEYIDGKEYSLEGTVQ
FT                   DGVIAHFSTTEKFVSDQSEFIEIGHIVNAPIEQQLHTKIQNYIDQVIKILGADNCPFHA
FT                   EVRLRRDGEPVLMEIAARLAGDKIADLLCLSRGINYFDYVYAAYLGIKMPLVEMKNNYA
FT                   GIRFFYRPHTDMFTIVTGMDAAKLQTIEDIAIYYNAHVAIPEFPKPLRRLGHVIAKSED
FT                   YNKLSKMLHDIDSDIHFN"
FT   gene            75853..76467
FT                   /locus_tag="lpg0067"
FT   CDS_pept        75853..76467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0067"
FT                   /product="YdeN-like"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0067"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26175"
FT                   /db_xref="GOA:Q5ZZE3"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE3"
FT                   /protein_id="AAU26175.1"
FT                   /translation="MIKIKENRMSQSNVIIVHGAYGHPFENWFNWMKTELESLGIECFV
FT                   PQLPTPDGQELKNWLHVFNSTVSPMITHDTILIGHSLGSAFLLRWLEQANQSVFSTILA
FT                   GSFIGTVGIQKFDKINESFFENGFDWHSIINKSKQFFCYHGSNDPYISRSNFNFIANNL
FT                   QARKIIISQGGHLNEAAGFSSFPQLLIQLKSLLGINYGKFI"
FT   gene            76451..77398
FT                   /locus_tag="lpg0068"
FT   CDS_pept        76451..77398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0068"
FT                   /product="transmembrane protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26176"
FT                   /db_xref="GOA:Q5ZZE2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE2"
FT                   /protein_id="AAU26176.1"
FT                   /translation="MANLFSFLFLGTLGWGMSLYLMKILLVSLTPTEIVLYRMAIGAAS
FT                   LFILAKLFKLKTDNIRGLILDGIIVGTFNMTLPFYLTTYAVKTVSSSLASVINGLTPLC
FT                   TLILGMVFFSSKQKLGVLNLLSIVLGFIGIIIINSDVSIYQGSAVEFIALLATTISYGV
FT                   TANYFKYHARTKEPILVSAVSAFVSAITMLIFKCATESSINSWGIPQGMNQIIALLWLG
FT                   IIGSGFCLYLYCSLIQNAGAVFASMITYLMTITGVIMGMIFLHETISHQVMIGCIFIFF
FT                   SLILVNHAPLLEKILVSISRQISLKSARRYELNQ"
FT   gene            complement(77507..77582)
FT                   /locus_tag="lpg0069"
FT   tRNA            complement(77507..77582)
FT                   /locus_tag="lpg0069"
FT                   /product="tRNA-Asn"
FT   gene            complement(77642..78820)
FT                   /gene="aatA"
FT                   /locus_tag="lpg0070"
FT   CDS_pept        complement(77642..78820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="lpg0070"
FT                   /product="aspartate aminotransferase A"
FT                   /function="Amino Acid Metabolism, Energy Metabolism,
FT                   Biosynthesis of Secondary Metabolites"
FT                   /EC_number="2.6.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0070"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26177"
FT                   /db_xref="GOA:Q5ZZE1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE1"
FT                   /protein_id="AAU26177.1"
FT                   /translation="MDIALAKRVQKVKPSPTLAVAAKAAQMKAQGLDIIGLGTGEPDFD
FT                   TPQHIKLAAISAIEAGDTKYTAVDGIVELKEAVKNKFKRDNELDYQLNQILVSVGGKQS
FT                   CYNLCQAYLNPGDEVIIPAPYWVSYPDMVLLADGVPVIIETTPAQRYKINAQQLEQAIT
FT                   PKTRMIFLNSPSNPSGIAYTQNELKELGDVLKKHPQILIATDDMYEHIIWSQPFTNILN
FT                   ACPELYDRTIVLNGVSKAYAMTGWRIGYAAGPAPLINAMKTIQSQSTSNPCSIAQRAAV
FT                   AALNGSNESIEEMVNAFHQRHDYVADRLQSIDGIEVIPADGTFYIFPSVQAIIEKRGYA
FT                   NDIEFSEKLLNEVGVALVPGSAFGTEGCIRISFATGIDTLKDALNRLQRFCS"
FT   gene            77828..78052
FT                   /locus_tag="lpg0071"
FT   CDS_pept        77828..78052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0071"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26178"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZE0"
FT                   /protein_id="AAU26178.1"
FT                   /translation="MHTGKNVESSVGGDDLYAIDALQSIGHVVVPLVEGVHHFFNAFIA
FT                   AIQSGYGSSLGYGAWIGCGLGLNGFHRID"
FT   gene            78867..80858
FT                   /gene="uvrB"
FT                   /locus_tag="lpg0072"
FT   CDS_pept        78867..80858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="lpg0072"
FT                   /product="excinuclease ABC subunit B"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0072"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26179"
FT                   /db_xref="GOA:Q5ZZD9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZD9"
FT                   /protein_id="AAU26179.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKVELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPEALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTITGSMQRALTETERRREKQKA
FT                   FNLEHGITPKGINKSVEDILEGAYIGKRKTVVAEKSPQYTHWSPQELVKQINALEKQMY
FT                   SHAQNMEFELAAKIRDEYLLLKEQLMKI"
FT   gene            81213..82814
FT                   /locus_tag="lpg0073"
FT   CDS_pept        81213..82814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0073"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26180"
FT                   /db_xref="GOA:Q5ZZD8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD8"
FT                   /protein_id="AAU26180.1"
FT                   /translation="MNIKSNLAYSSVILKGHVNRYAFLGLLISVGSILIASCIVSYQLT
FT                   GSVSLGGFIQAQRSNPAIWILDLTPFMFVYWGQAFCYGLVNKAESLLVDKTKELLNISG
FT                   NLELKLKYDSLTNLPNNRLLNEKIRLAIEQLGSQGELAVIVIKINDLNYNFSSFNTNNI
FT                   VKQFAEKLKSVLIDPYMLKASLGINMVARLQSDEFAILMPRLKKDLEINELLIHLLTLL
FT                   NSNLMVDGININLATTVGAAIYPIHGEEDDVLLNHAIIAVYQARKENKSYAIYSPEMEE
FT                   DLINNRIVMNELQRSIENKDLKIYYQPIVELANGQIVGAESSARFEHPELGLLSAEKFM
FT                   PLIEGTSLIHNLTTLMLKEVIKQLAAWHDAGHKIFVSANLSVNRGLPDLIEKLLNDYEI
FT                   APQFLKLEFTERTCLAEQMVTSEVFERLSTMGIKLCIDDFCSENSSFIYLTDFPIENIK
FT                   VEKSFVLKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIADQNALEKLRDLGCLYGQGLY
FT                   FSRAVNVAEFTSLLKK"
FT   gene            complement(82906..84477)
FT                   /locus_tag="lpg0074"
FT   CDS_pept        complement(82906..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0074"
FT                   /product="glutamate synthase"
FT                   /function="Energy Metabolism, Amino Acid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0074"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26181"
FT                   /db_xref="GOA:Q5ZZD7"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD7"
FT                   /protein_id="AAU26181.1"
FT                   /translation="MRRQWYIGFGVILLCLFALFAMLQDIVWFFAFLIPIVILWIYDVL
FT                   QTKHTILRNFPVLGHVRYFLEFLRPEIQQYFIATDESELPFNRETRSMIYQRAKNVRDT
FT                   IPFGTERDILSVGYTWALHSLSPKHSSEVEPRIDVGGPDCKKPYNASRLNVSAMSFGSL
FT                   SANAIMALNKGAKLGGFYHNTGEGGLSPYHLQGGDIVFQIGTAYFGCRDDKGDFDENEF
FT                   IKEASRDEVKMIEIKLSQGAKPSHGGILPAAKLTEEIAKVRKVPMGKDVLSPIAHTAFD
FT                   NPVGLLHFVKRLRDLSGGKPIGFKLCLGRRHEFMAICKAMLKTNILPDFITIDGAEGGT
FT                   GAAPVEYTNFIGTPLEAGLVFVHNALIGTGVRDKIRVICSGKVTNGFDLLTNIALGADI
FT                   CNSARAMMMAIGCIQSKQCNANTCPTGVATQKKRLQYGLVVDQKKFLVANFHNNTIKSF
FT                   LEMVGALGLNNPSDLKPSHIMRRIGVDEVKSFDQIYTYVKPGQFLQGDIPEDYRIHWEH
FT                   ANPDKF"
FT   gene            complement(84555..84869)
FT                   /locus_tag="lpg0075"
FT   CDS_pept        complement(84555..84869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0075"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26182"
FT                   /db_xref="GOA:Q5ZZD6"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD6"
FT                   /protein_id="AAU26182.1"
FT                   /translation="MTNIKLCKIKLLNKIYEIKCPDGEEVSLILAAEKLNEKMQNNKNK
FT                   FKHLDNFHILLLAALDIGHELIVCKNEQEQQRLQVTQFISSLENKINKAVVGSETDSNP
FT                   "
FT   gene            85025..85606
FT                   /locus_tag="lpg0076"
FT   CDS_pept        85025..85606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0076"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0076"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26183"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="PDB:4GYT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD5"
FT                   /protein_id="AAU26183.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLMEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
FT   gene            85693..87021
FT                   /gene="pepP"
FT                   /locus_tag="lpg0077"
FT   CDS_pept        85693..87021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="lpg0077"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.11.9"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0077"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26184"
FT                   /db_xref="GOA:Q5ZZD4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD4"
FT                   /protein_id="AAU26184.1"
FT                   /translation="MKREIDMISQQEYKARRKKLAAQLPDDSVAVIPAAHEVLRSGDTH
FT                   YRFRQDSDFYYLTGFNEPDALLVIIAGKDSQSILFNRPRNPAEEQWTGKRLGQDGALQE
FT                   LGVQAAYPLSSITEELPKLFSGKSAIYYDLGRNLSLEKKIRHVLSSLKAQVRRGIKAPE
FT                   SLCDLEPILSEMRLLKSDAELELMRQAARISVAAHKRAMQVCQKMEYEYQLEAELIYEF
FT                   SRHGCRSVAYDPIVGGGANACILHYTENNKPLRRGDLVLIDAGGEYGSYAADITRTFPV
FT                   SGTFSPEQKIIYELVLKAQKAGIAAIEPGLPWNHIQQTIIRILTEGLCDIGILKGDLEE
FT                   LIKNEAYKPFYMHNSGHWLGLDVHDVGRYKINNEWRPLEAGMVLTVEPGLYISAGMEGV
FT                   DKRWWDIGVRIEDDILVTRAGYEVLTGDLPVNVDDIEALMRGE"
FT   gene            87011..88213
FT                   /gene="ubiH"
FT                   /locus_tag="lpg0078"
FT   CDS_pept        87011..88213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="lpg0078"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="1.14.13.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0078"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26185"
FT                   /db_xref="GOA:Q5ZZD3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD3"
FT                   /protein_id="AAU26185.1"
FT                   /translation="MANKETDILIIGGGLTGASLSLALQGLGFSVTLVESRPYSDKVNP
FT                   DFDARSLALSPASQRILAMLGVWEILKEYTTPIHMIHVSDQHRFGASRLHGEKNSPLGY
FT                   VVEMQYINRALSILINKEHLLTPAALKSIDFNNSTATVAHGDDMISIRAQLIVAADGTE
FT                   SMTRYLCNLPVKIKDYAQDAIVANVGLIKPHGNRAFERFTPNGPLALLPMMNDKMSLVW
FT                   ASKPEEAKRLVMLNDDDFLRELQTAFGYRLGRFGKVGKRYSYPLKQVLMPQQTKWPVVF
FT                   VGNAAHTLHPVAGQGFNLGLRDIAALAQCISQKGLNPQMLEHYLQLRAHDQQMITWLTD
FT                   GLIHLFTSRLPGMGVARNLGLLALDNIPALKNLLARYARGFGGITPDLVCEIALSAGEF
FT                   Q"
FT   gene            88210..89373
FT                   /locus_tag="lpg0079"
FT   CDS_pept        88210..89373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0079"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0079"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26186"
FT                   /db_xref="GOA:Q5ZZD2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD2"
FT                   /protein_id="AAU26186.1"
FT                   /translation="MSQHFDVLVIGGGIVGLTAALAMAQRHYTVAVIDAGTLMVNTDKS
FT                   DLRVYAINKASKMLLSELEVWQHLNDARVAPYNKMHVWDGVSGAYIDFDSRSIAEPNLG
FT                   AIIEESILKQALLRRISSESKISLFPQSVIDEVCHLERSIKISGQNTAWEGQLLMIADG
FT                   ANSPMRHKLKVDVTSWSYEQQALVATVSSEKSHQNTAFQVFHPDGPLAFLPLSNLNQCS
FT                   IVWSTHADNAMRLKLLDDNEFSRELTKAFGGQLGQIKVVSSRHQFPLQMRHVKQYAGHR
FT                   WLLLGDAAHTIHPLAGLGLNVGLADVKSWLTCLEMGKDELISKKVLGAYQRERKHSVWQ
FT                   IILLMEGFKRLFGTSASPVTSLRSLGLRACNEFIPIKRLFMRQASGL"
FT   gene            89551..90318
FT                   /locus_tag="lpg0080"
FT   CDS_pept        89551..90318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26187"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD1"
FT                   /protein_id="AAU26187.1"
FT                   /translation="MNRLKFFSKFHNALLKFESSISNLSDPLVGFKIKELQTKKILVRA
FT                   DGRSLDHLHKLGGLPQRVDSEKLEKVRITDVERYQKFNLNPFGWGACASTEDLRQFLET
FT                   YPELTKQAWVHKFYGSSTSLLTLKSEVGIGCGEHDGEKEELVVDSVSFGQIIASTCPKY
FT                   RDKYLDGGVVPNAMKDFNPKVPETMKLGDFSSEKSTLEWLLINDCEEEFAKLCKEVYGD
FT                   TPLKILLRRFDGDQYLADAVTYYVKESSLSPRV"
FT   gene            complement(90308..91633)
FT                   /locus_tag="lpg0081"
FT   CDS_pept        complement(90308..91633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0081"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZD0"
FT                   /protein_id="AAU26188.1"
FT                   /translation="MRSKFFSFFTRASRPMKAIPPKIWFETQLKGSGLDKKFQIDELIE
FT                   TQSSVRVFANKKYLPDTETINEALTKVTAVNVSGDKSGYFQNGLPFPNEAGYFEKIPVG
FT                   HPELLSPIERLTGSKKIVSSHSLVTASGGYPLTNPLLPYRKPIRVSIFSLAGPSFENNY
FT                   LHYRLFLLDSVQKIIDSPLFSHLHDGLPIQFDEAKKELGEYDTNKLMARIRLGFPYLAR
FT                   FSSGGFYPSFSKSNAIIFLSEAYFRYQLEDVSLLLASVNQTGKETGKAALLKATAVGMG
FT                   FFAKIDCGYDIQHIIFPYYLRAYKKLLSEHKFPWIAKIEFPIFNEIQQEQFDSIFEDYD
FT                   GPTKVYRSTRDVLEFREEEIEKYLPAAINPSDAFALTGNEWGYGSVESMIGNNSSIRFD
FT                   QVHHMNPLILDPSHHVEAQINKDHGVELTVNPRPQSSSSIKL"
FT   gene            91808..92371
FT                   /locus_tag="lpg0082"
FT   CDS_pept        91808..92371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0082"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26189"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC9"
FT                   /protein_id="AAU26189.1"
FT                   /translation="MSQIKTHVLKLIVDLFAKCICFAIMQYIDDLNGEFMFGRLWLRLP
FT                   VNKPTLDLSKMVLGRMPAETTFESVKREFEQELRRVGLKRFQENIHAEQLILEQLLKQR
FT                   EEMTKKIDEKCLRPALQRSENGYDVTGLYWSRMQGELSKIQSKKERVELDETIDWLYAR
FT                   RRFLKEQNNLSLNKEPAHSASPAL"
FT   gene            complement(92368..93315)
FT                   /locus_tag="lpg0083"
FT   CDS_pept        complement(92368..93315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0083"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme"
FT                   /function="Protein fate / hydrolases / secretion,
FT                   Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0083"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26190"
FT                   /db_xref="GOA:Q5ZZC8"
FT                   /db_xref="InterPro:IPR011758"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR039523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC8"
FT                   /protein_id="AAU26190.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKESGQESTLDKVSFCRKEFAR"
FT   gene            complement(93312..94835)
FT                   /locus_tag="lpg0084"
FT   CDS_pept        complement(93312..94835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0084"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0084"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26191"
FT                   /db_xref="GOA:Q5ZZC7"
FT                   /db_xref="InterPro:IPR025838"
FT                   /db_xref="InterPro:IPR025840"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC7"
FT                   /protein_id="AAU26191.1"
FT                   /translation="MKNNKRHVYGLILTLLLLGSGIFLYRHIVLDVPLTDTETINSWMV
FT                   ESNLRFTADRNTPIKASFNIPYLPPNFAILDEYFVSRNYGVTTNLNGSNRETVWSIRRG
FT                   NGPQSLYYRAIFRQTDSDESSLPKPSVTKSQPLNDSQKSAVETITNQVRSTSADIQTFA
FT                   QSTIKELNKRDGNAKLLVGNEFNDDNIINATILILNQSKIPAITVQGIYLNQQKKADLK
FT                   SLLAVFNGKNWIYINPKTGSAGLPKEFLIWQYGNGPLFNVVGGNRAQFSLTVSPTPINA
FT                   LSVAKSRGLEDSQLLRFSLLQLPVNVQGIYKILLTVPIGAFIILILRNFIGIKTFGTFM
FT                   PVLIALAFRETHVAWGITLFVIIISFGLLARFYLDQLRLLLVPRLAAILTVVILLMIFI
FT                   SVLCQNLSLDTGMSVALFPMVILTMTIERMCITWDERGASEAIKSGIGSLAAAVISYGA
FT                   MSYEPLQYLIFAFPELLLVLLSLILWFGQYRGYRLVELKRFKSLASAMK"
FT   gene            complement(94825..95352)
FT                   /locus_tag="lpg0085"
FT   CDS_pept        complement(94825..95352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0085"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0085"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26192"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="PDB:2PMA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC6"
FT                   /protein_id="AAU26192.1"
FT                   /translation="MRSKFVLFMLMSLLTGSLMANSEAQIYGYVEKATLIDQNLTLSAK
FT                   LDTGAKSASLHAVNITEIEKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRSSETNPG
FT                   LLRTTPIKRPVVLLNIKLGDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVDPALTF
FT                   TTKSKSPVNNEK"
FT   gene            95581..97527
FT                   /locus_tag="lpg0086"
FT   CDS_pept        95581..97527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26193"
FT                   /db_xref="GOA:Q5ZZC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC5"
FT                   /protein_id="AAU26193.1"
FT                   /translation="MIAPYLYMPHASDENQASKPTDLVFILAIAGRIDAQSRILAQKLD
FT                   KSRSIYYAYAVMDSLSSSYSMFKYFFDLFASPNDNDAMHEFLNSPAGLITIAVESVFLV
FT                   TFSVLACQFENEKEDYYKKFIANAWPYFRDVMKGLKNAYKGWRSAVVAFSLIGGVDAKF
FT                   LILPMGVILGVFAAANRFWIRSMLEDRKIMMSENIALLMEIKKLISLSHEESFSYFKRI
FT                   RYQTMQTRNFAFWAVAAGGLLDGLYLYVGVLSLAVLSPQLLMAMALICAFYTVACVITR
FT                   IYEEYDFQLRLLVTQTKCQLALITKELETNYAKLLLLQDKMDLDKVDQEELKRLKRLVH
FT                   NLITRFDDSRKLLSQQSNRTYLSSALLGMKNGLYAYGALASVLFLVGSILVMAGVSFPP
FT                   ALLTACIILGLVLVLSFTIHSLVSNYWHQKKQETQKERPYERLIEWKNSLNDEFNKTEL
FT                   LAPEEFHKLLNDGLSLDPSPQFFFQEWFEVLRSLFSGFGKGQKFIDFAGNSLQELGEDG
FT                   HYRDTPVMYVLSVFSALLFGVTLALRALAKGLGRTPLAQQAKLTEDSKEASVSPEITKE
FT                   VMQKTEEQRESIQSEKTRTDSPGHTDSLSLFGIFETKTKRNQPDSPSIPHSKSESALNQ
FT                   LIPSQNSTILGLA"
FT   gene            complement(97493..98083)
FT                   /locus_tag="lpg0087"
FT   CDS_pept        complement(97493..98083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0087"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0087"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26194"
FT                   /db_xref="InterPro:IPR025350"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC4"
FT                   /protein_id="AAU26194.1"
FT                   /translation="MQESFDPSTITTLHKTSIIRWKANGIEYQHKQFLQLVEENHAFNF
FT                   QLWHAEDKARRDDMGFEFVYQAKREIDAYNQQRNNRMEAMDEWLYKALEPENHNHCPVN
FT                   SESPGMIIDRLSILSLKSYHMDLQTKRQDVSEEHRIACTQKLEIIQQQLNQLALCLDEL
FT                   LNEVRAKTRTFRVYHQFKMYNDPKLNPELYCSD"
FT   gene            complement(98310..99086)
FT                   /locus_tag="lpg0088"
FT   CDS_pept        complement(98310..99086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0088"
FT                   /product="glutamine ABC transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0088"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26195"
FT                   /db_xref="GOA:Q5ZZC3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC3"
FT                   /protein_id="AAU26195.1"
FT                   /translation="MLLLNFKYILNGLKNMKRFMFILLMFLNFYTFGKPLIIGVPEFAP
FT                   PFVSRSGGGGETYFGFNIDLMNSICKIIEMECQYKGMNIQQLYTNLNQGKLDIMLAPTP
FT                   IVSTVGTNYIFSLPYLPSNAQVITLKANNDINSLADLKGKKVGTLKYTLYGSLLAEHFQ
FT                   DYFDLVQFSKLSDMALALSNQKIEAIVLNTNAAKYAMSNSATELKFVGDKMAIGDGYGI
FT                   LALKNNAPLIMKINKALLQIEKDGTYLEIYNTYFGD"
FT   gene            complement(99132..99578)
FT                   /locus_tag="lpg0089"
FT   CDS_pept        complement(99132..99578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0089"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0089"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26196"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZC2"
FT                   /protein_id="AAU26196.1"
FT                   /translation="MTIWIDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAKEKTNFANALDRWLAKSK"
FT   gene            99689..103663
FT                   /locus_tag="lpg0090"
FT   CDS_pept        99689..103663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0090"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26197"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC1"
FT                   /protein_id="AAU26197.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQIPA
FT                   QKNQFSLNHSVPFGLPASLSVLTIFLTYAPNLLHRELSEQLLTMLDSIKETETSVDNQL
FT                   AERCTRQLNYYSDAKPVLIALKERGAKDLIQILEQADERSLSAFSHLAKDTDLNVLIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLTDESINALSIRLLLSLVSSEKA
FT                   IEKLKEARVCLAQYPFSIDLHAMRAVFDFYQYELKRDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIEYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGEI
FT                   RTKINQLDLYLFDTPQLYQLASDLITKSYNSGKEPLSSYPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLCIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLHQMECLLEANKGGDELHNKGLEVLYHYYALSYPNLRSDLFLK
FT                   VVNHIYSRFFIKGNNETEARNGLFHWLKQSFPLIDKLPKELDRKKEIFLYNSAGKKIGF
FT                   LGESNAAMTFVNEEIVLLARTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENAIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGVIRNKNNALELFHYILNRDSRRSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISQDKKQETICDAVLDRLINSEACAALVLKEFLGDRTHNSIQKVNNPEIGKVSQFFDRR
FT                   HIVPLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNLDSPQAWQSKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANAGITSLFYKHKALNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWSKRD
FT                   KQKKSPIICSYLLSYTGKKSVLLHLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQSLDRQILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLISAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNAEN
FT                   SSSKIIKFCDDRTPGPTRKKAGDLINAPVAESRTNSLHLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQSKQSIDYNTPAIPSNFESIM"
FT   gene            103878..104342
FT                   /locus_tag="lpg0091"
FT   CDS_pept        103878..104342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0091"
FT                   /product="conserved domain protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26198"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZC0"
FT                   /protein_id="AAU26198.1"
FT                   /translation="MRILLSFYLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNVTNLDLWITHPVTDPGASAGWTSRLQAGKWSALLVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPASDQGTFWVAEDLSLAALTAAVGGRGFVLPEK"
FT   gene            104748..106928
FT                   /gene="vacB"
FT                   /locus_tag="lpg0092"
FT   CDS_pept        104748..106928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="lpg0092"
FT                   /product="(exo)ribonuclease R"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, DNA/RNA degradation / restriction"
FT                   /EC_number="3.1.-.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26199"
FT                   /db_xref="GOA:Q5ZZB9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB9"
FT                   /protein_id="AAU26199.1"
FT                   /translation="MSKKSKDPFYKREREKYAEPIPSREYIMEILDEYGRPMSRSKLFD
FT                   KLDLSSESQQESLGFRLKAMLRDGQIMQDRRGRFCLLQKINLLRGTVQGHPDGFGFFIP
FT                   DDGSEDMVLSAKEMRAVMHGDLVLAYQSGLDRRGRPEAKIHEVLEHANTTVVGRFFTDH
FT                   GVNFVIPDSKRLTQDISIPQEFIGEAKNGQIVLVELIAYPNKRSQAIGRVIHILGEHMA
FT                   PGMEIQVAIHAHGIPFEWPDDVLAEVGKIPQQISEEQLKGRTDLRNLPFVTIDGEDAKD
FT                   FDDAVYCYKKPKGGFQLYVAIADVSHYVAKDSALDQEAARRGNSVYFPGKVVPMLPEAL
FT                   SNGVCSLNPHVDRLCMVAELSITQEGKISRSRFYRAVIHSHARLTYTSVGAWLEQGKAD
FT                   EKHQALWPMLESLYDLYHILLDTRRLRGAMDFETTETRIEFDENKKIKCIVPVIRNDAH
FT                   KLIEECMLAANVATARFLEKAEIPTLYRVHAAPEEDKITALRQFLGELGLSLGGGRKPG
FT                   PKDFQRTMNMIGDRPEKHLIETVMLRSLKQAQYVESNEGHFGLAYSAYTHFTSPIRRFP
FT                   DLLIHRAIGHLLDNHPVYEFEYSHEDMNRLGKHSSMTERRADEATREVITWLKCEYMQD
FT                   KLGQVFKGRISAVTSFGIFVELDEIYVEGLVHVTSLKNDYYTFDSAKHRLIGARGGQVY
FT                   RLGDKMTVLVARVDLNERKIDFEPVEDEVCNE"
FT   gene            106894..107670
FT                   /locus_tag="lpg0093"
FT   CDS_pept        106894..107670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0093"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /EC_number="2.1.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0093"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26200"
FT                   /db_xref="GOA:Q5ZZB8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB8"
FT                   /protein_id="AAU26200.1"
FT                   /translation="MSLSRMKFVMNEQYVYGLHAVSALLANPHRMIKKLFVNQDRIDKR
FT                   LHEFLVKAENAHVPIEKLSAQKMNQQFSEFTHQGVVALASALAEYGESDLVTLLEKSKK
FT                   PVLILILDGITDPHNLGACLRSADATGVDFVVIPKDKSASITPVVSKVACGAAESIPLV
FT                   RVTNLARAMDILKQQGVWIFGAAGEAENLLYAMDCSGNIALVMGAEGTGLRRLTREHCD
FT                   GLFSLPMMGSVESLNVSVATGVSLYEVIRQRGQFRE"
FT   gene            107663..108313
FT                   /gene="rpiA"
FT                   /locus_tag="lpg0094"
FT   CDS_pept        107663..108313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="lpg0094"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="5.3.1.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0094"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26201"
FT                   /db_xref="GOA:Q5ZZB7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="PDB:6EEP"
FT                   /db_xref="PDB:6MC0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZB7"
FT                   /protein_id="AAU26201.1"
FT                   /translation="MSELKIKAAKAAIAYIEDDMVIGVGTGSTVNFFIKELAAIKHKIE
FT                   ACVASSKATEALLRAEGIPVIDLNSVQDLPIYVDGADEVNERGEMIKGGGGALTREKIV
FT                   ANVATQFICIVDESKVVKRLGEFPVAVEVIPMARSFVARQIVKLGGDPEYREGFVTDNG
FT                   NIILDVFNLSFSTPMALEDSLNVIPGVVENGVFAKRLADKVLVASASGVNNLK"
FT   gene            108377..109756
FT                   /locus_tag="lpg0095"
FT   CDS_pept        108377..109756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0095"
FT                   /product="cytosolic IMP-GMP specific 5'-nucleotidase"
FT                   /function="Nucleotide Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0095"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26202"
FT                   /db_xref="GOA:Q5ZZB6"
FT                   /db_xref="InterPro:IPR008380"
FT                   /db_xref="InterPro:IPR016695"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:2BDE"
FT                   /db_xref="PDB:4G63"
FT                   /db_xref="PDB:4OHF"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB6"
FT                   /protein_id="AAU26202.1"
FT                   /translation="MDTHKVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVK
FT                   ERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSD
FT                   QKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYC
FT                   VDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIRYGKKIFILTNSEYSYSKLLLDY
FT                   ALSPFLDKGEHWQGLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQG
FT                   GNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPI
FT                   EKKIGEAMAIKKELEQKYVDLCTRSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQN
FT                   SFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDID
FT                   I"
FT   gene            109946..111139
FT                   /locus_tag="lpg0096"
FT   CDS_pept        109946..111139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0096"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26203"
FT                   /db_xref="GOA:Q5ZZB5"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="PDB:6AOJ"
FT                   /db_xref="PDB:6AOK"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB5"
FT                   /protein_id="AAU26203.1"
FT                   /translation="MPKVIIFTDFDGTVTGKSGNETVFTEFYQSLLQGYKKDVEQDYKN
FT                   TPMKDPIEAQALFEAKYGKYNENFDHDQQDVDFLMSPEAVAFFHEVLKNDDVTVNIVTK
FT                   NRAEYIKAVFKYQGFSDEEISKLTILESGYKFNDVNSRLNHPTERANRVYILDDSPTDY
FT                   AEMLRAVKGKGYNEEEIRGYRKNPGEFEWSQYLEDVREMFPPKENSPEEVQLPDEQGDE
FT                   VSIGEETPVLLQEDNLSRREETATVLSNQPVPSSDFRTLKIMGAFAGIGFGFGFALGVT
FT                   LVATGVFAPSGVGLLGALTLGAISGTGTAALSSAIGFVVAEGTEITSESVSEEAVPAVK
FT                   QSSHEAMRGLGGSQLLSTNNIHPVGHFPSILSRRTPTKGKEEQCQEEYVLTNPLHNS"
FT   gene            111300..111641
FT                   /locus_tag="lpg0097"
FT   CDS_pept        111300..111641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0097"
FT                   /product="alkylphosphonate uptake protein PhnA"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0097"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26204"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB4"
FT                   /protein_id="AAU26204.1"
FT                   /translation="MNQLPNCPKCLSEYCYEDGDVLICPECTHEWPKNSNNNDEESAKI
FT                   IKDANGNLLQNGDTITVVKDLKIKGSSQVIKVGTKVKNIRLVDGDHDIDCRIDGIGAMK
FT                   LKSQFVKKI"
FT   gene            111756..112208
FT                   /locus_tag="lpg0098"
FT   CDS_pept        111756..112208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0098"
FT                   /product="two component sensor and regulator, histidine
FT                   kinase response regulator"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26205"
FT                   /db_xref="GOA:Q5ZZB3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB3"
FT                   /protein_id="AAU26205.1"
FT                   /translation="MRVLIVEDSAFNAFCLRRLLESVVASISVTIVNNSQAALSFVNNY
FT                   CPDIVIVDGDLGASPDEMNCNGPELAGILLQKYPQLPIVAWSDSDAMRENFIKVFKSHG
FT                   LFLNEYNTWPKVIGLERIHKTWSYYFGEFIGGQNPSFASQTSINYY"
FT   gene            complement(112238..114928)
FT                   /gene="polI"
FT                   /locus_tag="lpg0099"
FT   CDS_pept        complement(112238..114928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polI"
FT                   /locus_tag="lpg0099"
FT                   /product="DNA polymerase I"
FT                   /function="Nucleotide Metabolism, Replication and Repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0099"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26206"
FT                   /db_xref="GOA:Q5ZZB2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB2"
FT                   /protein_id="AAU26206.1"
FT                   /translation="MKPPLILIDGSSYFFRAFHALPPLTNSKGQPTGAIYGVANMIKKI
FT                   IKDYQPEEIAVVFDAKGKTFRDEWYPEYKAHRPPMPQELSSQFQPLIQLLQAMGLPLLI
FT                   IDGVEADDVIGTLAKQATEQGIPVVISTGDKDMAQLVNEHVSLINTMSNYSMDIDGVKA
FT                   KFGVTPEQIIDYLTLIGDSVDNIPGVEKCGPKTAVKWLTEYQTLDNLLAHANEIGGKIG
FT                   EYLRASIPHLPLSKKLVTIKTDLDLPLNLNQLMPKPADSEQLIKLTRELEFKSWLKELL
FT                   QEEENQKSPKEMDASNNKSYEIITTHKQLNHWLNKLEQSQQFCIDTETTNLDVMQAELV
FT                   GISLAVEEENASYIPLAHTDGSTQLVKEEVLTALKPILENPAIGKIGQNIKYDYSVLKN
FT                   YGITLKGIGYDTMLESYVLNSGAGRHDMDSLALKYLGYKTISYEDVAGKGAKQLRFDQI
FT                   PVVKAGIYAAEDADITLRLHHKLYPMLDESLRNVLHDIEIPLLTVLADMEMHGVLIDPV
FT                   ILEKHGSRLKEQMKSLEQEAVQLAGKAFNLNSPKQLQEILFDEQKLPVVAKTPTGQPST
FT                   AESVLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGR
FT                   LSSSDPNLQNIPIRSEEGRLIRTAFIAPEGSLIMAADYSQIELRIMAHLSQDDNLLRAF
FT                   ANGWDIHAATASEIFQTNLDAVSKEQRRRAKAVNFGLIYGMSAFGLAKQIGVERQDAQH
FT                   YIDTYFRRYPKVLEYMERTRKQAHQLGYVETLFGRRLYLPEINSRNLMRQKAAERTAIN
FT                   GPMQGTAADIIKKTMLAISSWEHSQKNPSAKMIMQVHDELVFEVRKEAVEECRAIIHKL
FT                   MEQTVKLSVPLVVSIGTGSNWDDAH"
FT   gene            complement(114931..116001)
FT                   /locus_tag="lpg0100"
FT   CDS_pept        complement(114931..116001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0100"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="2.3.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26207"
FT                   /db_xref="GOA:Q5ZZB1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZB1"
FT                   /protein_id="AAU26207.1"
FT                   /translation="MKGKPMNSSLRDIANLVQGMVIGNDAITVSTLSPIDNILPGSLVF
FT                   AEGEDNIKLAENSEAAAILIGQGTIDSPKPLIQVKNPFKAFIALLNHFYPPRRISPGVH
FT                   PTAVIGAEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTI
FT                   YDNCRIGSNVTIHASTVIGSDGFGYTFVDGQHLKVPHSGYVVIENNVEIGANTAIDKAT
FT                   LGATVIGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVH
FT                   IEDEVILGARTGVPPHKHLKKGTVYLGNPAKPKDVAIKHELSVNRIPLIRKNIKSLTEQ
FT                   VAVINKKLDIKAKEVE"
FT   gene            116250..117032
FT                   /locus_tag="lpg0101"
FT   CDS_pept        116250..117032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26208"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZB0"
FT                   /protein_id="AAU26208.1"
FT                   /translation="MLKKILLTGLCVLFSMNLSASEPIYDEEIPLLWSSIITVSGGPSW
FT                   ATPGQNQYIYPMSPVYINNFNPNLPPNYYLYFTHDSPTTILANGEIFFGLQRAINPQMI
FT                   GQLGLGVAGVSDAKVTGDVNLNGLLNVYTYDYKVNHARVELKGKLIGSAFTPVQPYLSG
FT                   SFGIAFNNAHDYRTLSINQFLFPAPWFASNTTYAFAYSVGAGVQKMLNRNWQVGVGYEF
FT                   ADLGKSYLGGDGVNITKGPRLTHLYNNQLLFSVSYLYS"
FT   gene            complement(117029..118258)
FT                   /gene="fabF"
FT                   /locus_tag="lpg0102"
FT   CDS_pept        complement(117029..118258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="lpg0102"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /function="Lipid Metabolism"
FT                   /EC_number="2.3.1.41"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26209"
FT                   /db_xref="GOA:Q5ZZA9"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA9"
FT                   /protein_id="AAU26209.1"
FT                   /translation="MKKRVVITGMEITSSIGSGIDKFWLAASQGQCGIKRIQSYDPSPY
FT                   STQIAGEITDLSLDHLPEFNKSKRYPRAAQYALFCAHHAIEKAGLEQAELNAAGTFIGT
FT                   SIGGQPELEAGYRLFFTDSWKKIPPLSVIRGMPNSIANHIAIAFGIGGPNSTISNACVS
FT                   SGEAIGMAYQQIAHGNLTTALCGGTESLVWESVMAAWCKLRVMSTNNENPSQASRPFDL
FT                   NRDGMVMADGAGILILEELQQAKARGAQILGEIIGYGASCDAFHVTAPNSQGQARAIVA
FT                   ALNDAKLSINDVHYINAHGTGTQLNDSTETETIKMVFGKRAYDIPITAQKAMTGHAIGA
FT                   AGAMEIIATTLSLQKNTLLPTINLHTPDPACDLDYVPNAAREKTIDIALSNHFAFGGAN
FT                   AALVLRKYIS"
FT   gene            complement(118383..119243)
FT                   /gene="vipF"
FT                   /locus_tag="lpg0103"
FT   CDS_pept        complement(118383..119243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vipF"
FT                   /locus_tag="lpg0103"
FT                   /product="N-terminal acetyltransferase, GNAT family"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26210"
FT                   /db_xref="GOA:Q5ZZA8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA8"
FT                   /protein_id="AAU26210.1"
FT                   /translation="MITQVNQLDELQLKDLKTLRAECKKNDGSIPNLYIHILKQHRSLP
FT                   TSFLYYQNGALIGFLSIYFFYDDAVEVAVLVSPQYRRQGIAKQLIKEALPLIKSQNYFN
FT                   LIFSCPSRLNDNWLTSKGFTYLHSEYFMERDDLNPILDYIRPLSFRMATLEDIPILCGL
FT                   DEVCFPDKNQDSVHRFQQILNEREYEIVIAMLNNHPIGKSHIRWQTKRATLSDIAILPK
FT                   EQGKGFGSALIAHCINMILSEGKSRVDLDVETHNKKALNLYIQLGFHIQNACDYWSINV
FT                   NQLAK"
FT   gene            complement(119362..119937)
FT                   /locus_tag="lpg0104"
FT   CDS_pept        complement(119362..119937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0104"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /function="Detoxification / adaptation"
FT                   /EC_number="1.8.4.11"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26211"
FT                   /db_xref="GOA:Q5ZZA7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA7"
FT                   /protein_id="AAU26211.1"
FT                   /translation="MLRILLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGGTLKDPTYEQVSAGNTHYAESVMVEFEPNKLSYKKLVEYFFRHIDPTVKNA
FT                   QFCDHGSQYRSAIFYLNDQQKKIAMEYKKELEQKFPTVYTEIAPSTSFYPAEEYHQNYY
FT                   KKNPIRYKYYRYRCGRDTRIQEVWGNKK"
FT   gene            complement(120045..120641)
FT                   /locus_tag="lpg0105"
FT   CDS_pept        complement(120045..120641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0105"
FT                   /product="cytochrome oxidase-like"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26212"
FT                   /db_xref="GOA:Q5ZZA6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA6"
FT                   /protein_id="AAU26212.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   VLLDKPYIAISFLLLSGYLDTLDGSLARFQNRASDFGSAMDIVIDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSSCFNFLAALFCFLVCLTALIRLFEFKKSVQAPS"
FT   gene            complement(120944..122224)
FT                   /locus_tag="lpg0106"
FT   CDS_pept        complement(120944..122224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0106"
FT                   /product="xanthine/uracil permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26213"
FT                   /db_xref="GOA:Q5ZZA5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA5"
FT                   /protein_id="AAU26213.1"
FT                   /translation="MPTLKSYFLKDTSLRTEILAGATTFLTMVYIVFVNPKVLHDAGMD
FT                   QGAVFTATCLITAFACALTGFIANTPIGVAPSVALNIYFSYSVVQGMGVDWQHALAMVF
FT                   ISGLLFLFLTLTKLRRLLVEAIPHNLQIAIVIGISLLIALIALENNQIIIGDQHNLMRL
FT                   GSIIRPETGLFFLGFILILTLDYHKIPGAIIIGILSISVLSLILGLTSWQGLIAMPPSL
FT                   EPTFLQLDFSGLSSIVALKTIFTFFLITVFDATGSLIGLLSPTIFKHEKNYYKRLTRSL
FT                   TADAAASSLAGLMGSASTSPYIESATGIEAGGRTGLTALVIATGFILMLFLFPLAKMIP
FT                   SFAVGPALLYVACCMIKHITNMKLQDITETAPCMVIIMMVPFTASIADGIGLGIILYTL
FT                   LKLFTRQKPNPLIIVLSLVFTVFFLIN"
FT   gene            complement(122242..123048)
FT                   /locus_tag="lpg0107"
FT   CDS_pept        complement(122242..123048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0107"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0107"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26214"
FT                   /db_xref="GOA:Q5ZZA4"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA4"
FT                   /protein_id="AAU26214.1"
FT                   /translation="MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNK
FT                   DHTLFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKPVALLVHDEFHYQIGDKTAIEPHG
FT                   FYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGEMPI
FT                   SRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN
FT                   HRLDTLNEIFDMFNGYLESRHGHHLEIIIIVLIAVEIIIAVMNFHF"
FT   gene            122311..122415
FT                   /locus_tag="lpg0108"
FT   CDS_pept        122311..122415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26215"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA3"
FT                   /protein_id="AAU26215.1"
FT                   /translation="MMAMATFQITIEHVENFIKRIKTMVNGIDASLYM"
FT   gene            complement(123147..123416)
FT                   /locus_tag="lpg0109"
FT   CDS_pept        complement(123147..123416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0109"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26216"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA2"
FT                   /protein_id="AAU26216.1"
FT                   /translation="MNSKVFSQRFNRELATLGFPEDLTEKTKAVSKVFGVTRHLANAMI
FT                   FGHVLPDKEQLDKIAEILEVCPQWLSGATDRKKAYSGRETADSV"
FT   gene            124044..125846
FT                   /locus_tag="lpg0110"
FT   CDS_pept        124044..125846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26217"
FT                   /db_xref="GOA:Q5ZZA1"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA1"
FT                   /protein_id="AAU26217.1"
FT                   /translation="MIQLGDLLKPTWAAERSLNNAWSVLNDEEKETIKSRMDKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFAQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSINHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIEFKNCHEMTMTELAQHIQHDMRI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHERVYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWNKTNNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDSFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
FT   gene            125843..126883
FT                   /gene="fdfT"
FT                   /locus_tag="lpg0111"
FT   CDS_pept        125843..126883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdfT"
FT                   /locus_tag="lpg0111"
FT                   /product="squalene and phytoene synthases"
FT                   /function="Lipid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26218"
FT                   /db_xref="GOA:Q5ZZA0"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZA0"
FT                   /protein_id="AAU26218.1"
FT                   /translation="MMVMRSFSFYYQHLENVSRSFSFCISQLTYPAKEWVALSYLLLRV
FT                   ADSIEDAKWQDLQTQSDSFAAFKSFLVQTPANDQFTKWLSSFPSQLPLGEKQLLCAVPL
FT                   LLEEKDNLPESIKQSVIKTILQVVDGMHYFLNHYHMEGKIVFPSLVTTNQYCFFVAGLV
FT                   GKLLSHIFTDLLSNFKWTASLLNQAFHFGFFLQKINLLKDRVDDETSGRYFISSENSLR
FT                   ESLVIHAHHSLAYVKSIPIIEGRPYRLFCAWSLFIGLASLKWLDKYGHRQKIKPRETYY
FT                   LVNQINLLIDDNRALEKLFNSYLPEQCKERSRYISESSKQIPAWFKKIYDGEMDSLTLF
FT                   ELDVQV"
FT   gene            complement(127189..130458)
FT                   /locus_tag="lpg0112"
FT   CDS_pept        complement(127189..130458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0112"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26219"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ99"
FT                   /protein_id="AAU26219.1"
FT                   /translation="MFIYNSWNVKFILLFQIMIIRELFNWIHNDSAPLHLSDQTIERDL
FT                   IEQEESQAKQTHRVLLGNVRLLKYSGSSNTEAIKELEQHCLFMDYLQLYKQEFVKDGKN
FT                   TVFLIALRNLLSHSHEEQLRLMPKINELFQILLRDNKESALSFYDKNKELFRHCTEIQE
FT                   RVTFELFQQKIEADSKSVMTQLDYFNEHLAYQENPLGIIALCRNWIGETEKFTALILWL
FT                   LERKVSVEKILLTNLLQDFLRYHLFTLHSRDNEVSRLYSLLGHFPEAQELVMAAQKISC
FT                   GELMFQQYSLDGTFRGKNLPVVSPEIPPLQFSLSKDNFIALHRTFGPAFLTAGIATATN
FT                   HDEVAWLDMLRHTLNQPETLKLLPDIINIIAREYSPKVLKTLAELIAESTAHQLLTLNQ
FT                   SCVFHLLQHKPRLLHDITEENVIGYINHLVRLDTHDQEIIYQLMALFRVLLKKNHPATK
FT                   AVFEAILDNLVNHPQLLEDEEFLTQLKKYPDCELLLDERCENILKQLNFCIAEQTSGLL
FT                   FGKHNYFIIEDVWLGALRKFAVLQQINPQMKFSFGHKYALQARIAEVVFIHQGDLFDLD
FT                   TFIDALDLPLVTSSGEISPYERALIEILATIDNELIRKQIIQKLETTPFNRLDWHEREY
FT                   GNQTVFIKAAKKGNLGLINLLEDKMEPSVLNKALRAAAKNYQWETLDHLCSLPGVELRQ
FT                   DEIDDLVVYLAEHGRIESVKKLLKLYDYKPSTELIGTILKKAIDNDNLQVVMYFCKLPV
FT                   ESPKQSMLDRLFKLAIQLQHWDIVEYLANSKHYSPSQTTLEKAFQQTALAMQHEAVEIL
FT                   GNVEKNPVRAIVIERALLKASKLGHTKVVQSICALPSESLTKQAIEDALEQAAAEGHLD
FT                   IVSCLCEPGTTTLRQPGINSGMKIAVQTGKLSVVNYFCSMTGSNKPTPRLIDQTLVMAA
FT                   KKGQTAIFMAIHSNRQTPPGKHAIEQSFQLAITAGKLQILDYLCRHESYGLNQSRIDQA
FT                   LISAVKSKQLGIVSYLCESLEITPSRKALKIAVSKAISSDQTELADYLRSRSSGKSKPL
FT                   DTPTDEMASPLEIGKQLATNGLFKYKRKDAKEPPLLLNPSL"
FT   gene            complement(130773..132017)
FT                   /gene="yuxH"
FT                   /locus_tag="lpg0113"
FT   CDS_pept        complement(130773..132017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yuxH"
FT                   /locus_tag="lpg0113"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26220"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ98"
FT                   /protein_id="AAU26220.1"
FT                   /translation="MVVELDETPVRTLLARQGIYDKNSAIVAYELLYRNSDAENSHVDN
FT                   LNQSSGEAATSSVLVQLFANLDVNTIIGNKQAFINFTHSHLVQKIPMLLPKNRIVIEVL
FT                   ETVAIDQPLLLNLMELKKQGYQIALDDFVFRNELAPLVDMADIIKIDVLHLDQQQIAEQ
FT                   LLPLKSFRGKLLAEKIEDKQQFNHCVNLGFDFFQGFFLNKPDSLTGQIITENKIQLLRL
FT                   LTEINNEEVPIQRIEEIILQIPKLSYRILRLANSASLYMSKKIESLMDAISQLGLMQIR
FT                   NWLNLLLLASLDDVAPDLLERTLIRAKMCESLAKSMDYPNSHQAYTVGILSTLDGILNE
FT                   PMPSLLAKIRLSETLNEALLNYKGDLGKILKFAIDYEQANFNQLERIPVKSETLSQSYL
FT                   KGIEYANHVIDIINK"
FT   gene            complement(132222..133676)
FT                   /locus_tag="lpg0114"
FT   CDS_pept        complement(132222..133676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0114"
FT                   /product="glycine cleavage system protein P"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.4.4.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0114"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26221"
FT                   /db_xref="GOA:Q5ZZ97"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ97"
FT                   /protein_id="AAU26221.1"
FT                   /translation="MLIFELSKTGRQAKAQIPRAVSKNYSIPEEFQRKSPPRLPACSEL
FT                   QVVRHFTCLSQKNFSIDTNFYPLGSCTMKYNPRGVHKAASLPGFINRHPLAMDNESQGF
FT                   LETLYKLQNYISEITGMPGVSLTPMAGSQGEFAGVAMIKAYHQSRGDTARDEILIPDAA
FT                   HGTNPASAVMCGFKVVEIATAPDGDIDLDELKRKVGPRTAGIMLTNPSTLGLFMRQIKE
FT                   IASLVHQAGGLLYYDGANLNAILGKVRPGDMGFDVMHLNLHKTFATPHGGGGPGAGPVA
FT                   VGKRLIPYMPLPVVKKTDSGYHWATRQDYPQSIGRLSCFMGNAGILLRAYFYMLVLGKE
FT                   GLLRVSEFATLNANYLLKELTKVGYTAAYPDRRASHEFILTLNSEKKNYDVTAMDFAKR
FT                   LLDYGVHAPTTYFPLLVPECLLIEPPETESKEELDAFVAVMKIIREEASKQPDILKAAP
FT                   HTLPVKRLDDVKAARELDLNYFATHE"
FT   gene            complement(133670..133978)
FT                   /locus_tag="lpg0115"
FT   CDS_pept        complement(133670..133978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0115"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26222"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ96"
FT                   /protein_id="AAU26222.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRNELKELIQKTEGKLC"
FT   gene            complement(133978..135348)
FT                   /locus_tag="lpg0116"
FT   CDS_pept        complement(133978..135348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0116"
FT                   /product="glycine cleavage system protein P"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.4.4.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26223"
FT                   /db_xref="GOA:Q5ZZ95"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ95"
FT                   /protein_id="AAU26223.1"
FT                   /translation="MPYIPHTPDDTKEMLEAIGAQDIQDLFDEIPASLQYAGFQNIPAG
FT                   INEMEMLKEAQNQAQKNRNGICFIGAGCYEHHIPAAVWDIASRGEFLTAYTPYQAEASQ
FT                   GTLQLLYEYQTMICELTGMEVSNASMYDGATALAEAVLMAVRLNKHSKTNRVLIAGTVH
FT                   PFYRETIETIVRNQHIEVITLPFDEQQGITNLGSLNQYTGEDITALVIAQPNFFGCLEQ
FT                   VDKMTSWAHHNKTISVACVNPTSLALLKPPGSWGEHGVDIVCGEGQPLGSPMASGGPYF
FT                   GFLSTRMAHVRQMPGRIIGRTVDKDGKTGFSLTLQAREQHIRRAKATSNICTNQGLLVT
FT                   AATIYMSLLGPEGLSQVATQCHQNTHELITALTQIEGVELAFKAPFFHEALIKLNQPVQ
FT                   SVLQQLADAGIAGGYAPEQHYPQLANTLLVCATEVRTAEDIAKYAKTLKTIMSKRGA"
FT   gene            complement(135351..135728)
FT                   /gene="gcvH"
FT                   /locus_tag="lpg0117"
FT   CDS_pept        complement(135351..135728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="lpg0117"
FT                   /product="glycine cleavage system H protein"
FT                   /function="Amino Acid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0117"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26224"
FT                   /db_xref="GOA:Q5ZZ94"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ94"
FT                   /protein_id="AAU26224.1"
FT                   /translation="MNDLKFTTTHEWLREDEEEVTVGITDHAQELLGDMVFVELPEIGD
FT                   EVSAGQELGVVESVKAASDFYAPISGVVTAVNEAVGKNPALVNHDPYHEGWLVKLKPSH
FT                   PDEIKSLLSDEQYQNEIAEEN"
FT   gene            complement(135762..136865)
FT                   /gene="gcvT1"
FT                   /locus_tag="lpg0118"
FT   CDS_pept        complement(135762..136865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT1"
FT                   /locus_tag="lpg0118"
FT                   /product="glycine cleavage system T protein"
FT                   /function="Amino Acid Metabolism, Metabolism of Cofactors
FT                   and Vitamins, Energy Metabolism"
FT                   /EC_number="2.1.2.10"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26225"
FT                   /db_xref="GOA:Q5ZZ93"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ93"
FT                   /protein_id="AAU26225.1"
FT                   /translation="MIKKGNAMTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHH
FT                   AVRNDAGMFDVSHMTIVDILGAGGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIID
FT                   DLIVYQRASDNYRVVLNSATRQNDVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKT
FT                   LSILAPAHVDAVSTLTSFECVDVDHWFFARTGYTGEDGLEIIVPNEFVTQLWNDLLHAG
FT                   VTPCGLGARDTLRLEAGMLLYGQDMDETTTPLESGLAWTVKWEPEDRGFIGMGALVSQK
FT                   QQGIKRKMVGLTLLDKGIMRHGQKVIIEGCPDGIITSGSYSPTLQQSIALARVPMETGE
FT                   QVLVDIRGKLIPAKVGKPRFIKQGKPV"
FT   gene            136967..137446
FT                   /locus_tag="lpg0119"
FT   CDS_pept        136967..137446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0119"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26226"
FT                   /db_xref="GOA:Q5ZZ92"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ92"
FT                   /protein_id="AAU26226.1"
FT                   /translation="MGKNMVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLK
FT                   AKGHVTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVA
FT                   IAYRDNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
FT   gene            complement(137421..137951)
FT                   /locus_tag="lpg0120"
FT   CDS_pept        complement(137421..137951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0120"
FT                   /product="IcmL-like"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0120"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26227"
FT                   /db_xref="InterPro:IPR021055"
FT                   /db_xref="PDB:5CNL"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ91"
FT                   /protein_id="AAU26227.1"
FT                   /translation="MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDY
FT                   KNYMQQQKEIAKYFSADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTH
FT                   WQAIMPILVVYKNPQYEQKQNLKVVLGFTVASPGQGVRGFSVTSLQSTPISPPCQCKIE
FT                   ETPGNTKQGDAKQ"
FT   gene            138448..140187
FT                   /locus_tag="lpg0121"
FT   CDS_pept        138448..140187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0121"
FT                   /product="ABC transporter, permease protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0121"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26228"
FT                   /db_xref="GOA:Q5ZZ90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ90"
FT                   /protein_id="AAU26228.1"
FT                   /translation="MGNSRFYFANPDKFSRFINRWDLLLLILTFSVLFFLGWAGSQMAT
FT                   PYQLGDQIPISLEPSNLPFYALRTVLRMFIALIFSILFTFIVGALAAKNRRAEQIVIPA
FT                   IDILQSIPVLSFLSITVTGFIHLFPNSLLGPECASIFAIFSAQVWNMTFGFYQSLKTVP
FT                   HDLIEVSAMFRLSAWQRFWKVEVPFSMSGLLWNMMVSMSASWFFVVLSEAISVAHQNIR
FT                   LPGVGSYIALAIAQRDLHAVGYAILTMVIVIFLYDQILFRPLIAWSEKFKMEQSPDESE
FT                   YQSWLIDLIRSSRLMKRVTEWLAVFTNSFVNARWLRIGEVKAVKEIDFKRQKRLDRLWT
FT                   ALVLIAVITGGWFLLKFILAELKVSDIFHVFLLGAATGSRVIILILLSSMLWIPVGVWI
FT                   GLRPRLAQKIQPIIQFVAAFPANLFYPLFVIAIVKFNLSVEIWVTPLMILGTQWYILFN
FT                   VIAGASSIPRDLYLAADNFGLKGWIWWKRLALPGIFPFYITGAITAAGGAWNASIVAEY
FT                   VSWGNITLKATGLGEYIQASTTAGDFPQIALGTAMMCVYVLAFNHLIWRPLYRLAEERF
FT                   NFN"
FT   gene            140195..141493
FT                   /locus_tag="lpg0122"
FT   CDS_pept        140195..141493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0122"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26229"
FT                   /db_xref="GOA:Q5ZZ89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ89"
FT                   /protein_id="AAU26229.1"
FT                   /translation="MPETIINIENLSKSFKKAPSQHLLVLEDVNFKLQEGEIVALLGKS
FT                   GSGKSTLLRIIAGLIAPSSGTVTYRGKPVTRPVEGIAMVFQSFALMPWLTVLENVELGL
FT                   EAQGISREERRHRAIEAIDIIGLDGFESAFPKELSGGMRQRVGFARALVINPDVLLMDE
FT                   PFSALDVLTAENLKSDLLELWKEKKTNTNGILLVTHNIEEAATLADRIVIFGNDPGYIR
FT                   AELPVTLPQPRDPESPEYLALVDKIYTLMTTGPKEKAKRAQRERQIGLGYRLPDVEPSE
FT                   LSGLIETMKSFEERIDLPELADELMMNIDDLFPILETLEILGFAKVSAGDIQLSELGKQ
FT                   FSEADLQERKQLFAQRLLEKVPLARYIRRVLDEKAGHRVSEERFLSKLEDYLSEKEADR
FT                   VLKTMIDWGRYAEIFAYDFNTGILSLENPGKGA"
FT   gene            complement(141570..142223)
FT                   /gene="dsbA"
FT                   /locus_tag="lpg0123"
FT   CDS_pept        complement(141570..142223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="lpg0123"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26230"
FT                   /db_xref="GOA:Q5ZZ88"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="PDB:4JRR"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ88"
FT                   /protein_id="AAU26230.1"
FT                   /translation="MLIIFKGYIEELTMFKKLIALLFLMPMTALATQFIEGKDYQTVAS
FT                   AQLSTNKDKTPLITEFFSYGCPWCYKIDAPLNDWATRMGKGAHLERVPVVFKPNWDLYA
FT                   KAYYTAKTLAMSDKMNPILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPT
FT                   IDMRVNSGMSLMAHYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKSA"
FT   gene            complement(142195..142797)
FT                   /locus_tag="lpg0124"
FT   CDS_pept        complement(142195..142797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0124"
FT                   /product="cytochrome c4"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0124"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26231"
FT                   /db_xref="GOA:Q5ZZ87"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ87"
FT                   /protein_id="AAU26231.1"
FT                   /translation="MKKLALVLILCSSSVIFAQENPQEAGQNKSTVCTACHGPQGISTN
FT                   PEWPNLAGQHEKYFVKQLKDIKEGKSRSAPTMTAIVANMNEQDMDDLAAYYAKMPVAEG
FT                   STPEKYLKRGEQLYRGGDLNKHIAACIACHGPKGSGNAQAGFPLLSGQHAAYTIMQLQA
FT                   FKDGKRTNDLNQIMQDISSKMSPEDMEAVAYYIQGLY"
FT   gene            142872..143474
FT                   /locus_tag="lpg0125"
FT   CDS_pept        142872..143474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0125"
FT                   /product="GTP binding protein EngB"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26232"
FT                   /db_xref="GOA:Q5ZZ86"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ86"
FT                   /protein_id="AAU26232.1"
FT                   /translation="MPINLYSKAVFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNC
FT                   LTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLE
FT                   ARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKVR
FT                   QYYELAEHLVSVQAFSSVKKDGVEELISLLDRWYEWN"
FT   gene            143588..146896
FT                   /locus_tag="lpg0126"
FT   CDS_pept        143588..146896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0126"
FT                   /product="ninein"
FT                   /note="conserved gene, eukaryotic NIN gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26233"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ85"
FT                   /protein_id="AAU26233.1"
FT                   /translation="MTPLFPTQGPITIRQGIGGSCYLLSSLDCILNLGADGEQLIKSLF
FT                   TQTEDGKVIVRIKRHEALKDNLQKNKMTGKYTHYVDELNNEDVFEISPERLKEIDNQYG
FT                   GVKSNSLAIKILERLVSYYYAGDWSNTDPLASVVAHDIPDRIAGFTSTAFLGKFFGIQA
FT                   EDIPYSKLDDIIKLKLMNPDEPVYISMSYGKVDSFGKFHGRHALRIDKIIPKGSGNYDF
FT                   VLINPHDNSKTETYKLDDLNKRNCRFCLFNTSIHRASLTKKLLTLSNEEGRYIFSNSGL
FT                   QKRLISLEEMHLLTDNKIISSCISLHKQIPYLEKLFLKLSVEEKKTLTACIANADGSKK
FT                   EFLKLFLTRIPAMDLLELVLREETSQELLGEVLTELALSNPVEENKLSPKAGINFNGEA
FT                   FLHLIVKSAIQQKINQLAYLPEKAKQEIESGLINFYFGGASSSLTRASGLRALFIANIF
FT                   SKKSIEALFPPKALFAKAIANYLTLKTLPDLLIEYLKSKDTSPIDEEFFDVVLASATFK
FT                   DPDEFFENLFRLSRINPEVAKALFVFASQKINVLFGISLEEYAKKIALKDSGEFKSWFE
FT                   SLSKPQPVIKIPEIDNVLRQQRVDDAKRVISDIVQRINSFPFSFEGFKTVEHVNLNAEE
FT                   LRGQLKKIVHSGELQNALQILDLPDGHPEVQRALERKLRMIDAAANRRSDFLRKYETDI
FT                   DEHVRQIKNFPIDFNDADTIVAIESQRILLNKKLHTLVKAEDLLGEQFIANPKIKMVYY
FT                   AQVEKINLRAELLQKRLLDEAQKVIDSVEKRIDNFVIRFNDISSTSAVEWQRNNLLQQL
FT                   DNLVKPNQALLSSEKVLDCNNLQPSIVRALQAKKQEINETADQLIIKINAEEVVKSYEK
FT                   QIREFPISFSRCQTVEEVIARKQDLIQSVRYLVDNKPDLLKAREQLQLSDEYHSDIKIA
FT                   LTDKICEINRQADVMSKRITDQIAAIKETLNILAEIKFSDHLKTIESMVKTLETKAVGD
FT                   ENYKRAAPIARTFYNNLLRAEEHFKNSQLPKNVKCNDFHQACVRAINAVMPVLEVHRGW
FT                   KQVFADLASALVTLCTLGGANLYAGRWRLFPVPTESEKIVKDFSLSMQPLSVSA"
FT   gene            complement(146993..148876)
FT                   /gene="acsB"
FT                   /locus_tag="lpg0127"
FT   CDS_pept        complement(146993..148876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsB"
FT                   /locus_tag="lpg0127"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="6.2.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26234"
FT                   /db_xref="GOA:Q5ZZ84"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ84"
FT                   /protein_id="AAU26234.1"
FT                   /translation="MLPVHLKHPHLTATEEYLSEFWSEIAAQTIDWIQPWSITLQGGLH
FT                   KGDVKWFQGGLLNVSANCLDRHLPHKANQTAIIWEGDDENQNKTLTFAQLYSEVCKMSN
FT                   VLKSLNVRRGDTVGIYLPMIPEAAIAMLACARIGAIHTVVFAGFSAHALQQRLIASSCK
FT                   CLITADAFQRGGKTIPLKKQADEASVDLNITKLVVKNSNAPTALNKNKEHWWHELKQTV
FT                   SDQCTPEPMNTEDPLFILYTSGSTGQPKGVVHTTGGYLVQAAYTHQLIFACQDNEVFWC
FT                   TADVGWITGHSYVVYGPLCNGITTLMFEGIPTWPDAARNWRIIDKHQVNVFYTAPTAIR
FT                   SLMRAGDQWLNSSSRSSLRLLGSVGEPINPEAWNWYHQKVGQGKCPIVDTWWQTETGAI
FT                   MISPRASDEVIKPGSARKPIPGIVPLLLNEQGHEINGAGEGLLAIKYPWPSMARTIAGD
FT                   HQRYCNTYLSNGYYITGDGAKRDEDGDYWITGRIDDVLNVSGHRLGTAEIESALVSHPK
FT                   VAEAGVVGIPHDLKGQAIFAYVILKQGNKPDAELQTELMERVKDQISAIAKPDVIQFAN
FT                   DLPKTRSGKIMRRILRKIACKEVSHIDELGDLTTLANPQIVEELMKNILKR"
FT   gene            complement(148878..149795)
FT                   /locus_tag="lpg0128"
FT   CDS_pept        complement(148878..149795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0128"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.1.1.31"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26235"
FT                   /db_xref="GOA:Q5ZZ83"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ83"
FT                   /protein_id="AAU26235.1"
FT                   /translation="MLITEKYMANIGFVGLGHMGFPMAINLLKAGHSVMGYDLQQSALE
FT                   HFAEQGGTIAHNLQELAKGKDVIVTMLQTGQQVLHVCLGVDGIFSQLNAGSLYIDCSTI
FT                   DVKSSRETHQIAKENHLLVVDAPVSGGVAGATAATLTFMVGGEAEAYNAAHPILSAMGK
FT                   KIIHTGGAGSGQAAKICNNMILGTTMIAISEAFILAKELGLSDGKLFEVVNNSSGQCWA
FT                   MSKYVPVPGILENVPANNDYKPGFAANMMLKDLLLSQNTAKSVHIETPLGAKTTEIYQQ
FT                   FVDQGLGDIDFSAIIKHIGKIQEV"
FT   gene            complement(149798..151324)
FT                   /gene="mmsA"
FT                   /locus_tag="lpg0129"
FT   CDS_pept        complement(149798..151324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="lpg0129"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /EC_number="1.2.1.27"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26236"
FT                   /db_xref="GOA:Q5ZZ82"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ82"
FT                   /protein_id="AAU26236.1"
FT                   /translation="MPFNTRSLKMGYNVPHYIGGQLINETDTEAQAIYNPALGEIIGQV
FT                   HFASKATCDRAVAIAKAAGNEWSQTPAIKRARVLFRFRELLEKYQMDLARIVTREHGKT
FT                   LDDAKGSVARGIEVVELHCGLVNELKGDFSAEVASHIDCHTFRQPLGVCAGVSPFNFPV
FT                   MVPIWMMIPAIACGNTFILKPSEQDPSAPVRLLELLSDAGLPPGVANCIQGNKTTVEHL
FT                   LAHPDIAAFTAVASTPVAEYIYTTAAAYGKRAHTFGGAKNHCVVMPDADLDQAANAIVG
FT                   AAYGSAGERCMALSVVVTVGQHTADALINKISPLIRAIRVDAGDVEGTDMGPLVSQAHR
FT                   QRVLAAIEKGVNEGARLIIDGRTFQHPQYPQGFYLGPCLFDEVTEEMSVYQNEIFGPVL
FT                   VIVRVNHFEEALALVNKHQYGNGTAIFTRDGFTAREYSQRVQAGLVGINIPIPVPIANH
FT                   PFGGWKRSVFGDTNMHGEESIHFYTRRKTVTSKWPITELKDSSFAMPTHD"
FT   gene            151762..154230
FT                   /locus_tag="lpg0130"
FT   CDS_pept        151762..154230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26237"
FT                   /db_xref="InterPro:IPR040769"
FT                   /db_xref="InterPro:IPR041034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ81"
FT                   /protein_id="AAU26237.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLSELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTFFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEKQQYFLEYALKNAEKIEDVVS
FT                   YLSSRHRTLPAPGNYGAHSLYLIDDEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLELYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKAAQKYASSKPGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSETTLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYV"
FT   gene            complement(154334..155065)
FT                   /gene="dapB"
FT                   /locus_tag="lpg0131"
FT   CDS_pept        complement(154334..155065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="lpg0131"
FT                   /product="dihydropicolinate reductase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.17.1.8"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26238"
FT                   /db_xref="GOA:Q5ZZ80"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ80"
FT                   /protein_id="AAU26238.1"
FT                   /translation="MRTRIIVNGANGKMGILACETLENHEQFEIVAKLSRQDNLGQSIL
FT                   DTKAQIVVDLTRADCVYENSLTIINHGARPVIGTSGLVETQIDELTKLCEIKQIGGIIA
FT                   PNFSLGAILMMILATKASEYFSEVEIIEGHHQQKLDAPSGTALKTAEMIAAARKKPKNK
FT                   LPLKELTPGARGGSHHDINIHSLRLPGLLARQEVLFGNIGETLSITHNSIDRRCFMPGI
FT                   VLACQKVLNLNNLVYGLEHLL"
FT   gene            complement(155245..155430)
FT                   /locus_tag="lpg0132"
FT   CDS_pept        complement(155245..155430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0132"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0132"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26239"
FT                   /db_xref="GOA:Q5ZZ79"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ79"
FT                   /protein_id="AAU26239.1"
FT                   /translation="MRIILSILAIFIPWLVLLIKDNPGGAVVALIMQATLIGWPFASIW
FT                   AWRAVNPLTPTSQSKQ"
FT   gene            155787..156479
FT                   /gene="proQm"
FT                   /locus_tag="lpg0133"
FT   CDS_pept        155787..156479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQm"
FT                   /locus_tag="lpg0133"
FT                   /product="activator of ProP osmoprotectant transporter"
FT                   /function="Detoxification / adaptation, Signal transduction
FT                   / other regulatory functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0133"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26240"
FT                   /db_xref="GOA:Q5ZZ78"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ78"
FT                   /protein_id="AAU26240.1"
FT                   /translation="MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLR
FT                   IRPLKIGIMSDILQHAEKAEQVGISKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNP
FT                   VAEVTEEEAEHASMKIKKRVEKSVKNARKQVNAKAANHSHVNSQPSAVSSVKPMNSFDS
FT                   HPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKA
FT                   EEKKETTE"
FT   gene            156480..157550
FT                   /locus_tag="lpg0134"
FT   CDS_pept        156480..157550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0134"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26241"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ77"
FT                   /protein_id="AAU26241.1"
FT                   /translation="MRIATLFLAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLSQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASTKPSSAKPYPLYALPEDEQNL
FT                   TLDKANAKPGLIRFRYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKRIFNVHRSNNIAYDRTKTPYQQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRTMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDVLYRATR
FT                   DLPDYVDAYFMILKQP"
FT   gene            complement(157650..163277)
FT                   /gene="sdhB"
FT                   /locus_tag="lpg0135"
FT   CDS_pept        complement(157650..163277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="lpg0135"
FT                   /product="SdhB"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26242"
FT                   /db_xref="GOA:Q5ZZ76"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ76"
FT                   /protein_id="AAU26242.1"
FT                   /translation="MLLLSIEVINMPDHNSSDIPLSQQIDEVRGLLLKALKAQLDDLIA
FT                   GKLTPQPSGVPFVHFEKDPPQIATLKKVINCLYHAEEAFKSWESIDTSTLLGKAKAAPK
FT                   LIRALTQIYKSLGLLDEATPEIRSVIADNYHLLEPLFTQAYTIVQESGWLSEFMEMDVT
FT                   DKASKVIFQGMDLLGPDIDKWHDTHPLVDAFAKISKLVETISKLQEKDMPGKEKEQAVE
FT                   LVRALLDDLDNNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWAN
FT                   HYLPTLITFADQLERQNYLKPGSLSTNLCSQIEHLGKQVNGILSEPNFGITERVVSIES
FT                   LKGKREQQIHNAQANSVRAIMATEKQQAATADFYRILEAYKGMNLSQVTEPDRILLRQL
FT                   YPQIQTALAHASLDLENLLTSVLNTTGPEKTPAKPKSWWELAKGGLGYVASYVVNYNVD
FT                   KILGTRESVDRFLSSQIASEQFKILIAEKAREKLRTGSDKLEETALQYKAEVRVNAIKS
FT                   TLRKQPLQREAPPSTFVAVKPSKLVNLRGTLTAIQEMQLSTTVNSTRTNVDTLIHRHLP
FT                   EKYQACFSTLPYQVNEKDPELVKQIKTIENNLFQLEKALKDFEKIDLSYGIMIRLHYFI
FT                   AIASAASKLKSSVKELSPEGQKALAPLLQQIMTLGSSFSDTNYTTNDLSALQQLKTEGQ
FT                   ARPGSPLGTSPEKTKTLPEETIKGNDKKPKEKTTELLDYADKISTARTLLLSKFKSTLS
FT                   PAIADSLNPQEHGVPFIHLDQDPPQTAAIKKIINSMYHAECALKTWHGIDTSTRLGKIA
FT                   AAHQGVAALSQVYKSFALFTEDFSDIHNLIRENHDLIAPVIIEANKLVKEYGWASQFSE
FT                   LDVAQKLGSILGQGINTVQPKTDEITQTASLVKLFSEIPRLLNNISSSLDENAEKSVDE
FT                   LRINSKKIEAIGAVFELFFEENAYLMSMFKGFSAISGLIELNKKIQREGNNLQEITIRQ
FT                   YQKWLKEGYPNLMMMLDEIETRHYLTPGLLSAPIALELDQINDKLNEIIETKPDFKLQK
FT                   IPLSFYMGDKRIERLMTKKTEHCLALLQIEEQKKAVNTFFGILKHYSGQPLSNIKPNEL
FT                   AQLRLAFVKIQSAMANSNLELSNDFVAALNQLETSPSEEINKIKVTVSQLIKLQPAVEN
FT                   NLSEQKKSSELKIAVIDKAIEHVIAKSFELKSDVSKEINIPQLRRTFLETESKKPIVGP
FT                   GELKPTSVSSLNTVRGNLAYIQELKLSSTVGMIREQFSALTRDNFSTRMQKYLIKPPGK
FT                   PLHVINDKDPLMVRQIKEVENSLYHLETALKQFEQMKKSDSFVSQTKALVEIANHAHEL
FT                   KMAVERFSPELKEHYGPVVRTALSFSNKVQSINYNKEDWADLQFILNRAHKELLKRKTP
FT                   RDHRIEKAFFEAGIREVQIDRTESAGKKAAKLGVKYAHLASPQLEKARAYLSSRYKNAF
FT                   GQQPKAIRSLTREQLANEEFMDAEISRLKKTLEEKYGFNIATIKVLLALLEQIQRAGAQ
FT                   AAEVAGMVNTLVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLS
FT                   AALELDMPFSKKLSILDDTTYVNILVRQTESDLQTLRKKLSEDPSNHEIAFEIEIKNDK
FT                   LAFLRQQMVLLEDKNPNQTRNVLLDMQFEVSLRNHLVYTTLKAPIAQEYEQIAREYYKK
FT                   NKNRFLYADDCSKELLQGLKEFEKKHLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIE
FT                   NINRELQNRDIPIEQRAIKVKSLPNDAVFIEKLSSADKGTHFLRKFIQFITIITASITE
FT                   AIKTGGSLIYIYRQKQMEQSIKNIEKSISLKEELHTIKNTDGASPRKGEGQEGEIEFTK
FT                   L"
FT   gene            complement(163368..164792)
FT                   /gene="pykA"
FT                   /locus_tag="lpg0136"
FT   CDS_pept        complement(163368..164792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="lpg0136"
FT                   /product="pyruvate kinase II"
FT                   /function="Carbohydrate Metabolism, Nucleotide Metabolism,
FT                   Energy Metabolism"
FT                   /EC_number="2.7.1.40"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26243"
FT                   /db_xref="GOA:Q5ZZ75"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ75"
FT                   /protein_id="AAU26243.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLANELSIGDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAQITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDPETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
FT   gene            complement(164776..165966)
FT                   /gene="pgk"
FT                   /locus_tag="lpg0137"
FT   CDS_pept        complement(164776..165966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="lpg0137"
FT                   /product="phosphoglycerate kinase"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="2.7.2.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26244"
FT                   /db_xref="GOA:Q5ZZ74"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ74"
FT                   /protein_id="AAU26244.1"
FT                   /translation="MNLIKMSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIK
FT                   SALDSGAAVIVLSHLGRPEEGKYEKKFSLEPVADYLRENLEYPVRFVKDYLSGVGVNPG
FT                   ELVVCENVRFNPGEKANDEALAKKLASLCDVFVMDAFGTAHRAQASTYGVAQYAPVAVA
FT                   GPLLIRELEALNQVLKAPKKPIVAIVGGAKVSSKLSLLKQLVGMVDVLIPGGGIANTFL
FT                   KAQGFEIGISLYEPDLLDEARHILILAKEKGCQIPLPTDVVVGKTFSETCPAFNKSLSN
FT                   VAADDMILDIGPETIRDYVDLIHDANTIIWNGPVGVFEFPQFAYGTRAIAIAIAESDAF
FT                   SIAGGGDTLAAVDLYDLNQQISYISTGGGAFLECLEGKTLPAVAILQERAKHVKTN"
FT   gene            complement(165977..167005)
FT                   /gene="gap"
FT                   /locus_tag="lpg0138"
FT   CDS_pept        complement(165977..167005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="lpg0138"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /function="Carbohydrate Metabolism, Metabolism of Other
FT                   Amino Acids"
FT                   /EC_number="1.2.1.12"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26245"
FT                   /db_xref="GOA:Q5ZZ73"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ73"
FT                   /protein_id="AAU26245.1"
FT                   /translation="MSMEVTLTRRSSMTIRVAINGYGRIGRCILRSIFEYNRQNEFEVV
FT                   AINDLSGIDVTAHLTRYDSTHGPFRSDVSIEGNMLIVDGHGIQVIAERDPAKLPWKQLD
FT                   IDIVFECTGFFTSRDAAMGHINAGAKKVLISAPAKGVDTTVVYGVNHSVIKASDVIVSN
FT                   ASCTTNCLAPVVKVLNDAIGIESGLVNTVHAYTKDQMLLDGSHKDLRRARSATQSIIPT
FT                   KTGAAAAVGLVLPELAGKLDGFAMRVPVLNVSVVDLTFQAKRATSVEEINDIMRKAKNR
FT                   ILQINEDPLVSCDFNHNPASAIFDTTETKVIGNLVKVVAWYDNEWGFSNRMIDTAHQMM
FT                   NC"
FT   gene            complement(167051..169129)
FT                   /gene="tktA"
FT                   /locus_tag="lpg0139"
FT   CDS_pept        complement(167051..169129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="lpg0139"
FT                   /product="transketolase I"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="2.2.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0139"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26246"
FT                   /db_xref="GOA:Q5ZZ72"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ72"
FT                   /protein_id="AAU26246.1"
FT                   /translation="MNGLLADLCLLSDNSASVKCKRVGMNSFTELANAVRMLSIDAVNQ
FT                   AQSGHPGMPLGMADIATVLWKKFLKFNPKNPHWFNRDRFVLSNGHGSMLLYSLLHLTGY
FT                   NLDISELKNFRQLHSKTPGHPEHGHTPGVETTTGPLGQGLANSVGMALAERVLASTFNH
FT                   DHFNLVDHYTYTFAGDGCLMEGISHEACSLAGTLGLGKLIVFYDDNGISIDGKVESWFT
FT                   DDTTSRFKAYNWQVIGPIDGHDADQIEQAISAARENTTQPSLIICKTVIGLGSSVAGSE
FT                   KAHGSPLSAQDINNVREFFNWKHAPFEIPDSIYKQWDHREQGEKEEQQWLQLLHEYRQQ
FT                   HPSEHDEFLRRANGDLPDDWQEISAGFLKQCLNNEKAIATRKASQQCIEFFAPILPEMF
FT                   GGSADLTGSNNTDWSGSKAITAHNFSGNYLYYGVREFAMAAIMNGLAVHGGFIPYGGTF
FT                   LVFADYARNAIRLSALMKQRVIYVLTHDSIGLGEDGPTHQPIEHIAMLRMTPGMTVWRP
FT                   ADLMETAVAWQQSLEHHNGPSALLLSRQNLPALAHGTDAADLIKKGGYIIADCEGKPDA
FT                   ILIATGSEVQLAITAAEKAKARGLQVRVVSMPCAERFLAQSDDYKNQVLPGQVRTRIAI
FT                   EAASSAYWHQFVGFDGAVIGLDCFGVSAPATDAFNYLGITVEKIINTLDTLTKQTMV"
FT   gene            169315..170649
FT                   /locus_tag="lpg0140"
FT   CDS_pept        169315..170649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26247"
FT                   /db_xref="GOA:Q5ZZ71"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ71"
FT                   /protein_id="AAU26247.1"
FT                   /translation="MTPIISHLLKIFPELNTQVKTDSLNWTFNTHLKQLGPDFYSKVAR
FT                   LHPILNMEYSVLCQHLRYNLSSPDYSSPEQIKEQLIDALKLAELLEYTYQHYLVVPREV
FT                   VRLRRHKAIYKELLTELSGYSFALDNPEPESLKTSLSLTQAIREKTAQSNWYRIFISRS
FT                   KRVINLLDNLDTGSKAFRDFVVLLDKYTNPFLAYLGWCFFAPRLFTNLFLILKHTIPGE
FT                   WMGEKEKSLDWSDRFYAHLQRRWFELANDSVWFTVGILNCFVLVGALAPLSVYLSLFAF
FT                   VFDVANTSLRAYIEIGRLQQLQKEYGELFDQEENEDQKKIIKEYQDLISYRIKFEILRS
FT                   FLSVGGAVAVVIAMALSVPALGIINPIIPLIGAVLLLALWGVSLYLNNKLDEYRPVDNI
FT                   EKPAPSVINKLSFFAPKNEKKESLHLSSKPEKVLEAEELIPAFTF"
FT   gene            170703..172763
FT                   /locus_tag="lpg0141"
FT   CDS_pept        170703..172763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0141"
FT                   /product="oligopeptidase A"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.24.70"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0141"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26248"
FT                   /db_xref="GOA:Q5ZZ70"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ70"
FT                   /protein_id="AAU26248.1"
FT                   /translation="MNVMLSKNYMMEKYNMSTTVGLPQFSHIKIEHFKSHLDALLKNHL
FT                   EEIDRLLKENHHYTWDNLIYPLDSLADELERFWSPFAHMHAVMDSETIRESYEACLPLL
FT                   SAYDAAIGHNQDLYEAIKSIDQHSLNPAQKKIIADSIQDFELSGVALSKANKKRFEAIQ
FT                   SRLAELSSKFENNVLDATHAYTIHITEAERMAGLPEHALNTAKELAHEKGLDGFVLTLE
FT                   YPCFQAVITHAEDRALREEMYRAYITRASDQGPNAGTFDNTPLIDEILSLRHEKAELLG
FT                   FNNFAELSLATKMAASTNQVTEFIYDLISRTRDKGKAEFRQLEVFAQDKWNLSPVNPWD
FT                   VAYLSEKRRQDLYSLSQEELRPYFPQPKVMQGLFAIVKKLFGMSIEEIEGVDVWHKDVQ
FT                   CYCIVDESNQTRGYIYTDLFARPHKRNGAWMDSMQSRRKLEDGTVQLPIATLTCNFAKP
FT                   SANRPAMLSHDEVVTLFHEFGHCLHHVLTQVDYLGGSGINGVEWDAVELPSQFFENWCW
FT                   DEHALSLLTSHADTGETLPSALYERLIAAKNFQSAMAMLRQMEFALFDFRIHQEYQTGK
FT                   ASFVPNILADVRSKTSVVPIVPYNRFQHSFSHIFGGGYAAGYYSYMWAEVLSSDAFARF
FT                   EEEGIFNPKTGHDFLKSILEVGGSRKAADAFVEFRGRPATIDALLRHNGIL"
FT   gene            173401..174849
FT                   /locus_tag="lpg0142"
FT   CDS_pept        173401..174849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0142"
FT                   /product="transposase, IS4 family TnpA"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0142"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26249"
FT                   /db_xref="GOA:Q5ZWJ9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZWJ9"
FT                   /protein_id="AAU26249.1"
FT                   /translation="MIKSPLFEVCMDLAVEDTTAWSEAIFGSVALGDKRLTRRLIQIGK
FT                   QLSSTPGGSLSGSCGGQDALIEGSYRFLRNKRVTANQIAEGGYQVTSWLSQSIPTLLAI
FT                   EDTTTLSYTHQVKESLGDLGGPKEKSNRGFHVHTTMLMDAEQEKTIGLIAQERWCRDIK
FT                   ERGKKNHRRVRLYTEKESYKWEKNTRELENRLGSKMSDVISVCDREADIFEYIQYKLDH
FT                   AQRFIVRASHNRKLEGSNCYLFQMLPSAVNLGIYTIEVAQKANRKKRQVTLELKTTSVT
FT                   FSPSERRAKARELKPITLNVVIAKEKNPSESDCLEWILLTTEATTTLECTRKITRYYEM
FT                   RWRIEDFHKAWKSGVGAEEQRMQSIENLEKMIVILSFVAIRLLQLKEYFEYPTTLVIND
FT                   SSTSCDELLTDAEWKVLWNSVERKSLPEKIPTAAWAYKAIAKLGGWTDSKRTGKAAWST
FT                   IWKGWFRLQERVEGLRIANELMEM"
FT   gene            complement(174882..176057)
FT                   /locus_tag="lpg0144"
FT   CDS_pept        complement(174882..176057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0144"
FT                   /product="transposase TnpA or TnpA2"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26250"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZTI8"
FT                   /protein_id="AAU26250.1"
FT                   /translation="MPRHDVILNLPGFTIKKASGYQPLLLDLTYNRLPRCSHCSSKKVR
FT                   KKSSYERKVHHELIGHRRTILRFKAYKLFCNECGRYGNQQFPGIAKYQRSTERLQVQIF
FT                   HHHTSGISQKELSLQFKQGKATIERWYHRRYQIEGNELLNTPCPKVLGLDEHFFSRKHG
FT                   FATTLCDLKKHKVFDIVKGRREVDLNHYLNSLKGKDRVQVVCMDLSNTYRSLVKKHFPN
FT                   AKIVADRFHVIRLVQHQCMMTYRELSSSIKNNRGLLALLRTKPDKLTSHKKIKRDTFLA
FT                   ENPAIEAIYHFQQQLHELLMNKTLTKVRCRKIIPLFLKMIQNLKQSPFKSLVALGKTLD
FT                   SWKEEIACMWRFSKSNGITEGFHRKMKLIQRRAYGFRNFENYRLRVRVLCA"
FT   gene            complement(174882..175442)
FT                   /locus_tag="lpg0143"
FT   CDS_pept        complement(174882..175442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0143"
FT                   /product="transposase (01), TnpA"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0143"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26251"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZTP3"
FT                   /protein_id="AAU26251.1"
FT                   /translation="MDLSNTYRSLVKKHFPNAKIVADRFHVIRLVQHQCMMTYRELSSS
FT                   IKNNRGLLALLRTKPDKLTSHKKIKRDTFLAENPAIEAIYHFQQQLHELLMNKTLTKVR
FT                   CRKIIPLFLKMIQNLKQSPFKSLVALGKTLDSWKEEIACMWRFSKSNGITEGFHRKMKL
FT                   IQRRAYGFRNFENYRLRVRVLCA"
FT   gene            complement(176091..176453)
FT                   /gene="ccrB"
FT                   /locus_tag="lpg0145"
FT   CDS_pept        complement(176091..176453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrB"
FT                   /locus_tag="lpg0145"
FT                   /product="site specific recombinase"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26252"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ66"
FT                   /protein_id="AAU26252.1"
FT                   /translation="MEQRNINLYTLQQELLKIEKQINASTSRFIETTSQVIQRALEKKI
FT                   EELEEQKLQILQSIELHSNNKIDFETALMAVLSFMENPYKTWVNGDLKQKKLVQRLVFI
FT                   KALPQQRGHFNQVSIN"
FT   gene            complement(176652..176885)
FT                   /locus_tag="lpg0146"
FT   CDS_pept        complement(176652..176885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0146"
FT                   /product="transposase B, TnpA"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene, also ISR508 transposase OrfB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26253"
FT                   /db_xref="GOA:Q5ZZ65"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ65"
FT                   /protein_id="AAU26253.1"
FT                   /translation="MSKKGDCWDNSVAESFFSRLKDELVHWRNYQTRREAKQDILDYMT
FT                   MFYNNQKLHSSLDYLSPNQFENRYWGLMKKVA"
FT   gene            complement(177533..177826)
FT                   /locus_tag="lpg0147"
FT   CDS_pept        complement(177533..177826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0147"
FT                   /product="transposase, IS911"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0147"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26254"
FT                   /db_xref="GOA:Q5ZZ64"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ64"
FT                   /protein_id="AAU26254.1"
FT                   /translation="MSIRRKYTKEFKLDAISLVTEQGYTCPEAARSLGINSNILSRWIR
FT                   EAAENNENAFRGNGKLTEEQLEIRQLREEVRRLTMEKEILKKATVFFAKEAK"
FT   gene            178308..179678
FT                   /locus_tag="lpg0148"
FT   CDS_pept        178308..179678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0148"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26255"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ63"
FT                   /protein_id="AAU26255.1"
FT                   /translation="MSQDSFQSSYTPVHYGKSASEFSKERGQWLLANVEQQIGWPQKRA
FT                   LISYRGRKILLLPATSKYYAGVAVITKIGQLDEGKIFVMQFLSALAWYRPSKIDIIQWT
FT                   NSATQGSLNQYLRLELTKRPGMTALFFRPTMLPDPKNKNAQLALSLFREGLSLNHLGYS
FT                   FLSYYKIINMRYPNGATQKQWIRSNLYKLESLKYLSDRLSSLKQKHNDLAYYIYTECRC
FT                   AVAHAGGTAPVYDPESLYDEIRFYEIQPIAHALAKIIIEDEFCIKTTNTILKEHLYELE
FT                   GFHYLIGDKVTKRLKDRESISTTEIQIPHLISLRLWGKRKFRAFEKLSVTVIGINKGIV
FT                   QLSLTRDGRVIIPLALDFPSEKLIFEPMTGADLSDDGTPNAASQFADTYRFYGEVIANG
FT                   ILEVWDVNSNLILGRLLEYLPVNILPSQTKDNLIKIEKRWRDEAKRRVVAIKSPNGK"
FT   gene            complement(179810..181150)
FT                   /locus_tag="lpg0149"
FT   CDS_pept        complement(179810..181150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0149"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26256"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ62"
FT                   /protein_id="AAU26256.1"
FT                   /translation="MAYTKWTYEKLIEEARKYQTKQEFRTKNCSAYAAAKYQGIIEKVC
FT                   SHMIPAHMSWSDEMLATEAKKYQSKIDFKNGSSGAYQAAHKRELIDQICTHMDNLHPKW
FT                   TEEKIRDEASKFKTKSEFRASNLGAYKAAWKRGILNDVCMHMIDMKTDWTYEMLLSEAK
FT                   KYSSRGEFSSISNAYQIAAKRGILDEICSHMEVHHVNWTDEMIFEEATKFKSRSDFKLS
FT                   SPLAYAAAQRRTILDKACGHMEFKHKYWSNEEIAQEAKKYKTRNELQMRSTAYGIAHKR
FT                   GILDEVCSHMKYTERVNWTPKLLAEEALKYSTRADFYRNNNNAYVAARRFGVLDDITEH
FT                   LEYLDRYNTRDVVYLWHAEADIYKVGITSENLGDKRIYDVAKDAGFIPKIVMLENVGTV
FT                   MAKRIESQILKLGQPLSFRNSFPGSSEFRHFSSTDLNKAIELIKTGN"
FT   gene            complement(181180..182550)
FT                   /locus_tag="lpg0150"
FT   CDS_pept        complement(181180..182550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0150"
FT                   /product="putative phage protein"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26257"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ61"
FT                   /protein_id="AAU26257.1"
FT                   /translation="MSLALPDFEFSFATRDEFDRKPVAKKLINILNSNIDISPMVIDGS
FT                   WGTGKTEFCRKTIKLINDEFNETLICAYIDAFEADHTNDPLIPIVAAISELIEDSSKKI
FT                   AFLNKAKAIFRYGLKASARASVAWLLRSNTETLDQEFQKELEKAVDEGSQNLVDGVITD
FT                   YQEAKKDINSLKLILQDLTVEKKLVIFIDELDRCKPDFAIAIIEKIKHVFDVANVKFIL
FT                   VTNYTQMKASVNHCYGLALDAHRYLDKFIKFKFYLPTDKYSNKRKQHVSYHYADQLIRN
FT                   SDILKAHSRYYLDSRFDLLNNLIIINELSLREISNFILYLELFHTLKSDQFAPDKWYHL
FT                   SIFIIFILYFKPELREKIRKKDILASELCKFLGINSHIKAKELTHDKDGVSRDIATLIM
FT                   IFLNDNSIPGYQSDDEEDFKGWLSKLALSTNVGYLELITYIEQFINDIFNEFQFVTK"
FT   gene            182740..183804
FT                   /locus_tag="lpg0151"
FT   CDS_pept        182740..183804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0151"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26258"
FT                   /db_xref="InterPro:IPR032557"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ60"
FT                   /protein_id="AAU26258.1"
FT                   /translation="MKKIILDTSILRSLSLSKSAEVEALNKLIKYEHVEVYLPYIIYNE
FT                   YITHLRDEFNQSVIILNREVRKLNKYLYKSRSIKDEFLKAVDQINFDEINEFNYWIDKY
FT                   QIQVATNLDLDPTVVLTDYFNGKLPYRSLKCREDIPDSFIHHEIMKYSEQTKEEIIFIC
FT                   HDKKLIKSFENTRISLYDSLKDYVQKPETNKLLSAIKAEFLVELYDYFVENIEDVRERI
FT                   ENDLSTKIDYMEIQSNHIPSDNNEGNIASIEYVDPKDFKIIKDSLYHYGDDLYTFDTVF
FT                   LADVSVDFYIYKPDYYCLDEEFYTEDHNDHYFSAQKSIIVEFKCNIKVNILIDEDDDSV
FT                   TYENLEINDISFSG"
FT   gene            184405..184920
FT                   /locus_tag="lpg0152"
FT   CDS_pept        184405..184920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0152"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26259"
FT                   /db_xref="GOA:Q5ZZ59"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ59"
FT                   /protein_id="AAU26259.1"
FT                   /translation="MSNVSIRKATPLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIAE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDDIEDNSKGEISAVYIHPNFWHQGF
FT                   GKKLSLAALKNLKELGYSEALLWVLSDNSQARSFYEGIGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
FT   gene            complement(185908..186222)
FT                   /locus_tag="lpg0153"
FT   CDS_pept        complement(185908..186222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ58"
FT                   /protein_id="AAU26260.1"
FT                   /translation="MKPTLFLVLMWICAESFGATIMVKGLPSPLGYSNDLYYWPPNVAI
FT                   SPDTTNLFITMDGINKVCFLNTGLQGGLEQISEISIIINGVKKDWNCFPYTTTILEARP
FT                   "
FT   gene            187002..187889
FT                   /locus_tag="lpg0154"
FT   CDS_pept        187002..187889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0154"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ57"
FT                   /protein_id="AAU26261.1"
FT                   /translation="MASQVIFLSWGHYFKFEKTTNIEFCIYKKQINLYRLSASCLIKEI
FT                   FSMKRYIWFHPSYVLESTEATLLGQQTNAKDHGYILLNDQELGKVTCEDHLTIMGHSTL
FT                   APTPAEDTGLYIQGDTADDLIRRLTTNGLKEAPKILSLESCRAGISGGLAQQLSRSPFF
FT                   KYTLIEANLNSVGRKPMEMQWNFPTDSLGRAVLKLDNSPWMFYLGGFLVGRLTHDAYTT
FT                   EDLFSLLSPPTFHKHFFANYQPGFFGGRSGRHCLFNKTTITLEKASNFALEDQDSASAK
FT                   ALEVVLKKLYSQPA"
FT   gene            complement(188236..189114)
FT                   /locus_tag="lpg0155"
FT   CDS_pept        complement(188236..189114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0155"
FT                   /product="sensory box (GGDEF/EAL domain)"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26262"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ56"
FT                   /protein_id="AAU26262.1"
FT                   /translation="MLTNIERAKLQLIDETNDMVIITKAEPLDAPNGPEVVWVNKAFEN
FT                   ISKYKANEIIGQTPRILQGKETNQNTLKMIKEALKAQTNINVDLLNYTKDGTPYWISFS
FT                   IVYLRDGQGNLCYLGAIEKDITALKNLNFKLSEKAKTDPLTNVYNQENFFIAGNEAIKN
FT                   FHQNQEAVGLLFFDVDDFKGINDTQGHIYGDMILKKVAQESLKLVRKTDNVFRYGGDEF
FT                   AIIFSGIDVKILERKAQQLQKKLAKSHISVSIGGTISIQSDKSINTLLARADEALYYVK
FT                   ANKKGLFFIAE"
FT   gene            complement(189144..190304)
FT                   /locus_tag="lpg0156"
FT   CDS_pept        complement(189144..190304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0156"
FT                   /product="signal transduction protein (EAL/GGDEF domain
FT                   protein)"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0156"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26263"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ55"
FT                   /protein_id="AAU26263.1"
FT                   /translation="MFLQASRRKTYTIIKLKETQSIKGNSMPCEKCDSAATYHLSGTYQ
FT                   LLILPPRGHCYSKLLKHLTENNFDINKRDSGIIELLFTAERAQDIGHALERCYSQAELE
FT                   DSKAVLLPIDIADRNVERVLNHTHSLKKIVGLCLSQWLVGLIENQGLSTFCQPILHNTT
FT                   LKPYGFECLLRGKQDNNILPSSDLFGAAKSSDMLFLLDKKARICHIENMSKIDIADKKI
FT                   FINFNPTAIYDPLFCLTTTNQSLKKTSIKPAQIVFEVTESDEVKDKKHLLKIIDYYRNQ
FT                   GYCVALDDLGSGYSSLNLLTELQPDYVKLDQELISQIHTNEFKQIILEKICEMATKLKI
FT                   KIICEGIETEDELQIIKNYAIDFYQGFLFEKPMPYEKIPDYIKASA"
FT   gene            complement(190331..191104)
FT                   /gene="map-1"
FT                   /locus_tag="lpg0157"
FT   CDS_pept        complement(190331..191104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map-1"
FT                   /locus_tag="lpg0157"
FT                   /product="methionine aminopeptidase"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.11.18"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26264"
FT                   /db_xref="GOA:Q5ZZ54"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ54"
FT                   /protein_id="AAU26264.1"
FT                   /translation="MKYTMLVKTPEEIKKMRVAGQLAASVLEMIEPYVIAGTSTKELEQ
FT                   ICRQYIVEDLKAIPSTLNHYGFPACICTSINHVVCHGIPSEKKLKNGDIINIDVTVQKD
FT                   GYIGDTSKMFLVGNIKPFAKKLVEVTQECLYKAISIVRPGAHLGDIGNIIQTHAEQHGY
FT                   SIVREFGGHGIGKSMWEDPHIMHFGKPNTGLRLQAGMTFTIEPMLNLGRKEVKTLGDGW
FT                   TVVTKDHKLSAQWEHTILVTDNGHEILTLRADEHL"
FT   gene            complement(191073..191285)
FT                   /locus_tag="lpg0158"
FT   CDS_pept        complement(191073..191285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0158"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0158"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26265"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ53"
FT                   /protein_id="AAU26265.1"
FT                   /translation="MGIVKISDELHEATKLMARAMSRSINSQAEYWIRIGKLAEENPSI
FT                   TYTDILKILVHQASLGEIYDVSEDA"
FT   gene            complement(191460..191939)
FT                   /locus_tag="lpg0159"
FT   CDS_pept        complement(191460..191939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0159"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26266"
FT                   /db_xref="GOA:Q5ZZ52"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ52"
FT                   /protein_id="AAU26266.1"
FT                   /translation="MKEKTAKQLKLFIIYLLSYWLLSIISCLIAFGYDDSLRMLLASPK
FT                   SDLSGALLFFSSFIAAALLFVFRYKTFSDKPYPYFIFGFYVGNVSLLMLFILDAFIREL
FT                   IVWKFPEFLLVFISPFVELVLSYLFFGFAFLAIIPAVTSAFILYAVQRKLLLSPI"
FT   gene            192160..193137
FT                   /locus_tag="lpg0160"
FT   CDS_pept        192160..193137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26267"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ51"
FT                   /protein_id="AAU26267.1"
FT                   /translation="MNLKKEVFLNQNCAEMMIKKAARLILGSDLDFEYTRDVQDIQIDL
FT                   GPAFMFSPDEEKTLWVSGKNQETLERDLATLNKSSAYFFRTGTQGGAGHWQVLYYEAAK
FT                   SGWVSYSSQSNHFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAQNIIHAA
FT                   NFVYIFRTQNEDAAIQYCALNQALHPEIKRITITKVQTQTRLTPEIHCPRGDLSYANLK
FT                   NVYSKHLALLHVINRLEAGSKSYNPYWMGSQEKLNKIFEALGHCYQKGLDVDNELNNSN
FT                   SKLSKAINMRRLPSLFSFWCEKNESFVESRKIIEEHRICRLNNL"
FT   gene            complement(193391..193852)
FT                   /locus_tag="lpg0161"
FT   CDS_pept        complement(193391..193852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0161"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0161"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26268"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ50"
FT                   /protein_id="AAU26268.1"
FT                   /translation="MLPVIDLCPNHCQNMKTYRKELWFNIPERMGFINITDKVIECLKE
FT                   SRIQEGLILVNAMHITASVFINDDESGLHQDYKKWLERIAPHQPIEQYRHNDTGEDNAD
FT                   AHIKRQIMGREVVVAITEGRLDFGPWEQIFYGEFDGHRDKRVLVKIIGQ"
FT   gene            194022..194303
FT                   /locus_tag="lpg0162"
FT   CDS_pept        194022..194303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0162"
FT                   /product="SapA-like"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0162"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26269"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ49"
FT                   /protein_id="AAU26269.1"
FT                   /translation="MLICKTQITQDWVEFADKATKFAWQFGIGSLYALSDSLLIDINYN
FT                   FISIGEVRNSGQYNAIAANNTPASGAPTKFTNVYSNQAEIGIHYQFNT"
FT   gene            194761..195582
FT                   /locus_tag="lpg0163"
FT   CDS_pept        194761..195582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0163"
FT                   /product="hydrolases of the alpha/beta superfamily"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0163"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26270"
FT                   /db_xref="GOA:Q5ZZ48"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ48"
FT                   /protein_id="AAU26270.1"
FT                   /translation="MFLVSISIKTNKESIMSKTIYFFSNNLKLEGKLEEPTGQCLGYVL
FT                   FAHCFTCGKDIAAASRIASALVANGFAVLRFDFTGLGSSEGSFSETNFSSNVEDLVAAA
FT                   DYLRTHYQAPVLLIGHSLGGAAVLLAAKKITEVKAIATIGAPASAHHVKHHFSADLSKI
FT                   ESDGEAHVTLGPRSFTIKKQFLQDIDRYQETIKSDAGKALLIMHSPIDKVVSIKEAEKI
FT                   YKAAQHPKSFISLDKADHLLSNKRDSQYAAEVIAAWASRYLAPSLEDKRAE"
FT   gene            complement(194901..195011)
FT                   /locus_tag="lpg0164"
FT   CDS_pept        complement(194901..195011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0164"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26271"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ47"
FT                   /protein_id="AAU26271.1"
FT                   /translation="MLPKPVKSNRNTANPLATKALAILLAAAISFPQVKQ"
FT   gene            complement(195663..196118)
FT                   /locus_tag="lpg0165"
FT   CDS_pept        complement(195663..196118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0165"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0165"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26272"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ46"
FT                   /protein_id="AAU26272.1"
FT                   /translation="MPDITHYLKPMVLFSGLLVATFAMAEATKAEETSTVKLSTILQQL
FT                   SDQGYKNIHDAEIDDGVLTVEGSNEQGVKFEIHIDPATGKILKKQEHPQPKYSIIDITK
FT                   KIENEGKFKIIEIEFDEGIYKIKGETASHEKKKLYIDPNTGEAKTNH"
FT   gene            complement(196286..197170)
FT                   /locus_tag="lpg0166"
FT   CDS_pept        complement(196286..197170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0166"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0166"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26273"
FT                   /db_xref="GOA:Q5ZZ45"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ45"
FT                   /protein_id="AAU26273.1"
FT                   /translation="MAGTSLLTLIDDIATALDDIAAMTKVATKKTAGVLGDDLALNAEQ
FT                   IIGIHANRELPVIGAVAKGSAVNKLILIPLAILINFFVPALVGILLILGGLYLCFEGFE
FT                   KIVEKIFHKKNEPAKKKTDTQTIDMRQFEKEKISGAVRTDFVLSAEIIVITLGTVAATS
FT                   LINQIAVLTLISLIMTIGVYGLVACIVKLDDLGFILREKKHPLKQIGILLIGAAPILMK
FT                   ILSVAGTIAMFLVGGGIITHQITAIHHFTENLSAMMSIGVDFFIGIISGAITAALYFTF
FT                   KKMKSKFKLMNTK"
FT   gene            complement(197445..197855)
FT                   /locus_tag="lpg0167"
FT   CDS_pept        complement(197445..197855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0167"
FT                   /product="peptide chain release factor"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0167"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26274"
FT                   /db_xref="GOA:Q5ZZ44"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ44"
FT                   /protein_id="AAU26274.1"
FT                   /translation="MIGKDKWEILTEKMTNLHIYETDLSEKFILGSGKGGQKLHKTAST
FT                   VYLKHLPTGMEVKCQESRSREDNRYFARQRLCEKLQAVFSDEKTKTQQRIEKIKRQKKR
FT                   RSRRSKQKMLDEKSRQSQLKTLRKSPRSHDIE"
FT   gene            complement(197956..198681)
FT                   /locus_tag="lpg0168"
FT   CDS_pept        complement(197956..198681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0168"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0168"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26275"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ43"
FT                   /protein_id="AAU26275.1"
FT                   /translation="MKNNRHFLKFYCIRDLSWLSSVRASFIYSPFERITSSPFSSYIEL
FT                   RKKPVKFLLILLIALTLCDCGRSKETQFYLLTPIPPQKNSRNSYNHLQIGVDEVSIPDY
FT                   MKKPQLMIHQTAHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWNNKFHP
FT                   DYHLQVMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNT
FT                   NLTHLTEEIARFFIKNTTK"
FT   gene            complement(198678..199463)
FT                   /locus_tag="lpg0169"
FT   CDS_pept        complement(198678..199463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0169"
FT                   /product="probable transmembrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0169"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26276"
FT                   /db_xref="GOA:Q5ZZ42"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ42"
FT                   /protein_id="AAU26276.1"
FT                   /translation="MPVCILLLRFRDDVHNERFYTLVGIFIVGALCLMILGGTFFYIEY
FT                   KRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFV
FT                   ERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPT
FT                   HNSAEKYTSMEEAFEAAKKAFEDVSELVRSKEIQDTLEAIQKVSENLGQLASSLNQDVP
FT                   SVVAYLNQSLKQITSAAYSTQNLTDYLSRYPESLLRGKR"
FT   gene            complement(199432..200187)
FT                   /locus_tag="lpg0170"
FT   CDS_pept        complement(199432..200187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0170"
FT                   /product="probable ABC transport system permease protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0170"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26277"
FT                   /db_xref="GOA:Q5ZZ41"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ41"
FT                   /protein_id="AAU26277.1"
FT                   /translation="MYVFRRFSKPIITFLHSLELAFRFLGHLVHSTIKVIFGKLSIVWP
FT                   NTLEMIYYSGARLVILLSFIGILLGATVSQTVYALLKPFQLHQRVLPIVQNILTHEILP
FT                   VLIGFILCIQAALHMVNTRLEHYQENPEAIILAQVLPIIVGMNIASLLLYVYLVSAIFF
FT                   SFYLTFHFMLGFTNNEFLSYVVSSTTLFDLIYSVVKTLILCIIVGLTSGYYYYEASIRH
FT                   IYLRKAVSRILTRGSFWLIIASMYITLTF"
FT   gene            complement(200453..201019)
FT                   /gene="legU1"
FT                   /locus_tag="lpg0171"
FT   CDS_pept        complement(200453..201019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legU1"
FT                   /locus_tag="lpg0171"
FT                   /product="FBOX-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26278"
FT                   /db_xref="GOA:Q5ZZ40"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ40"
FT                   /protein_id="AAU26278.1"
FT                   /translation="MKAKYDPTKPGLQKLPPEIKVMILEFLDAKSKLALSQTNYGWRDL
FT                   ILDRPEYTKEITNTLFRLDKKRHRQAIAQMMSGRVTASSMAKLFEELLCFSIPSSYVFL
FT                   IFFASQKSVALIEVLTVILVFAAITSLAHDLVDYFIESDTKAEKQHAHRRAFQFFAQPS
FT                   QSAAQQNLEEENLSADPKACQCEPL"
FT   gene            201209..201934
FT                   /locus_tag="lpg0172"
FT   CDS_pept        201209..201934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ39"
FT                   /protein_id="AAU26279.1"
FT                   /translation="MLYNKWGYLMTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRY
FT                   GMQMTADMPGLWSPLSNYDIENDLRMARVHRNGRMREIGYLTVNLVFQFDSLDVTEYET
FT                   KYGISAKDVLEKAGFTCSQDAAGYSEPASTSTRLLGQESKPEKPTQTSVVNTSFFALKN
FT                   VDTDKRFTKSTKLGILYEARSYGKIEDDTLKSYGFTDGQWERQKEGIENIVIIKKLTQS
FT                   ISQGPAVLDEAVDNIPTLS"
FT   gene            complement(202064..202924)
FT                   /gene="oxyR"
FT                   /locus_tag="lpg0173"
FT   CDS_pept        complement(202064..202924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="lpg0173"
FT                   /product="transcriptional regulator, LysR"
FT                   /function="Detoxification / adaptation, Transcription
FT                   factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0173"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26280"
FT                   /db_xref="GOA:Q5ZZ38"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ38"
FT                   /protein_id="AAU26280.1"
FT                   /translation="MSLLLDDIKYFIAASDTLNMTRASEIIGISQPALSYSIKRLENKL
FT                   GGLLFIRLKNGIQLTKLGEEFKRRSHRLLYEWEQVQNIANPESGFVQGNYTIALHPSVA
FT                   LYTLQYFMPKLQVNYPGLGINFIHGHSREMTEKVISWEADFGIVVNPIQHPDLVIIKLS
FT                   TDEVTVFYANDAQNKLIYDRKLAQSQYILKKIGKKITFNGVINSTSLEVVAKLTALGLG
FT                   YGILPTRVTYPYKHLKKVLNAPVFRDEICLVYRPEKHNNPVSKKIIQIIRSSISNDNDK
FT                   ENYFD"
FT   gene            203005..204084
FT                   /gene="pvcA"
FT                   /locus_tag="lpg0174"
FT   CDS_pept        203005..204084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcA"
FT                   /locus_tag="lpg0174"
FT                   /product="pyoverdine biosynthesis protein PvcA"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0174"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26281"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="InterPro:IPR017133"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ37"
FT                   /protein_id="AAU26281.1"
FT                   /translation="MYSLFQEGRKMKNTAFLITKNHYPKDYRLKKSPDSDSAMGVAKRI
FT                   LAEVMIFRRVPETISLCGTGCQKCASPHLPKIISAVNKNEPVTFILPAFPGKSPNPEKV
FT                   LGHLPDHAERLSLNFLGTLCQRIKNFYTPGIKIILCSDGRVFSDVVGMNESDVTAYQLE
FT                   LDRLIKEMSLADLSTFNLDYFYKDLHFVQMREELMKSYGQSLDFLKQKIRNGAKPSASP
FT                   DEQEANRMYSGITRFLFEDAMHAGQTKSRTAIQKESRFKAYEVIRRSNAWSALIAERFP
FT                   KAVRLSIHPQTCGSKKLGIRLIGNESWMTPWHGVAVESNKGYVLLRRSEAEALGAKLIC
FT                   SSDGRHSHYQLMAEVSYEL"
FT   gene            204074..204910
FT                   /locus_tag="lpg0175"
FT   CDS_pept        204074..204910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0175"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26282"
FT                   /db_xref="GOA:Q5ZZ36"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ36"
FT                   /protein_id="AAU26282.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVSGTYQRKMEFYNSKT
FT                   VSPIITKHPQKDFSVIRYNEPPSVDKGHFVNPPDIEFTGIDQEELDFFHRSLENALYSP
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
FT   gene            204907..206349
FT                   /locus_tag="lpg0176"
FT   CDS_pept        204907..206349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0176"
FT                   /product="FAD monooxygenase, PheA/TfdB family"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26283"
FT                   /db_xref="GOA:Q5ZZ35"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ35"
FT                   /protein_id="AAU26283.1"
FT                   /translation="MSAQVADVVIVGAGPVGLMCAYLGQLCGINVVIVDKSNCPLEVGR
FT                   ADALNARTLQLLELVDLFDELYPLGKTCNTSSVWADGQFISRQSSWWEELEGCLHKHFL
FT                   MLGQSYVEKLLDDKLKETAAAVKRSTAIVNIEINEAGCLTTLANGERIQSRYVIGADGS
FT                   RSFVRNHFAIPFEIIRPQIIWAVIDGIIDTDFPKVPEIIVFQAETSDVAWIPREGEIDR
FT                   FYVRMDTKDFTLQEAMDKINHAVRPHSLNFKDIVWFSQFSVKESVAESFFIQDRIFLAG
FT                   DACHIHSVNGGQGLNTGLADAFNLMWKLHMVMHFGAPKELLHSYEAERKPVAHGVIETS
FT                   GELVRSTKYSLNGTHAQDYVRIVQKRAGYITGMGIRYGETGLCGSRLFDFEIFNGIAKT
FT                   RLYSLLDYMKFTLFIFGDCEVELQPPEFVKVIPIYPNQYQKNFWTNNTHYANQAILVRP
FT                   DSYIQYAVPLDKIESLFELAQL"
FT   gene            206346..207494
FT                   /locus_tag="lpg0177"
FT   CDS_pept        206346..207494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0177"
FT                   /product="chloramphenicol resistance protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26284"
FT                   /db_xref="GOA:Q5ZZ34"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ34"
FT                   /protein_id="AAU26284.1"
FT                   /translation="MNKSLIFLAIGMFTVGCNTFLIAGLLPQIGETLEQSVAVTGQGVS
FT                   LFSLTYLFSAPLFSLILVNQPVKRMIQLALTVFMLGNLITLLSENIVLFLIGRSLAGAG
FT                   TGIFTPLCISIAIHFTRPSAKGRILSFIWSANSAGVVFGVPAGLYLSSLFHWQLSIASL
FT                   IILSLLALIGFSMQNIDIKLPKPSPFGGRLRLLIEPKTLSVIGITCFTALASLGLYSYV
FT                   TLIQSGSPNSLSMTLLSWGLGGFIGSSLIGVFIDRTGKPRVIMALILVGLMFALIAIPF
FT                   TRNLPYLGLIPFFMWGACGWAIVTPQQHILYELHENQGTILAAINSSALGLGSALGTLL
FT                   GGLLISSGFRGIYLPFSAATLLFFVLIIQLIVINTSHKVNNI"
FT   gene            207491..208723
FT                   /locus_tag="lpg0178"
FT   CDS_pept        207491..208723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0178"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26285"
FT                   /db_xref="GOA:Q5ZZ33"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ33"
FT                   /protein_id="AAU26285.1"
FT                   /translation="MNRPVVIVDPLSSGIELAPAFKARGIPAIAVTLKPLDWIGFGANM
FT                   QTSDFIEIIPDQPNLVEVLAKYDPIAIIPGTEEGVPLAEALAINLTPQFANDPEKSQNR
FT                   LHKAMMQKALQEAGVPALKTLNTASENEVEAWIRTNGLIDSPLIIKPPVSAGSDKVFHI
FT                   PARGEWKKAFNRVLSEPSKITGKVNATVVVQEQAIGTEFAVGTVSANGKHYLAHLIQYN
FT                   KTSFNDRKTVYDYVEFVPYSKERYGELFDYTQKALDALGIRWGAAHNEIMLTKDGPRLI
FT                   ETGARMCGGPVVGFAREATGSSQADKLVEIYVDGGVSAEEYVFKKTVVPVFLKSPAKGK
FT                   ISNVEAFADLSKLPTFLNEHIWFKNGDLVPQTVDYLTSIGIIGLAGDRDSILLDYEKIR
FT                   NMESKLVIQTF"
FT   gene            208880..209854
FT                   /locus_tag="lpg0179"
FT   CDS_pept        208880..209854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0179"
FT                   /product="O-methyltransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26286"
FT                   /db_xref="GOA:Q5ZZ32"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ32"
FT                   /protein_id="AAU26286.1"
FT                   /translation="MDKNSKSFGEANERIGNAIHHVCLNASDAKFIKSNIQESYQSWAN
FT                   VLYDRVFLNWGLCDKKIYRELSSLNFDFSTVGFFPHVYGQSLLFYLIRPLIKIHFFNKR
FT                   LLDVGCGNGVGLKISSELLKTRYALGIDLVSKLVTNSNNSFYIEDKINYMQADAENMAI
FT                   ANESFDIVTNLESSHLYPQIEHFFSEVERVLAPNGFFCYADVHFDVKQQAQRLEAFVKT
FT                   KKNLRIIEKHNITKMVQASIYQRLIVNEKGFYQLAQYLLGPDKIHYTSELANVASSMGL
FT                   MFLPWWRIRFKNPALQALGKFARRCKHWNKKYYFYYLIQKIDS"
FT   gene            complement(209967..210809)
FT                   /gene="htpX"
FT                   /locus_tag="lpg0180"
FT   CDS_pept        complement(209967..210809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="lpg0180"
FT                   /product="heat shock protein, protease HtpX"
FT                   /function="Detoxification / adaptation, Protein fate /
FT                   hydrolases / secretion"
FT                   /EC_number="3.4.24.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0180"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26287"
FT                   /db_xref="GOA:Q5ZZ31"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ31"
FT                   /protein_id="AAU26287.1"
FT                   /translation="MINNLKTFILLASLTALLVVIGGLLGGSTGMLIALVFAGVMNFSA
FT                   YWYSDVLVLKMYNAEPLPNNHFVNNIISELAHRAGTPVPKVYLINNSTPNAFATGRNPE
FT                   NASIAVTTGLLDRLTQEEITGVLAHELAHVIHRDTLINVVSATIAGAISGIANMFMWLS
FT                   MFGHNSNNEEGVHPVVGMIMMIVAPLAAGLIQMAISRSREFEADAGGARISGNPQWLAS
FT                   ALLKLDQANHEQYFDEAETHPSTAHLFIINPLNGEKLANLFSTHPSTAERVARLRAMY"
FT   gene            211023..211934
FT                   /locus_tag="lpg0181"
FT   CDS_pept        211023..211934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26288"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ30"
FT                   /protein_id="AAU26288.1"
FT                   /translation="MYSKYPAFFLNKNIKSSSGVQFSNVVKIPSAIESLYRGDNNLTGI
FT                   IFLLPTLITGVFCQNFPEVVDIEQIRLHKLTNLSNDFHMVSMSEDPQIALDWGNGCFIT
FT                   IDPVSFSDYIVDVHATFSENQLNLPGRMEREKEHVALAVPFCSIKKITIHNKELANPFY
FT                   LSIPQENHEAKMELNTLYGELISLLRKKYTQEVDEKEEQIALRTYAIRYLDFYAKFCGC
FT                   DNPFDKTIAQLSELYPEFMSNFLQSSHFSSKTGLMKEIVVNSLDNLFKEHPYTKSIDAS
FT                   YIYRVKESTTCYEDDWAKPVYD"
FT   gene            complement(211981..212433)
FT                   /locus_tag="lpg0182"
FT   CDS_pept        complement(211981..212433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26289"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ29"
FT                   /protein_id="AAU26289.1"
FT                   /translation="MLNSSSYMKKSSFFDYSFFTISDTKEEFPLFPEEGMDCLFEKLGS
FT                   RITSKKAGNTYFISPADPSIAIQKGNDGVHEYYHLLLNKKVIAVSSFVNHKTTIYLANI
FT                   IKQLEPERIGTPVDFDFLGDTDETDSVFSDTLDNAEGNVDQTPSPR"
FT   gene            212762..214258
FT                   /locus_tag="lpg0183"
FT   CDS_pept        212762..214258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0183"
FT                   /product="amine oxidase, flavin containing"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26290"
FT                   /db_xref="GOA:Q5ZZ28"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ28"
FT                   /protein_id="AAU26290.1"
FT                   /translation="MTKKVTNIAIIGGGTGLTSAWALENQQKFHVTVFEENDRLGGHIH
FT                   SIKVNNVILEGGAEFIGPPTLYPNVHRLFQYLGVALDQFELNMDFDDLKQKDHIVLPPL
FT                   YHTSSGRSEDTSSILYTLSCGLFGKRRKQNETRVSVDTLLTEMYNLLEMNHLIMDARNK
FT                   LLHPDNLITLEQFIKEFKEKCVHTLSPIDKFAEEFLYPLIASGWGVSIETIKTFGAHYA
FT                   MNYLAAGMNWFDAPEGLSSYIDRMVAQCTNTQFNANTAIKKLIPITIDGKIKYQLLKRD
FT                   GTFVCDATGSPMIYDDVVISTPAYVTSELLSGIESNTIKVLREKLANVTYYDTTVVFHQ
FT                   DPEYLSPYRTVVHSRFDGAQSANTMCKPWKFNNEETPIMKTWVLPGQAMPKNVLREVHY
FT                   KHPVMDKNYYEAQQALHAAQGEAGLWHGGILAGFNDSHESGITAALQVAAQLNHREHCL
FT                   HKNERLALFPNLVDSVLSPKLSTGRVVEVEGVVSSSMSYT"
FT   gene            complement(214503..215387)
FT                   /locus_tag="lpg0184"
FT   CDS_pept        complement(214503..215387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0184"
FT                   /product="ABC sugar transporter, periplasmic sugar binding
FT                   protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0184"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26291"
FT                   /db_xref="GOA:Q5ZZ27"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="PDB:3ROT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ27"
FT                   /protein_id="AAU26291.1"
FT                   /translation="MKKLASTLLCFSLLISASVFARDKYYLITHGSQDPYWTSLFQGAK
FT                   KAAEELKVDLQILAPPGANDVPKQVQFIESALATYPSGIATTIPSDTAFSKSLQRANKL
FT                   NIPVIAVDTRPKDKTKNPYLVFLGSDNLLAGKKLGEKALELTPSAKRALVLNPQPGHIG
FT                   LEKRAYGIKTILQDKGIFFEELDVGTDPNQVQSRVKSYFKIHPETNIIFCLTSQALDPL
FT                   GQMLLHPDRYDFNYQPQVYSFDKTPNTVSLIHKKLVNYVMDQQPFLMGYLSITQLVLMN
FT                   RYQLNPVNINTAM"
FT   gene            complement(215391..216131)
FT                   /locus_tag="lpg0185"
FT   CDS_pept        complement(215391..216131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0185"
FT                   /product="ABC sugar transporter, ATP binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0185"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26292"
FT                   /db_xref="GOA:Q5ZZ26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ26"
FT                   /protein_id="AAU26292.1"
FT                   /translation="MINSHQTQPLLRLENIEKSYGSHRILNKVSFCLYPGEITALIGDN
FT                   GAGKSTLVQIISGYIQADKGNIYWQEQPLCYSNQYNAPFEMRRLGIQIVHQQLALIDEL
FT                   SIWRNFFLGNEINKKIGPFKFLNIRLMQHIASQSLQSFGLVCLPNIDLPVKKLSGGERQ
FT                   MLVVCRAKYFNAKLLILDEPTSALSPAQADKVLQIIKNIAQAGIAIVFITHNPAHIQNT
FT                   AHKVIKLSCGTIEIMELTNTLIKG"
FT   gene            complement(216128..217069)
FT                   /locus_tag="lpg0186"
FT   CDS_pept        complement(216128..217069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0186"
FT                   /product="ABC sugar transporter, permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0186"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26293"
FT                   /db_xref="GOA:Q5ZZ25"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ25"
FT                   /protein_id="AAU26293.1"
FT                   /translation="MYKIHHYFLFGVLVPFISLVSLFTIFSSDFLTLTTWASILASASD
FT                   IGIIVLGVTLLLIGGEFDLSVGANFALSGLLFGSLTLLGINSFLALTIALAIGACIGLI
FT                   NAACTVFFKIPSFIVTLGSMLILRSLILLYTQGLPVSVEDTNGVMQVLAGELSQNLLSS
FT                   FIWWFAIGFYLIYLLNWTKLGNHIVATGNNCDSAYLSGINTIRVKFFCFVCCGIIAAFS
FT                   GVTQFSHLNSLSPIAGEQYELYAIAATVIGGTSLKGGQGSIISTLLATLLLSTVDTGIV
FT                   QIGVSTYWYRSFIGLILIFAMTINVYLRKSDS"
FT   gene            217228..218655
FT                   /locus_tag="lpg0187"
FT   CDS_pept        217228..218655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0187"
FT                   /product="zinc metalloprotein"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene, peptidase, M20/M25/M40 family;
FT                   acylases"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0187"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26294"
FT                   /db_xref="GOA:Q5ZZ24"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ24"
FT                   /protein_id="AAU26294.1"
FT                   /translation="MNGFHFMISKKITQISFSLALALIVGVAEAKTTRPADEQQRARSI
FT                   YKQFIEIQSGFTTGSTTPLVEVAVKYLKKAGFSNEDIFVGGASPQKANLVVRYRGTGDK
FT                   KPLLLLAHTDVVEAKASDWSMDPFQLTEKEGYFYGRGTLDDKAQAAIWIANLIQYKQEG
FT                   FKPKRDIIVALTADEEGSSPYNGISWLIKNHKDLIEADFALNEGGWGDLANGKKISQNI
FT                   QVSEKYIVNYNLEVRNKGGHSSLPTKDNAIYRLAGALERLSKFNFPLKTNDVTAAYFKQ
FT                   MAAIETGPLKTEMVEASKGSKQAMQRLADSSPQWNAILRTTCTPTLLEGGHAMNALPQL
FT                   AAVTINCRVLPEDSPEMVEQSLKTAINDPEVTLKRIGKLSRGPSSPLSPEILKTITQLT
FT                   QRYWPEVPTIPIMVTGATDGRYLRSVGIPTYGVMGLFLDRDDFRAHGRDERISVESFYE
FT                   AHAFLYDLVKQLSSNVT"
FT   gene            218775..219851
FT                   /locus_tag="lpg0188"
FT   CDS_pept        218775..219851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0188"
FT                   /product="acyl CoA transferase/carnitine dehydratase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0188"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26295"
FT                   /db_xref="GOA:Q5ZZ23"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ23"
FT                   /protein_id="AAU26295.1"
FT                   /translation="MENRYILKGLKVIDLSSVLAGPSVGTFFAELGASVVKIEHPVHKD
FT                   VTRTWKLPGEDPDSEISAYFASVNFGKEYLFLDLMKQEDYLCFLNLIAESDILIMNFKK
FT                   GDDVKLRIQDDHLHSINSRLIIGKINGYGDESDRVAYDLVLQGESGFMSINGTQESGPV
FT                   KMPVALIDVLAAHHLKEAILLALYQREKSGKGRVVSVSLYDAAVSSLINQASNYLMTGQ
FT                   VPQRIGSLHPNIAPYGELFQTSDGALIILAIGSDRHFVKLCNILGLKDLPGKDEFRHNQ
FT                   NRVRNREQLAVLIAEQTEKLQSSELLEMLHRENIPAGKIMDLKDVFDNERAKSLIRKEV
FT                   IDDVPTARVTSVVFKQTL"
FT   gene            complement(219993..220859)
FT                   /locus_tag="lpg0189"
FT   CDS_pept        complement(219993..220859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0189"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26296"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ22"
FT                   /protein_id="AAU26296.1"
FT                   /translation="MKPGYLLGALLLSPILAFANSDNNTDGLIFSPLPQNKNTVVRHYS
FT                   NEQEMPNLSQMAQRTIDFPTQIVRVSGNLTGLELSCDDVENEIDQVFSKKISPNLFTYN
FT                   TYVSCGYDVNDPEQHAINFSIQSYFDPLTDNAVDYLKSYLKEYNGYNLFNTTTLQIENA
FT                   KGIIVSMNLNAGLKSNPDKTPFTLYRQDRNNFYFKSNFDVRKELISDIYQRFYSNDPDM
FT                   ILPFFDKWIFSYAGSVYYSILMASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKR
FT                   NPNKHCL"
FT   gene            complement(220962..221183)
FT                   /locus_tag="lpg0190"
FT   CDS_pept        complement(220962..221183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0190"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26297"
FT                   /db_xref="GOA:Q5ZZ21"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ21"
FT                   /protein_id="AAU26297.1"
FT                   /translation="MNIKLILTQAIVFFYKLLHSFASWYCPSIQNHILLNSYLWLFKVK
FT                   KFAIPCRSHALIASVLFMLVIGSNLQTR"
FT   gene            221236..222189
FT                   /locus_tag="lpg0191"
FT   CDS_pept        221236..222189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26298"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ20"
FT                   /protein_id="AAU26298.1"
FT                   /translation="MISQKEALALLNKYEKHLNELQNIITTSYQNLLRCDAQIIPNALA
FT                   ALKAIANNTQFVPVVATSGMSSIKALNSDPQIALKELLVNDFFKDHFQKMCIHYAKDKP
FT                   ELLTNLQNFHACVSQEKIIIYKAKNGELALKFPTQEWRDRFIQKMGGISHFASSDKFNA
FT                   NKECPQTYPENPTTLYLSTYTAKNGELAVVFPNKEIRQNFLTLFRHASSATWSIYEGQD
FT                   AVYFNDKNLHTPGYNFGINAPACVSQSSNAAHADVRYAARILGQALRNPNNTCFFNRLP
FT                   EELINKIISLSTDNEVLAAEDAISLVQPNLGKPQLK"
FT   gene            complement(222394..222978)
FT                   /locus_tag="lpg0192"
FT   CDS_pept        complement(222394..222978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0192"
FT                   /product="heat shock hsp20"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0192"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26299"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ19"
FT                   /protein_id="AAU26299.1"
FT                   /translation="MRRFLMKNKLLPNLIIITLAATIYANSINVQAKQNDQIQNSNEQL
FT                   TQDPFDTDPFFQSHDDVLLQIHKMQQAMDQFIKSQFSQMQNTLANDPHHNPFGSAKNIQ
FT                   ITENKDEIIYKIKLPQGSDSKVDITVKNGQLVLSANVTQKITREQDNNKSVSFSQSNYM
FT                   QSFPLPQSYDPKSMVTKMKDSNLIVTFKKNS"
FT   gene            complement(223101..223295)
FT                   /locus_tag="lpg0193"
FT   CDS_pept        complement(223101..223295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0193"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ18"
FT                   /protein_id="AAU26300.1"
FT                   /translation="MPSLELRVIRLYSISNIRHFVLEKIWFNPIFCMRLSCSPIRDNRF
FT                   KIDLLPKLINWFQAKALTF"
FT   gene            complement(223447..225696)
FT                   /locus_tag="lpg0194"
FT   CDS_pept        complement(223447..225696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0194"
FT                   /product="catalase/(hydro)peroxidase KatG"
FT                   /function="Amino Acid Metabolism, Energy Metabolism"
FT                   /EC_number="1.11.1.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0194"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26301"
FT                   /db_xref="GOA:Q5ZZ17"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ17"
FT                   /protein_id="AAU26301.1"
FT                   /translation="MFKRTIPLFAAFTLAISPSIFPNYAHAQEDKPKTNQYWWPKMLDL
FT                   SPLRQPNATSNPMGEKFNYAEEFNSLDLNAVIEDLKKLMTTSQDWWPADYGNYGPLFIR
FT                   MSWHAAGTYRIYDGRGGANGGFQRFAPQNSWPDNANLDKARRLLWPIKQKYGRKISWAD
FT                   LLVLAGNVAMESMGFKTIGFAGGREDAWEAININWGPEGKWLESKRQDKDGKLEKPLAA
FT                   TVMGLIYVNPEGPNGVPDPLAAAEKIRETFGRMAMNDEETVALIAGGHAFGKTHGAASG
FT                   KYLGPAPEAAGIEEQGFGWKNSYGSGKGKDTITSGLEGAWTVTPTHWSHNYLQNLFNFN
FT                   WVKTKSPGGAIQWVPENSNASSMVPDAFDPSKRHAPVMLTTDLALKFDPVYSKIAKRFL
FT                   DNPKEFDDAFARAWFKLIHRDMGPRSRYLGSLVPKEAMIWQDPVPPVDYKLVDANDIAN
FT                   LKGKILNSGLTTSELVKTAWASASTFRGTDMRGGANGARIRLAPQKDWPANDPQELAKV
FT                   LKTLESIQNNFNNAQADGKKISLADLIVLGGNAAIEQAAKQAGYDIIVPFTPGRTDATQ
FT                   GMTDVKSFEVLEPKADGFRNYFDKSNNMSPPEMLVEKASLLKLSVPEMTVLVGGMRVLN
FT                   ANTGQNQYGVFTDKPGTLNNDFFINLLSMSTEWKKSSETEGIYEGYERKTGKLKWKATS
FT                   VDLIFGANSELRAVAEAYATDDAKEKFIQDFINAWVKVMTADRFDIKAANANINS"
FT   gene            complement(225828..226832)
FT                   /locus_tag="lpg0195"
FT   CDS_pept        complement(225828..226832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0195"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26302"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ16"
FT                   /protein_id="AAU26302.1"
FT                   /translation="MENDMPKTKYALPPVVLFESHADRSTSDFLIKQLPDLKKAGYTTI
FT                   CVDGMEPCASLEENISMMKILIQIQVKKLSELPLEHPEYAQGVEKLRSVVAKLDLFEAM
FT                   KEQGFKLGGIDLPVSEQLKEKSLNSIRREQTITDNTLKHVKENDGGVVVVLGFGHCIFQ
FT                   QMIKEQDENANQYLWYHVHNPDNETQAYKELVESYTKKGLSTYFPLGVNIFKSSDKELD
FT                   TDFWNKVSANCYNYDPKALETSTASILKSLVGPEVTAHLRTDGQHHVDALISLETVEKT
FT                   HQIKSSDFLRSLSKTLGNIHFEVAKIKTKDQVIIRGINEPEVAEQISKLSKKM"
FT   gene            complement(227034..228308)
FT                   /locus_tag="lpg0196"
FT   CDS_pept        complement(227034..228308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26303"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ15"
FT                   /protein_id="AAU26303.1"
FT                   /translation="MLLGDFIMSLEIYTWKNGSKGLGFTKPVKSMLLGGNVGHAAVELT
FT                   FPADAKGDELAKKYQDVPGLSISKRTEIVPEKQENGSYKPKEQVVYFVYFSWWPGHTNG
FT                   HHINSHREDLESEWRHEPAPKIKPEIQEHLYGENIPTANKTNVTGLLISDKTITKVKEI
FT                   SHQSIKETTTIENDPAYQQLKAEEAALQTELQQLIDKRKIYEQELARSGLEQRQPNKEL
FT                   CLTDAEIARGYEISKELKRVAEQIKLCQIDFEERYLSVGEPPSSVIRIPTTLDHNAPTF
FT                   ALDAAGILDKMASLAQSTTAYSFYKFNCSTSATQVVKAGISDELKNIMKTDGFNVEKAS
FT                   QTTIATPTSFRHFSQQVQTELILLNTNQALVEQQRAKTENTSEAPTTSTQSFKQKFQDT
FT                   VKEKSEKAVREQDESEENRIGLTIS"
FT   gene            228667..228984
FT                   /locus_tag="lpg0197"
FT   CDS_pept        228667..228984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0197"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26304"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZZ14"
FT                   /protein_id="AAU26304.1"
FT                   /translation="MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSEMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
FT   gene            229092..230123
FT                   /locus_tag="lpg0198"
FT   CDS_pept        229092..230123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0198"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0198"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26305"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ13"
FT                   /protein_id="AAU26305.1"
FT                   /translation="MNIVRIFLSFLFLFFNCLGFAQSRVPQLFLFLGGDKASSFQNTLQ
FT                   NPCIQGVQIIYSWRQLEPQKGVYDFSKIEEDWNFLSRIDKKLFIQIQDRSFSPDVFHVP
FT                   DYIRLEKAYHGGVVQQYDFPGEGKPMTTGWVARTWDPAVRKRFQLLLKKLASKFDGKIY
FT                   GINLSETSIDLDPDNLPEDFSSDKYFYSVLDNIGYLKKAFQKSRVIQYVNFFPDEWNND
FT                   HHYMSRLFAFARKHHIGLGGPDVVPYKKSQMKNSYPFFHKFKGKIETAIAIQEPDYTYT
FT                   NPKTGDFYRFDDFYSFSQEYLGAFILFWNTEEPFFSEQLLPRLNRTYFNCKKGNNESQA
FT                   ATA"
FT   gene            230239..231609
FT                   /gene="cydA"
FT                   /locus_tag="lpg0199"
FT   CDS_pept        230239..231609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="lpg0199"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /function="Energy Metabolism"
FT                   /EC_number="1.10.3.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26306"
FT                   /db_xref="GOA:Q5ZZ12"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ12"
FT                   /protein_id="AAU26306.1"
FT                   /translation="MLVELLSRIQFGFSIGFHILFPTLNLGLAVFLVIMEAMWLKTKNP
FT                   AYLEICKFWTKIFALTFGMGVVSGIVLAYQIGTNFGPFITQFGNVLGALFAYETLTAFF
FT                   LEAGFLGVMLFGWKRVPPALHFIATLLVTIGTTVSAFWIMSANSWMQAPSGYQLIEGKY
FT                   VVDSWWAVVFNPTFIPRFIHMLLASYVTTCFVIMAVSGFYFLRKQSTAIAKKSLSFSLW
FT                   ASLILVPLQIGVGDVVGINVHHYQPLKTAAMEGIWETQKGAPLLLFAIPSQTQQKNFYE
FT                   VGIPKLASLINTHEWNGEMIGLSSVGNEEQPRMAPVFFSFRIMVGIGLIMLFTAIAGFI
FT                   LRLRGTLFENSWFHRWCIVMAPLGFIASIAGWLTAELGRQPWVVHGLLKTRDSVSAIGV
FT                   EEVIISFVLLIVAYGVVFGFYLYYLLRLISHGPGILEEDEAEHHAFQYMTDFPKEKK"
FT   gene            231609..232598
FT                   /gene="qxtB"
FT                   /locus_tag="lpg0200"
FT   CDS_pept        231609..232598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qxtB"
FT                   /locus_tag="lpg0200"
FT                   /product="cytochrome D ubiquinol oxidase subunit II,
FT                   cyanide insensitive"
FT                   /function="Energy Metabolism"
FT                   /EC_number="1.10.3.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26307"
FT                   /db_xref="GOA:Q5ZZ11"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ11"
FT                   /protein_id="AAU26307.1"
FT                   /translation="MLPFIFATLLGFIVLMYVILDGFDLGIGILFPFTSSESERDKMMN
FT                   SIAPVWDGNETWLVFGGAMLYGAFPQVYGLLLPILYMPIMLMLIALIFRGVSFEFRFKA
FT                   KRSKTLWNWSFSISSVAATFLQGVILGAFVQGFSINESSMTINDPDWLTPFSLCTGIAL
FT                   VCGYALLGSTWMIIKSTGRLQRKMVHYARGLLVLVSFFLLFVSIWTPLHSEEVFHRWYS
FT                   FPNVLLLSPLPLIALMAIYLVWQNLNSGSEYKPFIYSIIIFLCSYIGIAISVYPYLIPH
FT                   QVTLWEAAAPDSTLVFILIGVAIMLPILLAYTLYAYYLFRGKSSENYH"
FT   gene            complement(232599..233384)
FT                   /locus_tag="lpg0201"
FT   CDS_pept        complement(232599..233384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0201"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26308"
FT                   /db_xref="GOA:Q5ZZ10"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ10"
FT                   /protein_id="AAU26308.1"
FT                   /translation="MNKMIILLVIAIIFLHMCLIWLWYRYTNNPSVVDVGWASGLTLAG
FT                   LIYLNNQEFSLRSLLLVLALLTWGIRLGGYLWWTRIRLKKIDKRYLALSNDWKLAKPLG
FT                   FFLNFQLQGVLICLVSIPWYFSSSETQTALNLLDGLALIIFLTALILETVADNQLQDFK
FT                   KNYPGKVCNQKLWRYCRHPNYFYEWLVWCSFTLFALSAPYGWIAIISPLTLYLIMTKIT
FT                   APMTEQGSIESRGNLYIEYQKVTPMFFPKWLKNNSTPRK"
FT   gene            complement(233381..233917)
FT                   /locus_tag="lpg0202"
FT   CDS_pept        complement(233381..233917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0202"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0202"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26309"
FT                   /db_xref="GOA:Q5ZZ09"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ09"
FT                   /protein_id="AAU26309.1"
FT                   /translation="MIINPVHIVHYLSYYLCWIFCIYLASYGYPLLGLIITVLIMGLQI
FT                   IVQILNQLPWRGALYFSMGLALLGAITDAIWLYSGMIYFKANFFGSHFPPLWMVALWLS
FT                   FGFNLVVLYGSWLTYYFLWGLVMFPSIIFAYWLGVQFGAATLIGSEVVFYLTLGLTWSL
FT                   FLPLSLYLFNYRHRK"
FT   gene            complement(233907..235694)
FT                   /gene="yfhG"
FT                   /locus_tag="lpg0203"
FT   CDS_pept        complement(233907..235694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="lpg0203"
FT                   /product="fusion of two types of conserved hypothetical
FT                   protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26310"
FT                   /db_xref="GOA:Q5ZZ08"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ08"
FT                   /protein_id="AAU26310.1"
FT                   /translation="MPLDKLIGITFHAAIIAGCHRLIRHKQILNAINVFPVADGDTGDN
FT                   LSSTCMAIIYFSSVKADLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIAAVVTNPVQGTMITLIQKWATVCEIKQPDSLLAQAMLELLPLLF
FT                   MEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKSKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TSLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNLIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYDAFLTATKKYANITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTITKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPIVSIDSAGQGIMVGKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNLALHLAEMTTQAFNKPPTYIESVSLAIGL
FT                   HAGQGCIAIAGRLRECNDY"
FT   gene            235777..236475
FT                   /locus_tag="lpg0204"
FT   CDS_pept        235777..236475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0204"
FT                   /product="2-deoxy-D-gluconate-3-dehydrogenase"
FT                   /function="Carbohydrate Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0204"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26311"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ07"
FT                   /protein_id="AAU26311.1"
FT                   /translation="MARYLVIAASSAIGQSVTTLLKNRGDTVFTTARDNHKISPDFQLD
FT                   ATHFDAVLDVFRQTGPLDGVVNCAGSLLLKNAHSTSFDEFQVVINASLTTSFATIRAAG
FT                   LTMNQGGSVVLISSAAALVGLANHEAIAAAKAGIIGLAQSAAATYASNNLRVNVVAPGM
FT                   VNSPLTSSLLSNQLVLNASKGMHALGRIGVPEDIAHAIVFLLNPDNSWITGQVIAVDGG
FT                   LSRVRPKMKI"
FT   gene            236492..238030
FT                   /locus_tag="lpg0205"
FT   CDS_pept        236492..238030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0205"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26312"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ06"
FT                   /protein_id="AAU26312.1"
FT                   /translation="MTTLCFILGDQLNETIASLAAINKQKDIVFLCEVAEETSYVPHHP
FT                   KKIAFLFSSMRHFAQQLKKKGYRVRYTTFDDPRNQGSFAKELLRAIEEEQVSAISLTEP
FT                   GEWRVLKIFHGLKSQLTIPVTLHEDNRFLCKINEFRNWAKEKKQLRMEFFYRMMRQKYH
FT                   LLVDNNGKPVGGTWNYDAQNRKNANHISSFPKRLEHTRDVITDEVLGLVSARFAKHFGQ
FT                   CYPFNLAVTREQALEEANYFMEHFLCNFGAYQDAMLKDEISLYHSKLSVYLNAGLLLPL
FT                   ELCQMAEQAYFSKQMPLNSVEGFIRQILGWREYVRGIYWLFMPDYGEMNYFNACRPLPS
FT                   FFWGEETGMFCIKEVVRQTSTEAYSHHIQRLMITGNFALLAGLDPKQVCEWYLAVYADA
FT                   YEWVELPNTLGMALYADGGLMASKPYAASGKYIHRMSNFCQSCYYNPNDLLGEKACPFN
FT                   ALYWNFLHQNQEKLKDNPRLRYAYMNWQKMDFDKQKKTIHKAQRILADLDSANL"
FT   gene            complement(238035..238448)
FT                   /locus_tag="lpg0206"
FT   CDS_pept        complement(238035..238448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0206"
FT                   /product="membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0206"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26313"
FT                   /db_xref="GOA:Q5ZZ05"
FT                   /db_xref="InterPro:IPR018687"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ05"
FT                   /protein_id="AAU26313.1"
FT                   /translation="MNGWTLKVFAIAFFIFIVTDMIWLGFIARNLYFDQYQQWLRLSEG
FT                   QLKPIWWSALLVYLLFALSIIVFVIPLAKTSLPYAALYGALLGAIIYGIYDFTCLAIFK
FT                   DFPVGMAFLDWLWGIVLCSWCSVATIYVASYIK"
FT   gene            238464..238634
FT                   /locus_tag="lpg0207"
FT   CDS_pept        238464..238634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26314"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ04"
FT                   /protein_id="AAU26314.1"
FT                   /translation="MIFILLVLYFTFNRIQVIELHFQNLSFNKKLILWLIEINASYYKR
FT                   ISVITILEYGV"
FT   gene            238638..241697
FT                   /gene="pkn5"
FT                   /locus_tag="lpg0208"
FT   CDS_pept        238638..241697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn5"
FT                   /locus_tag="lpg0208"
FT                   /product="serine/threonine-protein kinase"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0208"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26315"
FT                   /db_xref="GOA:Q5ZZ03"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ03"
FT                   /protein_id="AAU26315.1"
FT                   /translation="MCNHSLNEPHLGSSYLACESMFGSYYFALYFALNFFLMIVFYNAK
FT                   VIFIQVCKYVRFLMKLLRFHELKSLPSMDEKALELLIKVLGNKGIRKLIKSADGKPISR
FT                   EIMIHEFGIDCQILFITTEASLKPIIVPTENKISGGGKSYCEQFKVYALDDGKTYFLKS
FT                   VKINAESLTEFTNETDTLSKLGRLVGTFFNEQTQVHYILTTFIKGIDLSRYKNALPLNI
FT                   NLKHFWEVLGIMISVCHQVKQFHELGLIHRDLKPGNIMLDADMQCHLVDFGSSSSDKEP
FT                   KPVSWGTASYLAPELNAQEDFIAFSQASDLFALAYSLDELFNPFRQVKFAKVDIGIKNK
FT                   HLVLLHAEIEACITGLMSNETSVRTLYFSRILQLQRVPESFKSRPEAFTYMIMLLTQWK
FT                   SCYEAPEMNKELDEIIAEIKVAYENHEQDVVKIITLLEQLSKADGLLNSHKALLSVLIK
FT                   SLANVQQQELGQDDILPRRFESDVVSRLIKTPTAKMMAAIKQVSDAIVKILEQYEHSPA
FT                   ESFEHAVLQDFLEQMVQSDILFGAPKEKIEISDIIKILKANRPEDFVQIQHISFKFAQV
FT                   ALRDLALHDLPKHEPKGAFLEILKKYQAKYAPEETSLFELYHHMAGVRDHNPSKVKKGE
FT                   GYRFRAFICDELFYGDEIFTTGDNRGREGKPNQRLQTNQVGLMKFEHSAHTKGLLTLNG
FT                   QSWYADCKTQLPNYDSIHYLSALKTDCPYITGPSGMTSLFMNMMFLLLNPKDQDVILSY
FT                   SLGVMTYVVGAGYHSIKEILIPMVKCVGIVPDYPQHKGTECLTAPPLYNHYFKAIEEFD
FT                   KEFAEVHEKIWQEYLAYFRMTYMPVCMRSHCLPHQVPSMEDISSEVKEMLEIVSKSVKN
FT                   CLEEHKVKRTGDMGLFLSTPCGQTKALEVLSHVCQQQVGLTAIFRQIQAYFKGTFETEE
FT                   GIIINREMQLKFIAHFFDVLKESPTLLSQFNLTLRIENTIGVHQCELGSSKQKELFLEI
FT                   KKTSIAANEEQMVANHEPRKENRNVIILPY"
FT   gene            241716..243683
FT                   /locus_tag="lpg0209"
FT   CDS_pept        241716..243683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0209"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26316"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ02"
FT                   /protein_id="AAU26316.1"
FT                   /translation="MLSKEKINPFLKNTKRQGSDNLAAMADPTSLKNTGDYRCFNSKPE
FT                   AYTYFIFLLNQWQTNYIDDKREAIAKAIDSIKMAYENHEQDTLVVHKMLHGLSHLLEQE
FT                   HADELNALCLVPIKDSQSNENNILPRRFESELACRLIESPTKSMMQAIDLVSQAIINLI
FT                   EEYSKLDSKSSERTALNFFLQELEGSDIEFGAFKKRPSLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARSVIGPFPLRNLPPFKPTGLFAQVLDKYLQAHSDLTEEEEGFSYQLMAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKTYLKTNQLGLMKLDHSAHSVGLTVIPEQ
FT                   IWCADAQAQEANQNSIYYKTALTNDCPYVTGPSGMTSIYMNMMLLLLNPQNIELIQAYS
FT                   LGIMAYIVGAGFHSVNEILIPLVKCINLLPNYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDQVWAYYLNYFKSCYMPLCMRDFCEAEQLANCPDPAPEVKILCGIVLKSIKDC
FT                   INFHNLNRHLDSRFLGTTTADIDALNQLKEACASQSSISGIMRLLQKYFSGENIARSTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLVISTKAEIFSDDFRIECFNLHR
FT                   ILKREYQVKEDCKNTSQLKL"
FT   gene            243721..244344
FT                   /locus_tag="lpg0210"
FT   CDS_pept        243721..244344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ01"
FT                   /protein_id="AAU26317.1"
FT                   /translation="MKNIYPGRVICDMKNAAIIKNRIFLNLDKPVKRFLASDKADTPMT
FT                   AEFYAEKDYEQLFLDFLSQATGSYDEQISLLIAELDSGADRVAQKLMLALYSPWQKNLL
FT                   PKAIKTIANKSEEYPLMSDLLIKFCQQHVGSVDAVDDFGETALAKILKKDQQRKSPLLF
FT                   LVKHGAKHCQLTSALQDSLIVNNSDIYNVAEDNTMDWISNCPQP"
FT   gene            complement(244591..244992)
FT                   /gene="tspO"
FT                   /locus_tag="lpg0211"
FT   CDS_pept        complement(244591..244992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="lpg0211"
FT                   /product="tryptophan rich sensory protein TspO"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0211"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26318"
FT                   /db_xref="GOA:Q5ZZ00"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZZ00"
FT                   /protein_id="AAU26318.1"
FT                   /translation="MLTQANIPSWYEGLNKSGLTPPGPVFSIVWSILYALLAIVGWVLW
FT                   CSRNESEMRSVFYLYSVQMLMNWAWTPLFFVLHWTGLSFLWILVMAGLTGLLMFSQTNK
FT                   KKSLAILLLPYLIWLLFAAYLNGVIWLLN"
FT   gene            complement(245097..246512)
FT                   /gene="phrB"
FT                   /locus_tag="lpg0212"
FT   CDS_pept        complement(245097..246512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="lpg0212"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="4.1.99.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0212"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26319"
FT                   /db_xref="GOA:Q5ZYZ9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ9"
FT                   /protein_id="AAU26319.1"
FT                   /translation="MTIALVWFRQDLRLTDNPAFIEACSHHEIVIPLYIYDDKCSVLGQ
FT                   AQAWWLHYSLIALGKSLNQQGLSLVLRKGSPQEIILELVAQYGVESVYWNRCYEPQVIA
FT                   RDKKIKLALVEREIKVQSFNGNLLHEPWTIKNKNGDFFKVFTPYWKQCRQILNIPSPFI
FT                   LTKRPRGIEIASDDIGKWKLLPAINWAARFSEYWIPGEEGAQKKLDEFIVHHLSGYKRD
FT                   RDFPAKNATSRLSPHLHFGEISPWVILRALELAKLEHTCDLASVEHFLSELGWREFSVY
FT                   LLYHFPKLDCENFRKEFDAFPWQNDEQLLTCWQKGMTGYPIIDAGMRELWATGYMHNRV
FT                   RMIVASFLTKDLLIDWRSGAQWFLDTLVDADLANNSASWQWVAGCGADAAPYFRIFNPI
FT                   LQSQKFDPDGVYIRQWIPELAQLNSQSIHQPWTDADASSIFLGKKYPKPIIDHQEARTK
FT                   ALSYYQQIKKGMD"
FT   gene            complement(246607..247314)
FT                   /locus_tag="lpg0213"
FT   CDS_pept        complement(246607..247314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0213"
FT                   /product="inner membrane protein, LrgB family protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0213"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26320"
FT                   /db_xref="GOA:Q5ZYZ8"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ8"
FT                   /protein_id="AAU26320.1"
FT                   /translation="MPSSILSESMIQAFFWSLITIGMYFITQKLYRRWPFWWLMPLALT
FT                   PILVASVVLLLHVNYQDYFRGTKWLVLLIGPATVAFAIPIYEKRALIRQHWPVLLIGVI
FT                   VGSFTAIASSWGLAILLGLDDNLRLSLLPRSISTPFAIEISRGIGAAPDLTAIFVIVTG
FT                   ILGAILGEFILSRLPFNSALARGALLGVGAHAAGTAQAHKIGNTEGAIASLAMILVGLF
FT                   NILLLPLISYLLK"
FT   gene            complement(247292..247900)
FT                   /locus_tag="lpg0214"
FT   CDS_pept        complement(247292..247900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0214"
FT                   /product="murein hydrolase exporter, LrgA family protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26321"
FT                   /db_xref="GOA:Q5ZYZ7"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ7"
FT                   /protein_id="AAU26321.1"
FT                   /translation="MFYGFTDCRLGRKEIFSRFGKTTLPYNLYESLKQFKFHNYSILER
FT                   LLVYKFILFILIKSVNLNEKIISTMSTYMANKIQQNSFFQIVLVGLFWLASELLLKLVK
FT                   LPLSGGILGLGIVLLLLATNCLKLNRIRRGAELLLANMLLFFIPGVLAILEHREFIGLL
FT                   GLKILFIILLSTITVMLVTALVVDYCYRWRTHHAKQHSL"
FT   gene            247787..248671
FT                   /locus_tag="lpg0215"
FT   CDS_pept        247787..248671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0215"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26322"
FT                   /db_xref="GOA:Q5ZYZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ6"
FT                   /protein_id="AAU26322.1"
FT                   /translation="MEFKLLQTFIEVVRQGSFSKAAENLFTTQSTVSKAIKQLEEELGI
FT                   TLIERFKKRNVPTTAGEIVYQRGTKLLADRDDLLKELDEIRGLKQGRLRLGISPVGSST
FT                   LFAPLFVLYRQRYPGIEVELVEHGSDKLAECLRAGEIDFAGTLLPISEEFDCQLVRSEP
FT                   LVALLASGHPLATKHCISLPELKEIPFILFGSGFALHRIILDACRHAGFEPKVVAQSSQ
FT                   IDFMLELVAAGLGVTFLPRMIATQRHTTQIRSLLLNGSEFQWNMAMTWRRNSYLSEAAQ
FT                   AWLALVREVHVDN"
FT   gene            248791..249003
FT                   /locus_tag="lpg0216"
FT   CDS_pept        248791..249003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0216"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0216"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26323"
FT                   /db_xref="GOA:Q5ZYZ5"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYZ5"
FT                   /protein_id="AAU26323.1"
FT                   /translation="MNNQQKIKCPICDKQNTWRPDNLFRPFCSERCKLIDLGEWASESR
FT                   KIPGSSIDPESIVTTNNKQDNVDEQ"
FT   gene            complement(249089..250168)
FT                   /gene="purK"
FT                   /locus_tag="lpg0217"
FT   CDS_pept        complement(249089..250168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="lpg0217"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /function="Nucleotide Metabolism"
FT                   /EC_number="4.1.1.21"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26324"
FT                   /db_xref="GOA:Q5ZYZ4"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ4"
FT                   /protein_id="AAU26324.1"
FT                   /translation="MKLGILGGGQLARMLALAAYPLGINTVCLDPSPDACAGQLTRLIV
FT                   SDFNDELALKQFLSEVDCVTIETENIPFSCAELIAQIKPFYPSTQALKITQDRLYEKNF
FT                   FRSLNIPTPEFLPVESEGELMQAITDIGMPAVLKTRRFGYDGKGQFVLRAQSDISKSWG
FT                   LLGSQPLILEELISFESEFSLIAVRNKSGETSFYPLIKNHHRKGILHFSEAPVHQDTLQ
FT                   QEAQTHAFKILEALNYVGVLTIEFFYQGNQLIANEIAPRVHNSGHWTIEGAHTSQFENH
FT                   LRALFDLPLGSTEVSGSCFLLNCIGNLLPLEPCLSIPGVHYHAYGKAPRPDRKVGHVTL
FT                   IDTHLERYAKSKDLLLDIS"
FT   gene            complement(250165..250665)
FT                   /gene="purE"
FT                   /locus_tag="lpg0218"
FT   CDS_pept        complement(250165..250665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="lpg0218"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit PurE"
FT                   /function="Nucleotide Metabolism"
FT                   /EC_number="4.1.1.21"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26325"
FT                   /db_xref="GOA:Q5ZYZ3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="PDB:6O55"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ3"
FT                   /protein_id="AAU26325.1"
FT                   /translation="MKPILIGLIMGSQSDWQTLIHAAHTLDALNIGYEAEIVSAHRTPD
FT                   KLFRYAEQAEARGLEVIIAGAGGAAHLPGMVAAKTSLPVLGVPVMSQTLNGVDSLLSIV
FT                   QMPAGIPVGTLSIGKAGAINSALFAAAILANKYPDIRAALKHYREQQTQKVLDNPNPKE
FT                   EKS"
FT   gene            complement(250725..251579)
FT                   /locus_tag="lpg0219"
FT   CDS_pept        complement(250725..251579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0219"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0219"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26326"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ2"
FT                   /protein_id="AAU26326.1"
FT                   /translation="MEVTPMHYQNQRVLLASKHQKEKAIQPPFEEKLGCFIHVPADYDT
FT                   DQFGTFTGEIPRKASAYETLILKAKAAAKQFGYRYVISSEGSFGPHPQLYFCPADTELM
FT                   AFVDLDNDLIIAEHEVSTETNYSHIDISATDDYEAFLNKAKFPSHGIIVRALNSEENYI
FT                   QKGICEPEQLKTTIQKAFTYSTTIRLETDMRAMMNPLRMNVINKLAVKLVHRIQQHCPQ
FT                   CHTPGFGKISAEGHLACISCGTPTELYLRKVLNCLKCEFKTYQARDDGLEFAEQRYCPY
FT                   CNP"
FT   gene            complement(251589..251942)
FT                   /locus_tag="lpg0220"
FT   CDS_pept        complement(251589..251942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0220"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0220"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26327"
FT                   /db_xref="GOA:Q5ZYZ1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYZ1"
FT                   /protein_id="AAU26327.1"
FT                   /translation="MNIIKVSEKKEMNISLHPMKKIEVIVSGDNENMVATMMEKANISG
FT                   FTLLRNVSGKGHHGFHEGKILFNDKASFVMFIAVAPEEAIAKIALGMKTLFQKNSGVLF
FT                   VSDVSVARVDYFS"
FT   gene            complement(251956..254244)
FT                   /locus_tag="lpg0221"
FT   CDS_pept        complement(251956..254244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0221"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0221"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26328"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYZ0"
FT                   /protein_id="AAU26328.1"
FT                   /translation="MSSHITLIKTNTSNENQMTQCNYPVDNDVMIIQAMVNNVTKQITP
FT                   VWPLEKFIACNSLHGFESMSFEEAVIQNQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTIEMPHRDKGLYFGFLKLAPFDSTLHQNNKSTKNWLSNLPEMPEQAIRLCLDKLGVL
FT                   NQRQEEFLQSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLVDFLAVRLIITCILWPEA
FT                   NLEEKKKEKDSADTKQLIQNIKHKEDDYRQLLLKKLLPELNKVQIKGNRAKAQMVFCID
FT                   VRSEPFRRCIEKLGHYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCLEHHEKGKEFKKILNRVYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RLTQDLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKITVRRALAENGINIPQDTVF
FT                   CGAQHDTTTDEVEIYHSNVSQFIDQDILDQLRADLNMAKHNNNLERINYLNSIDCAEKD
FT                   IVRRSADWSETRPEWGLARNAAFIVAPRQLTKNIDLEGRCFLHSYDWSKDEDGTLLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SHDEKSFHEPQRLLTVVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYKLE
FT                   KTNTWSVIK"
FT   gene            complement(254259..255779)
FT                   /locus_tag="lpg0222"
FT   CDS_pept        complement(254259..255779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0222"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /function="Metabolism of Cofactors and Vitamins, Energy
FT                   Metabolism"
FT                   /EC_number="1.6.5.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0222"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26329"
FT                   /db_xref="GOA:Q5ZYY9"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY9"
FT                   /protein_id="AAU26329.1"
FT                   /translation="MDKFLNGLSISLMLSPLIAMLFYILLGKTRNIQATYYGTTVIGFG
FT                   FGLSLLALIVSANTVNQNSYFLFHASTLSLLLSTLILFISFIIHRFSLRYMHGDKCYRR
FT                   YFFKLSAITLTTVVMALADNLLLFWLAWSASNLLLINLMIHKSQWKAAYNSGILTLKTL
FT                   LPGSLLLITAFWILFTLNNTLSIETITSEVSNKSSLAIAVALGFIILAAMAQSAIWPFH
FT                   RWLMSSLNSPTPVSALMHAGLVNGGGFLIVKFAPLFVTQENLLTILFIFGALTALLGTL
FT                   WKLLQWNIKSMLASSTMAQMGFMMMQCGLGLFPAAIAHLCWHGLFKSYLFLNSGSAVQQ
FT                   KKYQNKSRPEKLTNLLTAFFGGLSGMYGFALITGKPILSLHASTFLLGFAFITGTQLTL
FT                   GLIAYEKHFKKVILALALVFSIGIFYGGSIHLIESLLPNLTGFPQYQLSSLQVLTLIIF
FT                   FSLWLLFSMGLFKKIRETRLWDWFYMYMFNASTPHPKTITANRHTYYY"
FT   gene            255881..256732
FT                   /locus_tag="lpg0223"
FT   CDS_pept        255881..256732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0223"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0223"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26330"
FT                   /db_xref="GOA:Q5ZYY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY8"
FT                   /protein_id="AAU26330.1"
FT                   /translation="MSIDTITLQCFLAVAETQSFTKAAQRVGRTQSAISQQIAKLENLI
FT                   EKPLINRGRELSLTTDGEIFLGYAKRIYELHRESLDRFKAPELQGEIRFGLPEDFASII
FT                   LSDVLVEFSRLHPRVLLNVECDLTLNLIERFNEGKFDLILIKTTQQQVGSESIYVCTEP
FT                   VEWIGKKELLPLLDKPGPIPLVLSPTPCVYRGNVIDTLDKNHIDWRLVYSSASYAGKMA
FT                   AVRAGLGITAIQRSMIPNYLERLDYDFLPILNDVHVSLLKKSGSNKAIESLEFFILQKL
FT                   KY"
FT   gene            256774..258363
FT                   /locus_tag="lpg0224"
FT   CDS_pept        256774..258363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0224"
FT                   /product="toxin secretion ABC transporter HlyB/MsbA family
FT                   ATP-binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26331"
FT                   /db_xref="GOA:Q5ZYY7"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY7"
FT                   /protein_id="AAU26331.1"
FT                   /translation="MNAKPINSIIDVLDRQTISSIAMISVIISLLSLSIPIAAQTLVNL
FT                   IAFGKLLQPVITLSLMVLILMMALGALHIWQIVIIEVIQQKLMVKVSLSLTRHFTHMSL
FT                   DNFSTHHGPELVNRFFEIVTIKKSLASLLLYGINLGLQLFFGLLLILIYHPLFLLFDIF
FT                   IILGILLIIFIPYKKALDSAKKECSEKHVVGAWLEEILINRYLFRFSLYHRYVTQQTDK
FT                   KLVAFLKARNTHFKQLIKHQIGFYTLSALASSLLLGLGGYLVINNQLSLGQLVAAEIVL
FT                   GALIYSFRRFGALLENYYDLVASENKIDAVLNLSLEQVKEDEHGELLTPINSIQLEMDS
FT                   KNKALIAVDKPLLVFSEKSDLCQLFVEQLFGFQDPASLHVLINEIPCARKNLISLRRFS
FT                   LLIAEPQWFTGSIYDNLVLNHRNVPNKIIIEQLKNVGLADKIIQLPEGLRTILYEWQDV
FT                   FTLVELTKLMLVRALLLQPELIVIDRAFDILNHQEVNEMMELVLSLKNTLLAIVSQRSD
FT                   FNYLNNRLVISS"
FT   gene            258360..259346
FT                   /locus_tag="lpg0225"
FT   CDS_pept        258360..259346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0225"
FT                   /product="RND efflux membrane fusion protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26332"
FT                   /db_xref="GOA:Q5ZYY6"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY6"
FT                   /protein_id="AAU26332.1"
FT                   /translation="MKLHAYSMISKLPKPQKIAKIIFIVFIAIILFLSFTPWQQFALGN
FT                   GKVIAFSPTERQHTVNSPVSGRIKKWYVDEGMRVKPGDPIVDITDNDPELLSRLEVEKK
FT                   AILLRIEAAKQAIAAGKANVDRQKKLYEQGINSRRQYELAQIEYAKYQNDLAQANIDKV
FT                   NVDVRIARQKTQIIKAHVAGIIFRRLTGQESVVVNAGDVLAQILPETESRAVELWVDGN
FT                   DIPFVRLNQKARLQFEGWPAIQFRGWPEIAVGTFGGTVSFIDPTDNGFGLFRVVIVPNE
FT                   PWPSVRFLRQGVRVHGWVQLGQVPLWYELWRQYNGFPPESDRENKAS"
FT   gene            259343..260740
FT                   /locus_tag="lpg0226"
FT   CDS_pept        259343..260740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0226"
FT                   /product="multidrug efflux protein, outer membrane
FT                   component"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0226"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26333"
FT                   /db_xref="GOA:Q5ZYY5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY5"
FT                   /protein_id="AAU26333.1"
FT                   /translation="MSCFPSGKNKLVVLCLLLMLSFKCFPIPGKPLLLDAVLKSVDRSY
FT                   PQIVIARLEIRKAEGDYVNALGKFDPSFDVNPRFQPVGGYINNYADNLFNVPTLYNGLK
FT                   LFGGYRIGRGDWPIYYQNYLTNSGGEYRAGLSLPLLRDRRIDKERTELFTREETIRMKQ
FT                   QDAAATKIKIYQETIKAYWQWVEAGFQLRTFRHLLNLAKERQNAIIQQAQQGDLPRLAI
FT                   AENLQLIVQREQLVNQGEMLLAQAGINLSLYYRDAKGKPQKPDESQLPATFPAQPIRVS
FT                   NSIAQLQRHPVLRKLENYSKIVKLKQNLARNELLPNLDATAYTFKQYGTGGYPLLIPQA
FT                   AMIGVNFKFPIFQREARGKLISTTSELQQVQTEMKFTYEQLNNELSNLLVAIRIYQQQV
FT                   VLLNKELNLARQVEKGETKRFYEGDSTLFLVNQREQTTAQVKLNWINAEINLQEATALA
FT                   RFFSSTQ"
FT   gene            260923..262029
FT                   /locus_tag="lpg0227"
FT   CDS_pept        260923..262029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0227"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26334"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY4"
FT                   /protein_id="AAU26334.1"
FT                   /translation="MSYSIDNPGGGDCGFYALAIGLISIIQNEYKLHGKSKTYDRWKQV
FT                   ENIYGVRLQDILNIDLTKLHYSPYTYKSELLFLLQMSLRNIAVIVNKEDLVKRIIEEGR
FT                   SKDQTKIEGSNAYCKFMELVQLYLYRRGSLERISQFNELALSPEIVQTARDIARMLRPI
FT                   LRNQPFHQAQKIENAFVKEVLLNDVLSGNTINSNSIILKSLEKIKEQGRWATHDDLKEI
FT                   AELLKINLNVVGQPNGKPIPEYPTVTLKNLSNTHWITQVESLQGPRQYSTPSKRAFGYE
FT                   TLSDRAVPLKEEQTLDRAFRTETQSERTRRYNQHFETLFDTLSPYGFFPHVQSKRNVHV
FT                   FGKAQTGLESDEALAAQLQEAELRRILY"
FT   gene            complement(262200..263765)
FT                   /locus_tag="lpg0228"
FT   CDS_pept        complement(262200..263765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0228"
FT                   /product="amino acid permease family protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0228"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26335"
FT                   /db_xref="GOA:Q5ZYY3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY3"
FT                   /protein_id="AAU26335.1"
FT                   /translation="MLKRDISTLNILVASAGGMIGSGWLFSPFISAQMAGSNSLISWVI
FT                   AAIFMLFIALPLCELGTMFPVSGGMSNYPTYTHGREVGFLFAWTSWLSYVVMTPIEIQA
FT                   ILQYSSHFFPILIDNHSESLTLSNYGYLAAVGIMFFVVILNSYGIKFLAECNKYASVIK
FT                   FVLPSIAIISLLKQSPSLANVNINLSSKEHWVEIFTALSAGGVAFAFTGFQNGLILAGE
FT                   VKNPQRNIPIAILGAVLVGFILYFMLQFSFIAAVPQKYLAQGWHALSYPGDEGPLVGLT
FT                   LLLGLGIVATLLLFDAAFSPFGTTLVYTAATSRILYGMALNQHLPKFFLKVNRHNIPYV
FT                   TLYANLLVGSFAFLPFPGWQKLVAFLSSASILSYGIGPICLLAMRKMHPHMNRPFKLAN
FT                   SIFLSHIAFYICNLMLYWCGFSIIWKLNLALLMGLGIYFFYHRYISLRNGSPLVWFIMY
FT                   MGSFSIISYLGSFGGIGLLKFPFDLICFLPYSILILYMSQVLATPRHDNDMIGNVTELP
FT                   VYNS"
FT   gene            complement(263913..264746)
FT                   /locus_tag="lpg0229"
FT   CDS_pept        complement(263913..264746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0229"
FT                   /product="heme oxygenase"
FT                   /EC_number="1.14.99.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26336"
FT                   /db_xref="GOA:Q5ZYY2"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY2"
FT                   /protein_id="AAU26336.1"
FT                   /translation="MFSKALISATYKNGKPGQLTEEHEKAEHHRFKTDYLFKNAEISKD
FT                   LYASRLIQHFLIIKAIETKLQNLSKTEQSEISAFFALSYLEQLWRTTAIENDLRQLNIN
FT                   PDEIHKDEMTKTTENYLENIEKFTPKILLAHFLLHIAGFMHGGNIIRSKYIEPSNRLTT
FT                   YQITADQYDFSAAISFLSSGKHSPLALYQDMMKQIDNIVLTGDEYQELLEQCKGIYETM
FT                   SNIYDDLCDMHTHHLKLPTYSLAAISVSLVALGLILKLLMDFLNPMTNPIANAPR"
FT   gene            complement(264958..267087)
FT                   /gene="pleD"
FT                   /locus_tag="lpg0230"
FT   CDS_pept        complement(264958..267087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="lpg0230"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26337"
FT                   /db_xref="GOA:Q5ZYY1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY1"
FT                   /protein_id="AAU26337.1"
FT                   /translation="MNKTWHQTATGNRSILSNLRLSRTLLNIIFIIALSLLLIINIISY
FT                   NQVKNLIFASNWVSHTHEVIQTIDTCLYDIVEIESRQRFYLIRGSSSQLMADIDDMKST
FT                   LQLNLDKLEQLTRDNPEQNKRIHRFIDLVKQRLNLLNQLVQLKGSGKLDTQEGYDLLNQ
FT                   SQDMSHQVKSLGQEIKSVELVLLSERNTGVVRWAVTSSFILISGGIASILFLTLAFILA
FT                   NIELSTRRKTELQNQNTQIRLKKIIESASDMIAAFGKDQRFITFNEAYQREFKRLFDKS
FT                   ISINMSLEEAFNNAPENKKKLVQSWKESLQRDEETKNIEVNTEQEKTIYEMTSKLIQNG
FT                   DNEIKGVVHSVRNITKRVQEHTELQESYEKLANGMKELQEKNEQITLLVEMSDIMLACG
FT                   SQEELSEVMAKYSQRLLQFSSGYLFIMHPSKNYLEKAASWGNPHPHDLTFTPEQCWAIR
FT                   LGRIHYAGSSRIELMCSHMMFDEQPELSLLCVPLMAQNDIYGLLYLEVGLKFDENQQLL
FT                   ITAFAELTALALANVRLRENLRYQSIRDPLTGLYNRRYLEDFLFKQLHQAERTKASFAI
FT                   LMLDLDHFKKINDTFGHDAGDLVLKELGQILNNDIRLGDIAARYGGEEFVLLLYDINAQ
FT                   AAKMKAENLRSAISNLQVKYGAQPVGQITASIGISVYPDDAKSPAEVIEAADKALYQAK
FT                   NKGRNKVILFSEISP"
FT   gene            complement(267234..269792)
FT                   /locus_tag="lpg0231"
FT   CDS_pept        complement(267234..269792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0231"
FT                   /product="heavy metal transporting P-type ATPase, cation
FT                   transporting"
FT                   /function="Transport and binding"
FT                   /EC_number="3.6.3.4"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26338"
FT                   /db_xref="GOA:Q5ZYY0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYY0"
FT                   /protein_id="AAU26338.1"
FT                   /translation="MLYSNYRFYLAKDAQLLNPEESREAIEQILAKTKELELIRVAVDL
FT                   TSSNKSISLLSASKENHVIKTKVTQILKEQGLSVIDMMEVEVLQDIEKIEHHHPTHKSK
FT                   NTHLHPVKKHQKKAKHDHSHGHGHHHGHHHENHWIKAALGLIWGIGLLVLSIGTFNIPL
FT                   VAYYVITGLTSLMTLYLGHTVYQSAWQALKEKKWDTTTLYSISTLTILAVSIASVFVPG
FT                   LPMMFEAAPLVLGFWHLGEGIEHTLVGKINKKLDVRDCVPPLVLLKGNPDKEISVKTLI
FT                   PNDMIIVKKGQVIPVDGVLTQKALLYTTRIDGSPKLKEFHPGDVVKAGMQLADHIPSLE
FT                   MQVTKTYQNSYLSLIAENINKANDEKAPIEMFADKVLKYFIPGLIAVALLSGIVIGSLF
FT                   NPALAIQCVVSVLVSACPCALSLITPMAVKIGMKKASENGIHFNNGKALQAAADIDTVV
FT                   FDLNGTLTQGKMVVKSLHITDKKYLRPIALLESQSDHPVAKIIKSYMEQQDTASTEPLE
FT                   ITSIDKSHHSGMKGIINGEVFIIGNKDMLAANGITSIDKPYDNPEKGSVYIVRGTTVIG
FT                   QIALIDPLREDAIATVKQLKRLGKSVHICTGADQATAEKYAALLGIPKDNICANTVGAV
FT                   TKKGEVSKTSYIQQLKQKGFKVAMVGDAANDATAIAYSDIGIAVKSSIGDSITEQHAGI
FT                   VVQQGLLFPIATAFDVAQKTKQNIFQNLFVSLSYNSIITLVAAGLFVALGFALNPVLGV
FT                   ALMVLESTIVLTNLYLFKQQDIVSSTSSNANNAVEIEPAANTTSKVLHALGHRSQPQEN
FT                   LAVVTESKPVNPKVINLFAPKEHSSYRPDATQQKLGCGIC"
FT   gene            270036..270569
FT                   /gene="np20"
FT                   /locus_tag="lpg0232"
FT   CDS_pept        270036..270569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="np20"
FT                   /locus_tag="lpg0232"
FT                   /product="transcriptional regulator np20, Fur family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0232"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26339"
FT                   /db_xref="GOA:Q5ZYX9"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX9"
FT                   /protein_id="AAU26339.1"
FT                   /translation="MIGCCLIIFPCNRDYDKIVRTNYSLVRRLMKHNLLDKAYKHCVNH
FT                   GYRFTEPRERVLKILVDERKPLGAYDILQRLSMEVDNPKPPTVYRAIQFWHQEGFIHCI
FT                   DSLKSYVACLHGHHVGQAQFLICNQCDFVKELECVVDFTAVTEAANSIQFSIINCTVEI
FT                   KGLCSDCNLTNLKN"
FT   gene            complement(270686..272278)
FT                   /gene="mdlC"
FT                   /locus_tag="lpg0233"
FT   CDS_pept        complement(270686..272278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlC"
FT                   /locus_tag="lpg0233"
FT                   /product="benzoylformate decarboxylase"
FT                   /function="Biodegradation of Xenobiotics"
FT                   /EC_number="4.1.1.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0233"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26340"
FT                   /db_xref="GOA:Q5ZYX8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX8"
FT                   /protein_id="AAU26340.1"
FT                   /translation="MKKTGSDVLKEFITTFEINYIFGNPGTTELKFLEAIEQCDNATYF
FT                   LTLQESSTVGIAAGYAMITRKPALINLHNYVGLANAVCNMYNAFTSGIPLLIIAGQHAR
FT                   PYLIHSPVMSGDLTSLAHTAVKYAYEVNSASDLAVALQRGYAQAILPGPGPVFLSIPMD
FT                   IWQEETQETTIKKTKFLHACINAEIEQICEVLTNTPKGKLAFIADYEVGASNSIRLLHT
FT                   IADRLNADIYAAPYHVREVINPLSVNYKGRLSDKSGEVHNLLLQYETVVLLGEKVKGYL
FT                   YTGQSSIPQGIRFIQISAASEHLAFDYPCDLAILGNLEATLTAISKHLKINGLNVPLKP
FT                   ATNIKNLEKKYKQHPLHSLIVTLLNQVNRSVHLITEGSSEDAIVQDIATTLGFLNVNFS
FT                   PRGGGLGWAMPLAIGISLATRHHSICFVGDGGSMYAIHSIWSAAKYKIPVIFICFVNRE
FT                   YRVLKTDMSQNRSFTEEDFFRLDLNHPPIDVQQIALSFGAQVKTIKSKEEVETVLKSSF
FT                   AFQGPTFITLYHQ"
FT   gene            complement(272577..277121)
FT                   /gene="sidE"
FT                   /locus_tag="lpg0234"
FT   CDS_pept        complement(272577..277121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidE"
FT                   /locus_tag="lpg0234"
FT                   /product="SidE"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26341"
FT                   /db_xref="InterPro:IPR021014"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX7"
FT                   /protein_id="AAU26341.1"
FT                   /translation="MLIFKSQILILKYLSRSCVMPKYVEGIELTQEGMHAIFERMGHPN
FT                   ITSGTIYNGEPTIDKGALDRQGFMPVLTGVSPRQDSGHWIMLIKGQGNQYFLFDPLGES
FT                   SGKYYQNILAKKLPGATLSVIPNNAGLNMGLCGYWVASVGLRAHAALTQPIPPSLRNLG
FT                   QTITQEMRDELTQDGSEKITQWLRAVGNEFPDGDIQPDATALRRATEKNVRIDEFQPVL
FT                   TGTSPKEISINPTAPQEVSVPTWNGFSLYTDETVRNAARYAYDNYLGKPYTGTVEATPV
FT                   NFGGQMVYRQHHGLAHTLRTMAYAEIIVEEARKAKLRGESLKTFADGRTLADVTPEELR
FT                   KIMIAQAFFVTGRDDEESSKNYEKYHEQSRDAFLKYVEENKSTLIPDVFKDEKDVKFYA
FT                   DVIEDKDHKWADSPAHVLVNQGHMVDLVRVKQPPESYLEYYFSQLQPWIGSTATEAVFA
FT                   TQRQFFHATYEAVAGFDSENKEPHLVVDGLGRYVIGQDGNPIREESDDEDEEESGELKF
FT                   FSQKKKLEENQRYMRVDEYLKLDEVQKRFPGAGKKLDGGLPGLKEYQYLQRLNSINRAR
FT                   CENDVDFCLGQLQTAHHQTKITPIKRAFQSSSEKARRQPNMDEIAAARIVQQIMANPDC
FT                   IHDDHVFLNGQKLEEKFFRDLLAKCDMAIVGSLLNDTDIRNIDTLMQHERNTEFHSTDA
FT                   KAKPVKLGETWEKTIRSGGGVTQIKHDLIFLMQNDAWYHTRVNAIAQNRDKDSTFKEVL
FT                   ITALMTPLTNKSLMDTSRSPAPKTLFRGLDLSEEFKNKLINQAETIIANTTEHLFTDLS
FT                   TEAFKQIKLNDFSQVSARTCASTSTNIEVPRTIFGSNTIFEILDPDGLLHPKQVGTHVS
FT                   GSESEYSIYLPEDVALVPIKVSFDGKTGKGKDRHIFTLVAVKSPDFTPRHESGYAVGPL
FT                   LKMQTPKLEEIQRLVEQAREEPDLERVFNLQSRVARQAKFSTESGYKTFLNEKVAPVLE
FT                   QSLNGLLDNNVTILGKVLSAFPSDGQWSAFNSVEARQMKIQMDAIKQMVEKKAVLEGQI
FT                   LPALAQCQNALEKQNIAGALQALRNIPSEKEMQTMLSISGGLRGQIQRAKQDLTETLEP
FT                   LQRAITAKLVSDQEKVKVRYEKLIAGIPQQIADLEKAELADLAKVKKVVSRFNHLQEEL
FT                   KLLRNEKIRMHTGSEKVDFSDIAQLEAQLQKIHTKLYDAYLVELTKEISALVKEKPKNL
FT                   ADVKRMVSNFYAMSADIEQLRQEKIKEHGESKDPIDMSDIDKLKEELQKINQFLVKAMG
FT                   TNIRVSLNQMEVKTFDAQEKEAQQNLKQLDALINKLESSDAVQKQKEELEKLNQLLVEK
FT                   RKAYPAMVQLQFRSEALIIHLRELCEAHQAQMAKTRNVRAQEITNGRWKVQWLTDWVGL
FT                   TTDERVTLANKEKELAKFKEDLNNDEYDLQELISNLAEKNPSELEEAIGISKESAQKLH
FT                   KLLTHLNHSTTFMSKIEQRLQSIDELLNEFGKQAPRTEMIKTVEEKQGTLLRL"
FT   gene            complement(277484..277987)
FT                   /locus_tag="lpg0235"
FT   CDS_pept        complement(277484..277987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0235"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0235"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26342"
FT                   /db_xref="GOA:Q5ZYX6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX6"
FT                   /protein_id="AAU26342.1"
FT                   /translation="MKKAFRIMATYYGQCACGKIQFMCTGEPVFTQYCHCNKCREIASL
FT                   SQKKQDKSGYSLTAAYLTRDFRILSEDNDFEEIIKEKAKLFLCSYCHSLVYGIALDPAQ
FT                   QDSIGINVNNFSFDTSIPDSFKPVRHIWYASRIMDCDDQLPKFKDAPKEQFGSGELFEL
FT                   PDAN"
FT   gene            complement(278060..280039)
FT                   /locus_tag="lpg0236"
FT   CDS_pept        complement(278060..280039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26343"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX5"
FT                   /protein_id="AAU26343.1"
FT                   /translation="MRYTNIELLKRIPQHLKGVMEYYPDVLLFQLNQIQYTHLWHELSS
FT                   AKYLYTNGFVIKPTHWLMYAFQTVKGWLGFDNHCQPEKISYVLDKLSYYGYTKQFLQPD
FT                   FSSITNYSISPEISALVVKSRDDLTTAQLQNKLVNNYFKVEPHLGIDYSYQKLNPNHRF
FT                   GESWMHAHEWGLIPQLDPQDDSLIAEVISTLDKKGISAKDVFFLQHSKYAKAAAQYYCD
FT                   KAKNTIVPSFFFRLLWTDPRPRYLALALAYDPQIAKRDAQKFIEYHLAQKEYDNAFNLL
FT                   GILNDSNLVLKFLLAIPETERHALIQKDTAIAAIMAKYYIEKKQYLLATQFYTNIEEIS
FT                   PNAAFAIEIQEQNYEKAYDIFKKYNSPNLFSMPERKLLAKIFYSDAETAYVAGKTYRGN
FT                   KNWEKAKQYYLQSLEQKKAAHHLDPADEYLEDLYAHKRLYALLLIDADIDLNKAEDSDI
FT                   ASIQKAITLLRECRSSNKEEQEHHTRALAAGLMRRVDTLREKIAFNYYSSDFESIRKHK
FT                   IEHQQDIAILIKTLEELIALLEGTQDKALRLQLGKAHYLLADVQCFFDINAPDINQHYK
FT                   MAMKAVPGNPFYVLRVAELFEEEKSKLQKIGITQLKNMGYQVFDFLHWSEERWCKRDDI
FT                   IHNIKDIHMPPSEPINSSSWNFTF"
FT   gene            280320..281114
FT                   /gene="mhpC"
FT                   /locus_tag="lpg0237"
FT   CDS_pept        280320..281114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="lpg0237"
FT                   /product="lipolytic enzyme"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0237"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26344"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX4"
FT                   /protein_id="AAU26344.1"
FT                   /translation="MATLKINGVDIYYELYGQGKPLVLIAGYCCDHTFWNAMLHELAEQ
FT                   FQVLIFDNRGIGQTRDNGASFTLEAQADDIMAFLEQLGFSNPSILGQSMGGAIAQLLAR
FT                   KYGKKINKLIILNSVAKFNTRANQAMESLLNLRKENIPFDLLIEAGIPWFFSSEYLAEP
FT                   KNIAAFKENLKNNPYPQSLQDQARQFRTIPPFDSRGWLHEIKVPTLVIAAEDDILTLPA
FT                   ESQQLAQGIPNAQFITIPGGHSSPLEQAMIVNEVILKFLTSS"
FT   gene            281131..282597
FT                   /gene="gbsA"
FT                   /locus_tag="lpg0238"
FT   CDS_pept        281131..282597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbsA"
FT                   /locus_tag="lpg0238"
FT                   /product="glycine betaine aldehyde dehydrogenase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.2.1.8"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26345"
FT                   /db_xref="GOA:Q5ZYX3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX3"
FT                   /protein_id="AAU26345.1"
FT                   /translation="MEIYKMYIDGKFTLAKSGATRDIFDPANGDLIAKVPESAKEDAIL
FT                   AIKAARKAFDEGEWRKSLALDRGKLLFKLADLIRANAKMLAELETRNCGKPLLEAEFDV
FT                   TDAANCFEFYGGLATKIHGETMSVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAP
FT                   ALAAGNTVVLKPSELTPITALELFKLIDECGFPAGVVNLITGPGIGVGEELASNAMVDK
FT                   VAFTGGSATGRKIMQAATGNLKKISLELGGKNPNIVFADSDLEMAIDGALFGAFANQGE
FT                   VCSAGSRLLVERSIHKKIVEGMLKKIPNIKLGHGLDAGVKMGPLVSSAHREKVESYVKL
FT                   GMEEGAKLLCGGKRPTGNEFAKGHFFEPTIFDEVKSTMRIAREEIFGPVLVVIPFDTEE
FT                   EAIRIANDTDYGLSGAVWTKSVTRAHRVTSQIRAGILWVNHYHPTYNEMPWGGYKQSGA
FT                   GRELGLYGIESYLEVKQVNINLDETPIGWY"
FT   gene            282572..283924
FT                   /gene="gabT"
FT                   /locus_tag="lpg0239"
FT   CDS_pept        282572..283924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="lpg0239"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /function="Amino Acid Metabolism, Metabolism of Other Amino
FT                   Acids, Carbohydrate Metabolism"
FT                   /EC_number="2.6.1.19"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26346"
FT                   /db_xref="GOA:Q5ZYX2"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX2"
FT                   /protein_id="AAU26346.1"
FT                   /translation="MKHQLVGTKLMKKIHIKTPIPGPKSQQLMELRRQHVARGPFHATP
FT                   IFVKQAKGSFVEDVDGNVFLDFSSGFGVVNTGHCPDSVVNAIKLQAEKFIHTGFNIIPY
FT                   ESYIKVCEKLNDHTPGHFEKKSLLLNSGAEAVENAIKIARAYTGKQAVICFDHAFHGRT
FT                   YMAMTLTSKNKPYKHGFGPFPSEIHRAPFPYEYRWKGANCVEECFDEFTDLANFRVGVE
FT                   NIAAVIIEPVLGEGGFIQSPALFLQKLREFCTTNDIVFIADEIQSGFGRTGNLFAMNTL
FT                   GVPPDLTISAKGLGGGVVLAGVTGKAEIMDAAMEGGLGGTFGGNPLSCAAALEVFHIFE
FT                   EGSLLQNVTHLAKALQSRLSGFKEKYKVVGDVRGLGVMQAIELVKDKNTKEPNKEATVQ
FT                   LAQFCLEHGLIILTCGTYGNVIRLHMPLSTGVKDLELGLSIIEEGLKKLSV"
FT   gene            284008..284787
FT                   /gene="recN"
FT                   /locus_tag="lpg0240"
FT   CDS_pept        284008..284787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="lpg0240"
FT                   /product="DNA repair protein"
FT                   /function="Replication and Repair"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26347"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYX1"
FT                   /protein_id="AAU26347.1"
FT                   /translation="MNDIMWYQNIMRNLLEKLPEASRKDGEFFLDKLFLAVKRVDNKPE
FT                   MEFFLGLIEKSFLKFENEKSGSVTLVKFSRYILGLTLLYIKSGNDGAIWNSDFIPYLGE
FT                   IKKFFDVEKEGKSFYKFLNQLEVDVFVSLNHQLAIDFKHFTSILRGNNDLKTIQSFTEA
FT                   CKGLGNESSEGFNQVVKDAEAHMINLQFADDLNSDFNLEGIDENLRNTTLQKSSHANSM
FT                   PMSVNKGHRLSIFKALATSGELSDQTSLFINQNNGPI"
FT   gene            285047..285979
FT                   /locus_tag="lpg0241"
FT   CDS_pept        285047..285979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0241"
FT                   /product="glutaminase"
FT                   /function="Amino Acid Metabolism, Metabolism of Other Amino
FT                   Acids, Energy Metabolism"
FT                   /EC_number="3.5.1.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0241"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26348"
FT                   /db_xref="GOA:Q5ZYX0"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYX0"
FT                   /protein_id="AAU26348.1"
FT                   /translation="MSSKLLTIQLLEELVHAAELNQEGKTADYIPELANVNQELTAIAV
FT                   QALGEKTLAYSNNPLHPVTLQSTGKMIPLIGLLEEFGADQLFEWVKVEPSGDDFASITR
FT                   LEQFGPKPSNPMLNAGAIALCSRIPGIGEQQFRWLEHWVQKLFNQRLSINPLVFASEKR
FT                   TGNRNRALAYLLKSRNNLGADVHETLDLYFALCSYEAMLDQMLYLPTLLANRGKDPDTG
FT                   EQILSTETCKITLAIMATCGLYDETGTHMVKTGMPAKSGVSGYTIAVVPGKAGIVVLSP
FT                   RVNAKGNSIRGEIMLEGLSKAMNWHFALP"
FT   gene            286103..286990
FT                   /gene="serA"
FT                   /locus_tag="lpg0242"
FT   CDS_pept        286103..286990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="lpg0242"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="1.1.1.95"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0242"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26349"
FT                   /db_xref="GOA:Q5ZYW9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW9"
FT                   /protein_id="AAU26349.1"
FT                   /translation="MKIAVVEPIGIAMQEIRSELPGHTIIECDSRQWSDEQLIDFVKDA
FT                   DIIALTNRRLSAAVINSALRLQLIAVAFAGIDHIDRDAVSKRNIPVKNAAGYANTAVSE
FT                   LVFGLMISLARHIPDNNQRIREQGITNTGIELKNKVLGIVGYGAIGAEVARLAKAFQMT
FT                   TIIYDRKSQVTLDDLFSQSDFVTLHVPLTNETKGMVNLRLLSQMKKSAYLINCARGPIV
FT                   VNSDLKKALEQDMIAGAALDVFDVEPPLPANYSLWEVPNLIATPHIGFNTREALVAKGQ
FT                   LTIRNIKEFLSSRL"
FT   gene            complement(287203..287802)
FT                   /locus_tag="lpg0243"
FT   CDS_pept        complement(287203..287802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0243"
FT                   /product="short chain dehydrogenase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0243"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26350"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW8"
FT                   /protein_id="AAU26350.1"
FT                   /translation="MKIVVIGATGIIGKAIVAELNPRHEIISASYKNSDIQVDITSKQS
FT                   IDAMYKKLNTIDAIVLATGKVHFAALKDMGEDDYKIGLTNKLMGQVNVVLAGLEYINDN
FT                   GSFTLTSGILNRDPILYGSSAAMVNGALDGFIKSAALEMPRGIRINGVSPTVITEAMEN
FT                   YGPYFRGYEPVSAARAALAYSKSIEGAQTGQVYCVG"
FT   gene            complement(288008..289402)
FT                   /locus_tag="lpg0244"
FT   CDS_pept        complement(288008..289402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0244"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /EC_number="1.16.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0244"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26351"
FT                   /db_xref="GOA:Q5ZYW7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW7"
FT                   /protein_id="AAU26351.1"
FT                   /translation="MVLEFDTIILGGGKGGKTLAMDLAKSGQKIAMVENNQIGGTCINV
FT                   ACIPTKTLVQSAKVAHYCRKAKDYGLNTTLHPIDFKAIRARKDAVVKGMREANLKQFLD
FT                   SGMDLMLGHGHFIGPKMIEVTLSSPRDKQKTLHITADKIIINTGALPFIPPIAGLDKVN
FT                   YFTNDSLMNTDLVPQHLLIIGGGYIGLEFAQMFRRFGAEVTVIEASSEFLGREDKDIAE
FT                   QVFQTLSNEGIQFAVDTKINAIRQEQTEVIIEANRQGQSEIIRGTAVLVAVGRIANTAG
FT                   LHLDKTGVELDERGFIKVNEFLETTAAGIWALGDVKGGAQFTHLSLDDYRLVKHNLQNP
FT                   QKKLSSQNRLIPYTVFLDPELARIGLTEAQARSQGRRIKIATIPAAAIPRAKTQGETTG
FT                   ILKAVIDAETDLILGVSIFCAEAGEILGVIQLAMELRVPYQKLRDMMFAHPTLVEGINL
FT                   WFAQII"
FT   gene            complement(289454..292834)
FT                   /locus_tag="lpg0245"
FT   CDS_pept        complement(289454..292834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0245"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0245"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26352"
FT                   /db_xref="GOA:Q5ZYW6"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW6"
FT                   /protein_id="AAU26352.1"
FT                   /translation="MHGILRMMTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYS
FT                   EQHTPEEAIQDILQIEKLSKENPLVIDFYENTHSQYPLHIKLYRYETPIPLSDILPMLE
FT                   NMGLRTYTERPYKIKTRDGQLFWISDFNVTYSQTDSINITQVKDIFAEALISINLGICE
FT                   NDGFNKLVLCAGLSWQEITILRAYAKYLHQIGIRYSQSYIEKTIEMHAAIARELIHFFY
FT                   LKFGLKRKSAIHKDILALEQKIQINIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHA
FT                   GLSKDYLSFKLKSSEIPDLPPGQPLYEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDF
FT                   RTEILGLMKAQKVKNAVIVPSGAKGGFVLKKPLHAASREQIQQEVISCYKSFINGLLDL
FT                   TDNLINDKTIPPQNVICYDDPDPYLVVAADKGTATFSDIANSIAKEHGFWLGDAFASGG
FT                   SAGYDHKKMGITARGAWESVKRHFRELDINIQQQDFTVVGIGDMSGDVFGNGMLYSKHI
FT                   RLLAAFDHRHIFLDPNPDPVKSYEERLRLFNLPTSSWEDYNLQLISKGGGVYKRSSKSI
FT                   PISPQVKKALAIDANALTPNELIRALLKAPVDLLFNGGIGTYVKATTESHADVGDKTNE
FT                   FCRINGAELHCKVVGEGGNLGFTQLGRVEFALKGGLINTDAIDNSAGVNCSDHEVNIKI
FT                   LLDKEIREKKLTEKKRNQLLSRMTDEVADLVLQDNYNQALILSISAAHSSHYSGLYQDY
FT                   MKELEKWVNLDRSVEFLPDDKKLLERKSTGAGLTRPELAVLMAHTKIHIANELLKSHLP
FT                   DDSYFTTFLETGFPISLRKPYAKALPKHPLSREIIATQLSNKLVNNMGITFMYRMLMET
FT                   GMSIADIACAYTISACIFQTDVLQNLIDSFQDKISLSTQYELLHHIRQLLNLATRWFLH
FT                   NNRLTGGIEKNIKNYGKSVKKLELLIPKLMGGVTKEYLEKLISQFVSIGIEKDMAQKIA
FT                   ITRALYTSLNIIEVATQNEFDLSLTAETYFKVGSQFNLVWFRDQIANDSREGHWNTMAR
FT                   LSLRDELDNLQRRLTIAILTTNTKERTSEKLINYWLEQNHPIQKRWEKLLEMLLGSENI
FT                   DYTIFFIALRELSSLIQVL"
FT   gene            293014..293739
FT                   /locus_tag="lpg0246"
FT   CDS_pept        293014..293739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26353"
FT                   /db_xref="GOA:Q5ZYW5"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW5"
FT                   /protein_id="AAU26353.1"
FT                   /translation="MYKNILFFSNFSRMRWNEYDGDRYQSLWEHNKRDIKHTFFGTIAN
FT                   GKDLREVLFQPVTASFSMLVAGAFAQLLVPYSIFMLCMGEAGFAGRTLINYLEITTVAL
FT                   AMPFIALLSTVGRCIATVKCLVEDQYNLAEMVEDKEVKPNKIYLDCAEVNYTFRDENNN
FT                   QFSRKYYKFQYKMRGLNDELCQGSFTFRDLERAPDNDDFNGKLSSLTLYKYDILDLIKR
FT                   VHKDKFEEMEDENLIRMSI"
FT   gene            293971..294924
FT                   /locus_tag="lpg0247"
FT   CDS_pept        293971..294924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26354"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW4"
FT                   /protein_id="AAU26354.1"
FT                   /translation="MRVFYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLAARAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGA
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLTKNYNKWPYKDMLEKR
FT                   ILNAKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
FT   gene            295084..295425
FT                   /locus_tag="lpg0248"
FT   CDS_pept        295084..295425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0248"
FT                   /product="arsenate reductase"
FT                   /function="Transport and binding, Signal transduction /
FT                   other regulatory functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26355"
FT                   /db_xref="GOA:Q5ZYW3"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW3"
FT                   /protein_id="AAU26355.1"
FT                   /translation="MEKITIYHNPRCSKSRQALEILQNKGFEPIIIEYLKTPLDLEQLK
FT                   RLRTHLALEDLVRTNENVFKELGLSLANEAQILEAMVNEPILMQRPIVTFKGKAVIGRP
FT                   PEKVLELFD"
FT   gene            complement(295512..296666)
FT                   /locus_tag="lpg0249"
FT   CDS_pept        complement(295512..296666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0249"
FT                   /product="stearoyl CoA 9-desaturase"
FT                   /function="Lipid Metabolism"
FT                   /EC_number="1.14.19.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0249"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26356"
FT                   /db_xref="GOA:Q5ZYW2"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW2"
FT                   /protein_id="AAU26356.1"
FT                   /translation="MMFGFLNMTLWGYLLAGFVLTHITTTAVTIYLHRYQTHRALTLHP
FT                   LVSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFTLKKVFWQVPELYRE
FT                   ASKDKDMIKKYSSGTPNDWIERKLYSPHANKGIFLMLTLNLFLFGIPGLTLWAIQMMWI
FT                   PLVAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWE
FT                   FDLGWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVI
FT                   FPTLRDMQYRIKNRDLKNARHLFKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQ
FT                   QIWLKTSLSNKDLLNLIQKWCSQAEESGLHVLRQFASQLKSYSL"
FT   gene            complement(296785..298029)
FT                   /locus_tag="lpg0250"
FT   CDS_pept        complement(296785..298029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0250"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0250"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26357"
FT                   /db_xref="GOA:Q5ZYW1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW1"
FT                   /protein_id="AAU26357.1"
FT                   /translation="MSFKQLALIEPLNRAVSELGYTTPTSIQLKAIPLILNGHDLLGSA
FT                   QTGTGKTASFVLPILQKASQQTQTSPNRVKVLILTPTRELAIQVHESIIQYGKYLTLRS
FT                   AVIYGGVKSHNQIKQLDSGLEILVATPGRLLDLYQQRAVKFDEIDTLVLDEADRMLDMG
FT                   FIHDIKKIIKLLPLKRQNLLFSATFTPEVRALARNILNKAVEIDIAPRNTAVKTIKQTV
FT                   YSVDRNHKLALLSHLLHKNNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQ
FT                   RIKALADFKSGKVQTLIATDIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGAS
FT                   GLAVSLVSTEEIKLLLSIEKLINQKLERIKIKDFEFLHNFSDFVSAKIQKFAPPKAGYK
FT                   GNISRKSRTAFNKSA"
FT   gene            298358..298636
FT                   /locus_tag="lpg0251"
FT   CDS_pept        298358..298636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0251"
FT                   /product="RNA binding protein, cold-inducible rrm"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0251"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26358"
FT                   /db_xref="GOA:Q5ZYW0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYW0"
FT                   /protein_id="AAU26358.1"
FT                   /translation="MMKQKKIYVGNLPFGTTEEALSIQFSQYGKIEEMFLIKDRLTGQM
FT                   KGFGFITFSAQQEAESALEMNGQPFDGRSLKVCMAQKKTNSVSRSRW"
FT   gene            298794..299489
FT                   /locus_tag="lpg0252"
FT   CDS_pept        298794..299489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0252"
FT                   /product="membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0252"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26359"
FT                   /db_xref="GOA:Q5ZYV9"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV9"
FT                   /protein_id="AAU26359.1"
FT                   /translation="MVIIVSMKANGFFDEQSSLKKSKIGLNLVWMFSLGHIFLITLSNV
FT                   LVQYPFDMMGFHTTWGAFTYPAIFILTDLTTRIATANKARKIIMLSMTPGLILSYLVAS
FT                   YIEAGNNLNESGLSVLHLMPLRIALACFIAYVVGQLLDVAVFQRYRNRPAWWLAPTLSA
FT                   VAGNFIDTALFFTIAFYHCSNPFLSQNWPEIAMVDVFFKIMISLIAFVPVYGLVLSILG
FT                   IKTTNKLMV"
FT   gene            299524..300165
FT                   /locus_tag="lpg0253"
FT   CDS_pept        299524..300165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0253"
FT                   /product="acetyltransferase, GNAT family"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26360"
FT                   /db_xref="GOA:Q5ZYV8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV8"
FT                   /protein_id="AAU26360.1"
FT                   /translation="MMLTGLRLLTKDLKILNGKYIQLEPITSQHREELRKAANHEQIWQ
FT                   YMPQKATGKLFNSWFDDCLEKMSIRDQTTYAVRCKKEGDLKGATSFYDIQPENKRLALG
FT                   YSWYIPKVWGTTTNPESKLLMLHQAFDAWGINRVELGTDSRNIHSYRAIKKLGATEEGV
FT                   LRQHMILHNQVITDTIMFSILFSEWPAVKERLIQRLNYAATDKDHLAVSI"
FT   gene            300258..300827
FT                   /locus_tag="lpg0254"
FT   CDS_pept        300258..300827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0254"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26361"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV7"
FT                   /protein_id="AAU26361.1"
FT                   /translation="MSEYLVLPARKECSMYNKMFKPLDTDPILYFKMYSNYTEGRVDDC
FT                   CAFILMPSGLQRDWVCLQSIQFAFNKCGDVLGINIIFSGNESNIHKKVRETMEGMLKLK
FT                   LQYGRGEELFVFDEEKKTFHLGILPGKDTQAYLEGIIAFIQDSYRLQPDFAQNIKAQLL
FT                   NKEYLAQEYSRLRWKPPEKESVCVLM"
FT   gene            300982..302328
FT                   /locus_tag="lpg0255"
FT   CDS_pept        300982..302328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0255"
FT                   /product="outer membrane channel protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0255"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26362"
FT                   /db_xref="GOA:Q5ZYV6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV6"
FT                   /protein_id="AAU26362.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLQQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLIAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSRIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVEIKTLFENIDSNQLVPGNLPASVLSVRPDIHEA
FT                   EALLKAAHADVGAITANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALSDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVTLYQDLGGGSRGH"
FT   gene            302309..303355
FT                   /locus_tag="lpg0256"
FT   CDS_pept        302309..303355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0256"
FT                   /product="conserved domain protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0256"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26363"
FT                   /db_xref="GOA:Q5ZYV5"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV5"
FT                   /protein_id="AAU26363.1"
FT                   /translation="MVPVGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWF
FT                   VMYEYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFM
FT                   GGDKTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVL
FT                   EIQLNFITQLANLLESYLNPTQSLAAVQTKYLDYERKMLDGFTLYNRYIGEAKIETKKA
FT                   PFFIPHSIAAMQHFRRLFRLFSVFIYYLSTEEIRSDPWVCDQLSKLLRNLQSLQRKLLQ
FT                   QDAGPIGGDVEVAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDTEIKEIILIYDV
FT                   YDIRLNEM"
FT   gene            303412..304404
FT                   /locus_tag="lpg0257"
FT   CDS_pept        303412..304404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0257"
FT                   /product="multidrug resistance secretion protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0257"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26364"
FT                   /db_xref="GOA:Q5ZYV4"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV4"
FT                   /protein_id="AAU26364.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYVKNEQEVKKGQPLFTVFKAPYELAYRKAVSHVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNYSASRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASAYVYIHTH"
FT   gene            304581..306524
FT                   /locus_tag="lpg0258"
FT   CDS_pept        304581..306524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26365"
FT                   /db_xref="GOA:Q5ZYV3"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV3"
FT                   /protein_id="AAU26365.1"
FT                   /translation="MKIPFEGKWRATITKREAGFSQRVVVGSATSGNGSYNGVVGNSFV
FT                   FEDGWVELQWNNNAGSGWQESAVISSVGMTSPLVVVKFVSADDNFPNQRDGDYDDLQVR
FT                   FEHLDAPFEVTQRPYALDRGSLAMFPDGIFDASQGIQYMGVRIKNTWFFDWQSNFPATG
FT                   MKIGIAPVSRSALSAAGIMVIDSWTPQEQEGLGQIMDGGFVRVPDIKINEETTIYFKLD
FT                   VSNANPSKPEIGFVAQRDAYDPRYDEPTRIVDKKIFISRSSYNPATRELVTAIPEGTLY
FT                   LKLNKIAIDRKGATKAAQELKKCLKQHGGGIKGMSKWLHKLSRGFWQNSKDKERWCKEQ
FT                   GNDALRKLLKQLLDGKDIDICHLKAILDQCCERPGGDCECCPCGDGDGRPGGWDDGTGV
FT                   DGWCRVKPVFWLPLDFEYKVVPNPAYIGQFGPLAFEDPWWKVVLIILAIILAIASVIYD
FT                   YVYASEDDQYIIGQVVRNGDAPINLVDAAVSNLNGSRGVDLGQLDAQGNDINNGSPITV
FT                   LDSIIQLDRTAAGSYFGTLDAVLGNVVWKSGATSATTRGFISTLGTSVSIPYDEHDTLS
FT                   DTVTYINEVVISELAAIPQTLSDPGDSGSVWVDLATARPVALNYGSPTDSSDNRAFANP
FT                   IRSVIDVLNLRF"
FT   gene            306543..308327
FT                   /locus_tag="lpg0259"
FT   CDS_pept        306543..308327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0259"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0259"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26366"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV2"
FT                   /protein_id="AAU26366.1"
FT                   /translation="MKREFFQKLDKILDIASEHKQMLLQYPDVVMVGVGPERRKGKITG
FT                   EPAIIVTVRKKRSSNELKKRGEKPLPQTIKGIPVDVIELGKAVEAPEIIAVQEKAKKTI
FT                   SKIRAKWLQTPNITAIGYGYKEKGGEIDFNTIAIQFFVKKKFPIAELQNQQITPIPEKI
FT                   NGVSTDVIQLSPIRPAAASGSRGDRHDPLKGGVAIGVGSKPFHYGTYGATVFDRTTGER
FT                   LFLSNQHVLDASPGTDTIQPSPVLLDDSVEVGFQLDFCLPIHFIRLDTPNTTVGTVLAG
FT                   AAVAAAVAAALSDEIDPTRRGQEATMPATGSKTLFETQKVKMDYPELPIPGTPFKVKTA
FT                   WDYERHTDAGIKTFSVSEEKKNPHVLRDKLLITDKKLYHPGDTIRIFGLILLEECAPAS
FT                   QTRDDRQPISPRELEDITHYPNLASSINLDLVATMDSDIASSPARRTNTRAAVINPKRC
FT                   RCDRYHPVAILTPTTEDRAFPVVLREPVFAQKNQIFQDLLTVVKQRDDEKLLERVFVLV
FT                   RYGCIYTGTLRVNNIPAGPWKHFFYVQTVNIATSDMKPLLAAQIIGGLPVSENAKADLD
FT                   IACGPLTWEDGEFDIELI"
FT   gene            308513..308911
FT                   /locus_tag="lpg0260"
FT   CDS_pept        308513..308911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0260"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV1"
FT                   /protein_id="AAU26367.1"
FT                   /translation="MFGFFSDYKQYITLRNFAVVYNGLTGLAVLYSLWSNPEADPSEYA
FT                   IDISIHALTAITLMCKQAPESVKAVAMALNTYRGFDALFKAITSLPSTIPGIANAVDVL
FT                   NHRFNFKELEKLGNEETVETRSAVQHTM"
FT   gene            complement(309426..309605)
FT                   /locus_tag="lpg0261"
FT   CDS_pept        complement(309426..309605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0261"
FT                   /product="ISSod6 transposase, ISI301"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0261"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26368"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYV0"
FT                   /protein_id="AAU26368.1"
FT                   /translation="MVNLKSVLRIAEVDWGLYKYRHLVENIFVRLKQFRAIATRYDKLK
FT                   RNYASTLAMACSYI"
FT   gene            complement(309672..310310)
FT                   /locus_tag="lpg0262"
FT   CDS_pept        complement(309672..310310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0262"
FT                   /product="bacteriophage related DNA polymerase"
FT                   /function="Nucleotide Metabolism, Replication and Repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26369"
FT                   /db_xref="GOA:Q5ZYU9"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU9"
FT                   /protein_id="AAU26369.1"
FT                   /translation="MSDVLNNYYLQTMGIEVWVMRESTPSCEKHLAALADEVASCVRCS
FT                   LHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGLLLNKMIRSIEMTENDI
FT                   YIANVLKCRPPNNRDPALEEISQCSSFLTRQIQLIKPHLILALGRFAGQFLLDKPLPLK
FT                   QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAVKNFLLDYGQ"
FT   gene            310567..311841
FT                   /locus_tag="lpg0263"
FT   CDS_pept        310567..311841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0263"
FT                   /product="MFS transporter family protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26370"
FT                   /db_xref="GOA:Q5ZYU8"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU8"
FT                   /protein_id="AAU26370.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTYLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVGTVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFVFVKGELGGLWFGTENFANIRAVTVFVALWISLFSLPLFLMVQQKTGEHLTV
FT                   GTAIRKGLQELRLTIKSLPKQRDLFLFLIARIFYIDGLNSILALGGIYAAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNALFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
FT   gene            311920..312618
FT                   /locus_tag="lpg0264"
FT   CDS_pept        311920..312618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0264"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0264"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26371"
FT                   /db_xref="GOA:Q5ZYU7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU7"
FT                   /protein_id="AAU26371.1"
FT                   /translation="MFLQVISYDKLCSNMKIIISILFAFISASGHAFSCYDPQTIIQKP
FT                   IQFDKKRIALTREYQLTHYGIDSESIEIEPKMIVLHWTCIPSLDTTFRIFDPPALPSSS
FT                   PRRNELPGDLNVSSHFLVDRDGTIYQLMPETWMARHVIGLNHYAIGIENIGGVDSKDDL
FT                   TEEQAKANAFLVCYLKNKYPQIKYLIGHNEYLQFKGTALWLEKDPNYQTDKTDPGPTFA
FT                   KKVKQLVLAS"
FT   gene            complement(312673..314214)
FT                   /locus_tag="lpg0265"
FT   CDS_pept        complement(312673..314214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0265"
FT                   /product="multicopper oxidase"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0265"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26372"
FT                   /db_xref="GOA:Q5ZYU6"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU6"
FT                   /protein_id="AAU26372.1"
FT                   /translation="MTNTTDFYSITPLDKARWQKILINKITVRTLGKIFVFIMAITIMI
FT                   TLFNFSYATDSKLKPTVITVSEEEFQVDGKGKKTKEFKLTFTHPDGTKDNKGYFANKGD
FT                   MFHVLVENKSASPITLHWHGLIVPSDQDGVPDVSQILIQPGQNKLFNYRLLQAGTYWMH
FT                   SHQKFQEQKQLSAPLIIYDKDDPHKDLQEVILFLEDFTYKDPQLIFDQLRTAKMDMKAM
FT                   DSGNDLNDVTYDAFLANKKTFAAPDVISVQPLKKVRLRIINASSSTNFKIDTGKLSATL
FT                   IAVDGENIEPIVDSSFPIGVGNRMDLLVEIPSAGGAFPIKAMAEGTNKQTGLILKTDNT
FT                   PTPILSPNTTNKTGRVNYYELEKKLKGKNALTNKKINARLHYVLDGQMNGYIWTMNKQS
FT                   WPDVSPKVIHFGDRVEMIYENKSSMSHPMHFHGHVFQVTEIDGQPLDGAMRDTLLVQPH
FT                   STVKVQFDALNPGIWANHCHNLYHLNAGMFTTFEYQHYPKPDFYLKTIRQSKNNN"
FT   gene            314443..314877
FT                   /locus_tag="lpg0266"
FT   CDS_pept        314443..314877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26373"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU5"
FT                   /protein_id="AAU26373.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHLGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECLWRVVKGVGENFSVG"
FT   gene            complement(314892..315944)
FT                   /gene="corA"
FT                   /locus_tag="lpg0267"
FT   CDS_pept        complement(314892..315944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="lpg0267"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26374"
FT                   /db_xref="GOA:Q5ZYU4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU4"
FT                   /protein_id="AAU26374.1"
FT                   /translation="MSISFKSPILKLYEEINRIRMSIEMHSFDSIAVEFDLKNHSMQKI
FT                   AIEDLNIDYQDKDKIYWIHSDLNQKNIFKKLREKLRLPEEVIQLCGEKDNRSTTIEIDE
FT                   ALTLQIQGLCSMKLNDNYDADFGNLIIHLTPNYCFTASKTLSSVLFDLLKSCPKSLPYA
FT                   KTSCFLLFLLLEGVINDYAKIHLAYEELADQLDAQARTTNKNTYSQVLELKHGVMKIKR
FT                   YTIAIREILMRLTSRNILVISEQCRNSLYNLSNHCHLIVNEIDSLRDILNGLLGQIDNQ
FT                   LMQNMNETMRVLTAFAAIFLPLSLITGIYGMNFYWMPELGWKYGYFWALGLIVLCALLL
FT                   FLIFRKKKWF"
FT   gene            316127..316723
FT                   /locus_tag="lpg0268"
FT   CDS_pept        316127..316723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0268"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26375"
FT                   /db_xref="GOA:Q5ZYU3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU3"
FT                   /protein_id="AAU26375.1"
FT                   /translation="MNQDMEKIEKMYQLIMEINKLKLVFRNTVTNPQRNESTAEHSWSA
FT                   SMITLILMNQLKREFTEVDELKTIKLVLIHDVVEIYAGDVLAFDLAARKDKEKVELEAL
FT                   EKLSAVYPSFGIELDSLWHEFEERKSLEAKIAKAADAICPIFQRLQAKQSYIPFNISMA
FT                   QLEKTKYPYFQFSKTFSNLFEKLKADLLKEQLIFL"
FT   gene            316801..318363
FT                   /locus_tag="lpg0269"
FT   CDS_pept        316801..318363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0269"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0269"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26376"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU2"
FT                   /protein_id="AAU26376.1"
FT                   /translation="MVNQNESSILLKTLIIKKISIMYDDLWKPYASIQLPSLKLGGIVL
FT                   NGQLLSETPIHLVLKAFNRHGLIAGATGTGKTKTMQVLAEQLSLNGVPSLVMDIKGDIS
FT                   GLAMPGQTSTKLVERGQQLHIDFTPRGFPVELLTLTPQDLGVPLRARIDDFGPLLFSLM
FT                   LDLNDTQAGVVTVLFEYAKANQLNLVNLDDFKSLLQFAQTDRGNQLIAAQYGGVASTSI
FT                   GTIVRKIIELESQGGKQFFGEPSFVIQDLLRTDANGHGVISILRLLNMQDKPKLFSSFM
FT                   LKLLSDVYRQMPELGDPDKPRLVLFIDEAHLIFNYSSKALLNLIETIVKLIRSKGIGLI
FT                   FCTQTPNDIPEAVLSQLGLKIQHSLRAFTAKDRKALKLVSQNFPVSSYYNTEQLLTTLS
FT                   IGEALVSALDAKGQPTPLVQAMIRAPESRMGTLSNEELKVLVNQSPLFAKYYQMIDVPS
FT                   AKEKLSELISEQQVAKQQTSQKENDSSVLNNLSKNTLFRQVVRQVFRELTRAILSLFKI
FT                   KRN"
FT   gene            318430..319848
FT                   /locus_tag="lpg0270"
FT   CDS_pept        318430..319848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0270"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="6.3.4.21"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0270"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26377"
FT                   /db_xref="GOA:Q5ZYU1"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU1"
FT                   /protein_id="AAU26377.1"
FT                   /translation="MTRIYMINITGTYTDQYQLAMAQVCFLKGQHERIATFDYFFRALP
FT                   FKGGYAIFAGLEDLLDVLEQLRFEQQDIEFLQHQNMHPDFIRYLQQFKFNGTVYTSLEG
FT                   DVVFPTRPVVIIEANLIEAQIIETLLLNIINFQTLIATKARRIRQVAGERILIDFGLRR
FT                   AQGAGGYFASRAAIVGGFDSTSNVRAGRDYSIPVSGTMAHSFIQSYDSEIQAFSDYAEA
FT                   WPENCILLVDTYNTLQSGIPNAIKIAKEMEKRGHRLKGIRLDSGDLAWLAKRARHMLDE
FT                   AGLNYVAITASNQLDEYVIKNLLEQDAPIDAFGVGTNLAIGAPDAALDGVYKLAFINGQ
FT                   PRIKLSDTPAKITIPYQKQVYRVFERDGTYRGADVVCLKTEKKIDMMHHPFEILKSLSI
FT                   KHYKKEALLHKVMENGKRLLPKKSLGEIARFSQQCFDRLPLEYKRFINPHIYKVGLSTE
FT                   LKMKRDQLIAEHSR"
FT   gene            319832..320473
FT                   /gene="pncA"
FT                   /locus_tag="lpg0271"
FT   CDS_pept        319832..320473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="lpg0271"
FT                   /product="bifunctional pyrazinamidase/nicotinamidase"
FT                   /function="Amino Acid Metabolism, Metabolism of Cofactors
FT                   and Vitamins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0271"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26378"
FT                   /db_xref="GOA:Q5ZYU0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYU0"
FT                   /protein_id="AAU26378.1"
FT                   /translation="MNTQDNFMKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCF
FT                   DLIVASQDWHPSNHISFASNHTGRKPFEKIKLGNLEQTLWPDHCVQGSVGAQFHPKLNT
FT                   NSIEAIFRKGTDPNIDSYSGFYDNLHKKTTGLAGYLREKGARELYFCGLCADICVYFTI
FT                   KDALSQGFDCYLVEDATQALVKDDFIKIKKELIKQGSHIINSSNLLNNLQ"
FT   gene            complement(320556..320939)
FT                   /locus_tag="lpg0272"
FT   CDS_pept        complement(320556..320939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0272"
FT                   /product="cysteine transferase"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0272"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26379"
FT                   /db_xref="GOA:Q5ZYT9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT9"
FT                   /protein_id="AAU26379.1"
FT                   /translation="MSIQLNHTIVWVKDRDKSAHFLTEILGLPEAIPYGPFMVVEMSNH
FT                   VSLDFCKTDKEITPQHYAFLVTETEFDDIFKRICERKMDYWADPGQTRLGQMNYNDGGR
FT                   GLYFNDPNGHLLEIITKPYGSGS"
FT   gene            complement(320939..322180)
FT                   /locus_tag="lpg0273"
FT   CDS_pept        complement(320939..322180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0273"
FT                   /product="major facilitator superfamily transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0273"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26380"
FT                   /db_xref="GOA:Q5ZYT8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT8"
FT                   /protein_id="AAU26380.1"
FT                   /translation="MLIVKTILIMYPKTKLSFMTLLLLISFASVNAVLFTPALPSITAF
FT                   FRITEHAAQQTITCFLVGYAIGQLVYGPTANRYGRKKTLYIGIGLQIISSLLCVLAGMI
FT                   SMYPLLVLGRFLLALGSGVGLKMTFTLVNECYEPQLAAQKTSYLMLAFAIAPGLSVALG
FT                   GILNSHYGWESCFYAGTVYGAILLAMVRQLPETQKNLQLEAFQMKHLLQGYVSQFKNKP
FT                   LISGGALMGGASCFVYIFAATAPFIAINLLGMSTAEYGAANILPSLGLTLGSIWSAQFA
FT                   KKYSQRAGIQLGILISGFAALAMMMAALTHHSALIKLFFPMIFIYLGLSFIFANASTFA
FT                   MSHTSDKAHGSAVMNFINMGLVTVVILGLSLLPMSQYLLPAIYIILCIFMMWLFFSFIK
FT                   SNEIISSIDRNKES"
FT   gene            322271..323134
FT                   /locus_tag="lpg0274"
FT   CDS_pept        322271..323134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0274"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0274"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26381"
FT                   /db_xref="GOA:Q5ZYT7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT7"
FT                   /protein_id="AAU26381.1"
FT                   /translation="MGKFDQITYFIAVVEEHGFAAAARKFGVSTAAVSRQIARLEAELK
FT                   AELLVRTTRKLSLTDIGARYYQQCKKTLLELNEAEIAIANSRNEAVGILNVTSSRYFAM
FT                   RFLLPYLPEFMELNPKLQIKIELAERFPDLAQENVDVLFGVSMEGPPELVRKRVSTTRY
FT                   VLCASPDYLAKNGIPKTPSELGKHRYITHSMRNPDNLVTFKDNEQIYVEPVLWLNDSRA
FT                   LCECALLGMGIIKLHEYIVTEALQDGRLIEVLPEFQESSLSVYLYYQASRYLQPKIRRF
FT                   IDFFTK"
FT   gene            323554..326904
FT                   /locus_tag="lpg0275"
FT   CDS_pept        323554..326904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0275"
FT                   /product="SdbA"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0275"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26382"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT6"
FT                   /protein_id="AAU26382.1"
FT                   /translation="MHKKYNYYSLEKEKKTFWQHILDILKAPFRLPGWVVSFFLARNIT
FT                   HVALNPNNIPQQRLIHLTKTSNRPEDDIVVINFKKRPPHKWFNDTLIKIANTIAALPFV
FT                   TPRLRTRLHYDNENDINHVNKLLAEIDALVQGKSKQKYCKGRAFDWSKIHLKGLEFLDP
FT                   KMRGYVYEQLHEKYGYVSYTTKRKPNIEFFTLKTPDGSELDSVQVTGEDEEKKPMGERK
FT                   FIITCIARDQNFINWIKDLNYTAKNLGATAISFNYRGVDYSRGLVWTENNLVDDILAQV
FT                   QRLISLGADPKNICLDGMCIGGAVATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIV
FT                   PELQTANWWSPLTYGRFLLAGVVYALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRD
FT                   KDNGLYDGVIHDHFCSIASLVDSQINSILYKLSTDQPLTEEEKQILCDDQFSHHFKPSQ
FT                   SVLKNPKYKGPHFISRQDLVAELGHREEYTNHDYFLDRLREKFQLDRATRPVALAEDGE
FT                   KDIDGISSQLSNNKERPLIIASSGGTGHISATHGIINDLQSKTDNVVITQHHAELYKNK
FT                   PFSITSVLIRIGVWFTSLPILEDILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKEN
FT                   GIETGRTRPYVDMLLDIYPEGYEYTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVY
FT                   QNILQRLMHAAKQNTPYTRLISTQALSLGAICDAVKYYNTVFLPVYNAERGTSYQPIAI
FT                   DQYMTDLPSLGCIHFMNNLEELTSEQRQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNID
FT                   PRNNPMIRNAFKDPSLTKYLDKTQSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIA
FT                   SIMIGSLAANASADYAKYLLNQGYEHIFLFGGLNDSIAARIDQIINSYPAPTRDEIRKK
FT                   IILLGNQSDVEMAPIMTRSNCVVIRGGGLSVMEQMAMPIMDDKIVLLHHEDNEEGPLTS
FT                   GLSWEDGNSDKLIEYLSEKGAYAKKTSPGLCSGHLHEAEKSFEKKYHGQLKSTETKKKV
FT                   DLTIPQQETYSLKKEWDRKTGYTESGHILSHQHRFFNTIPEVREPFCSKEDLHHNELSS
FT                   QSLVSVSAG"
FT   gene            327062..328561
FT                   /gene="legG2"
FT                   /locus_tag="lpg0276"
FT   CDS_pept        327062..328561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legG2"
FT                   /locus_tag="lpg0276"
FT                   /product="Ras GEF"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0276"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26383"
FT                   /db_xref="GOA:Q5ZYT5"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR023578"
FT                   /db_xref="InterPro:IPR036964"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT5"
FT                   /protein_id="AAU26383.1"
FT                   /translation="MINKSRLLSLIACFNNREINMPKILDSHAYREMENELNTLFEQIY
FT                   KHGKNDRTAITLQAQQFLDNLSESIRDHSRLLLTKIAREELIYFKEKKPGDSREKFQNI
FT                   DKMSDYFNNLSALINFSVMQQEDPTLRAFYYDMYIQLMNFCYLKGDLFGAGAIYTGLIA
FT                   NNLPNSIDWKQLSSESRLIFKDCEEKFKRLFNLSTTYNAHTDLKRQFKTALIPALPSLL
FT                   TVQIYTKDSYDNSVSDFERIQDKLRQLDIEHNRFLNQLQNDRSTWSKAYYDYMSNVYLP
FT                   QSIFEYTTLLREYEELVTTHGGPIAKQFHKDKNSEPLVNFVESTLSENQSVLKVSPFQN
FT                   ERIVEMLSEIDVVKSECSSPAVFDDLSWKLREMNCTLVKAKSIGDYTSKIFANLDTPYM
FT                   EENTDEDPKPVLVEELQTDDVYQLHHSGMKLMRELEQAIEDHKPKVIYHCSGEANYGFF
FT                   KEARRRGRHLSREPMDIEVMDMDVMDYDENDLRDQTVMITV"
FT   gene            complement(328627..330849)
FT                   /locus_tag="lpg0277"
FT   CDS_pept        complement(328627..330849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0277"
FT                   /product="sensory box protein, GGDEF family protein, LssE"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0277"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26384"
FT                   /db_xref="GOA:Q5ZYT4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT4"
FT                   /protein_id="AAU26384.1"
FT                   /translation="MSTESFRILVIDDNPAIHQDFMKILNVSKNSVLLNKFDAELFDDE
FT                   TEQLGISLPEFEIDVATQGIEGIEKVKRSLEEGRPYPLAFVDIRMPPGIDGIETIKRIW
FT                   AIDPQIQIVICSAYSDYSWESTVNTLGLSDNLLVLKKPFDVIAVRQLASALTQKWVLAR
FT                   ETQKHTEFLNQLVEERTESLQQSFSLLRATIESSSDGILVVDLQGKIVDYNSQFVKLWN
FT                   IPESIMKKTSESQLIQYMSTQLLNSEQHAQHVKEFSIHIDDSSIQIYHFRNGKVVECCS
FT                   KPHRVGPQTVGRVWSFRDITEQTRLKEKLEYQATHDALTNLPNRLLLIDRIEHAISSYA
FT                   RHKMKFAILFFDLDRFKMINDSLSHEAGDQLLCAVAKRLRSLVRKEDTLARLGGDEFVM
FT                   LFQSFNSEEQIAGVAQKILKSFQKPFHIAERDINIHVSIGISVYPTDGKTVNTLLSNAD
FT                   MAMYQAKFRGGNQFSFYTEKLNKKTNQQFQLELDLQKAIIHHEFFLLYQPQFTVNTHEI
FT                   RSMEALIRWNHPQKGIILPLDFIPTAESSGLIVPIGEWVLRETCKQIGTWRTMGLPEIR
FT                   VACNVASKQLRQRDFPAMVEDLLKEYSVKPHCLELEITENVIIDKEIQRTIKKLKSLGV
FT                   LIILDDFGTGNSSLNLLKQVAVDSLKIDQSFIQNISKSPGDEAIIDAIIAIAQSMNFNI
FT                   IAEGVETQNQLKFLKKRRCNDIQGFLMSKPIPSEEIEKLLQGNRTK"
FT   gene            complement(330852..332267)
FT                   /gene="fixL"
FT                   /locus_tag="lpg0278"
FT   CDS_pept        complement(330852..332267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="lpg0278"
FT                   /product="sensor histidine kinase"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /EC_number="2.7.3.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0278"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26385"
FT                   /db_xref="GOA:Q5ZYT3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT3"
FT                   /protein_id="AAU26385.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINAKLEYAQDIAQIGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVALNYSSFLDLVHPNDKAGLKNVVEKALKEKEDYDYELRVRNGDNDYKWYRTIARANP
FT                   HKNEISGVLMDISKRKIIEEQVHELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLQNPKGKLILPYLDALSKTLHEEYE
FT                   ENMKESNSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPDINEFITDKSKLFQILTNLLANAKDSVLLHEANDSRKVVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGKGAQFV
FT                   LDLPINPKTLSTR"
FT   gene            complement(332290..333456)
FT                   /locus_tag="lpg0279"
FT   CDS_pept        complement(332290..333456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0279"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0279"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26386"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT2"
FT                   /protein_id="AAU26386.1"
FT                   /translation="MMKIESFQYIQNQGWSIPTFPELDSENTLILVFASPIFRANSKPI
FT                   EELAQAYKKSKIIGCSTAGEIFGPNIFDNSISVAVVQFESTKLQLAKTEVKSTEESYEA
FT                   GVHLSKSLHQKQNPQSIFVLSDGLNVNGSELIKGLNQHAGKGVIITGGLAGDGADFKNT
FT                   WIIYDGKIVDHCIGAVGFYGDQIHVGHGSRGGWDIFGPERVITRSKANILYELDNQPAL
FT                   KLYKTYLGDRASELPAAGLLYPLAIRNPSAPDSQHIVRTILGVNEEEQSLIFAGDLPQG
FT                   YYAQLMRANFDRLIVSANEAGENANDRLFKNGNLNTQPVLAIDISCVGRRLVLGELTEE
FT                   ETETTLQSLPPKSIQIGFYSYGELSPLATGTCELHNQTMTITTLLESP"
FT   gene            complement(333622..334503)
FT                   /locus_tag="lpg0280"
FT   CDS_pept        complement(333622..334503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0280"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0280"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26387"
FT                   /db_xref="GOA:Q5ZYT1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT1"
FT                   /protein_id="AAU26387.1"
FT                   /translation="MDIRDIKSFLAVVEYHSLTLAAKKLHVTQSAMSKRIRKIEDELNV
FT                   RLIISEGSKLIFTETAKQLIPYARQMLSAHQNMVHTLKNSQQFTQSIIIGASVYVSHYV
FT                   LPGFFKYLKETHPTIQAHLKTISEKEVEYILNHGTVDLVICPAREVSEKLLGNCLLWEE
FT                   KLNLVVAANHELAHRTSELSLSELSEYPAILTEKGAALRDKLDTLFEKNQLVLILGFEM
FT                   STIDAIKSLVEYGLGWSYLPDSLLSEKLKILKIKDLELTISFHAFYLKKRISDRLINDL
FT                   LSNFKKWQNRDN"
FT   gene            complement(334725..335909)
FT                   /locus_tag="lpg0281"
FT   CDS_pept        complement(334725..335909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0281"
FT                   /product="amino acid transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0281"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26388"
FT                   /db_xref="GOA:Q5ZYT0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYT0"
FT                   /protein_id="AAU26388.1"
FT                   /translation="MHLKRTLSLTLLAFYGLGTILGAGIYALVGEVAKEAAQFTPLSFL
FT                   IASIIALFTAISYAELSSRLPLSAGSALYVRRAFHQKWLSGLIGWIVVLTGVISAATLS
FT                   HGFVKYFQLFLPLPPSLIITILTVILAGVAVWGIRESATLILYMTLMEVGGLLMIIYYG
FT                   RYSFASIDIQSFSLPHSFDGVLIGAFIAFYAFIGFEDMVNTAEETINPEKTLPKAIFLA
FT                   LISATILYVAVAWVIVSTIPSNALVKTDMPLIEIIKLQGQSPLLFSIIALISITNGILV
FT                   QIIMASRLIYGMANQQNAPQIFSFVYSKTQTPVNSTLLVSLIILLFAYALPITTLAKLT
FT                   SSIILCIFIIIHASLIKIKLTKKKPTNAISFPIVFPMISILLTLAFLIIQFFLK"
FT   gene            complement(335977..336753)
FT                   /locus_tag="lpg0282"
FT   CDS_pept        complement(335977..336753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0282"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26389"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS9"
FT                   /protein_id="AAU26389.1"
FT                   /translation="MSRREWPANDYAIGSYIQATVAEEYLPYLNMKPADKVLDIGCGNG
FT                   AFTKNILMKVPQGSVLGIDASENMLHLAQDVSKEYPNFSVQKADVLTMDFHLQFDYVVS
FT                   FWCLQWACANIQKAFLNIVNALKPGGKFLTLFPAGDDPFIMSYYALKKSGQFASLHDFI
FT                   PPVDYSHLKNLEKKLESLSCQELKVKLCRQSITLPSLDVFRKFVNGIAFYQGQLPNEEI
FT                   QKINEAMVQYYDNECQAKYNGEYQFNFTIYLVTGEK"
FT   gene            336961..338172
FT                   /locus_tag="lpg0283"
FT   CDS_pept        336961..338172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0283"
FT                   /product="NAD dependent formate dehydrogenase"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="1.2.1.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0283"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26390"
FT                   /db_xref="GOA:Q5ZYS8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR033689"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS8"
FT                   /protein_id="AAU26390.1"
FT                   /translation="MFSQSQQKIVCVLYDDPKGGFPPNYARESIPELKQYPDGQSLPNP
FT                   DSIDFIPGEMLGSVSGELGLRQFLESNGHQLVVTSDKDGSDSVFARELKEATVVISQPF
FT                   WPAYLTRDRIESAPKLKLAITAGIGSDHVDLQAAMEHNITVCEVTYCNSISVAEHTVMM
FT                   ILALVRDFIPQYNTVIDGGWNIADCVSRSYDLEGMQVGCVAAGRIGLAVLRRLKPFAVK
FT                   LHYTDRHRLPVQLEQELNLTYHPSVESMVKVCDVVSIHCPLHPETEYLFDERLIKQMKR
FT                   GSYLINTARGRICDQHAVADALESGHLAGYAGDVWFPQPPAKNHPWRSMPNHAMTPHTS
FT                   GTTLSAQARYAAGVREILECWLGNKPIREEYLIVSQGHLAGVGSHSYSAGNTTSGTEQA
FT                   AELV"
FT   gene            complement(338278..339402)
FT                   /locus_tag="lpg0284"
FT   CDS_pept        complement(338278..339402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS7"
FT                   /protein_id="AAU26391.1"
FT                   /translation="MFTKSCAKATDQNRQELFMDSLLGDFQKMKEKALNQQQERRSKKR
FT                   ELHCKSSEKTKKPNQYAALTHSQVQEVKAKVRTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFVFALLLHQAQKPESLIHSLRLATFNNHFILIVNEQFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFERFGRLVNYFSINQEGQCFTHTVREGGTIERDPSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTNTKRRKYENQEQEVPQPRQETSNQPTETVYTDSSHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGLKPDLPKNLFKF"
FT   gene            339639..340322
FT                   /locus_tag="lpg0285"
FT   CDS_pept        339639..340322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0285"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26392"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS6"
FT                   /protein_id="AAU26392.1"
FT                   /translation="MVIIGILMSKERIKKTALEIVKYIHGNIKACNIPNQKKENKFFAP
FT                   LVYLCQTECDKILSNTKISLLERLLKCAKIIGDLQSGNCMQQTFLAFQRLLMRLIEDKL
FT                   SNFSTCIPISVMTISNHAFLIIDNDIVCDPWLNFVGDLKDYCFANMKRKEYFGIRSDWT
FT                   CFTNSEVYDEDSTEFTIQFVNALGVGISGFSEIKLANQLMQSSSMASDLGEDPVISIPK
FT                   EFHRI"
FT   gene            340355..341203
FT                   /locus_tag="lpg0286"
FT   CDS_pept        340355..341203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0286"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /EC_number="1.-.-.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0286"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26393"
FT                   /db_xref="GOA:Q5ZYS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS5"
FT                   /protein_id="AAU26393.1"
FT                   /translation="MLLFLFKFWFDLTVNILYLIMMGERMNFLNNKIVMITGASSGIGQ
FT                   ACARLFAAQGARLILAARRVERLHELSSGLKHHNNQEHYILPLDVCKKDLVRQQIESLP
FT                   GQWNSIDVLINNAGLALDTLPLHQGILEHWDTMIDTNIKGLLYISRLILPGMLERNSGH
FT                   VINIGSIAGHECYPNGNVYSATKHAVHAISKSMRLDMLGSAVRVTEIAPGAVETEFSEV
FT                   RWKDKQRAIDFYKDFQPLMAEDVADAALYCATRPLHVDIEQMIIMPTVQASANHLSRKG
FT                   R"
FT   gene            complement(342005..342622)
FT                   /gene="efp"
FT                   /locus_tag="lpg0287"
FT   CDS_pept        complement(342005..342622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="lpg0287"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0287"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26394"
FT                   /db_xref="GOA:Q5ZYS4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYS4"
FT                   /protein_id="AAU26394.1"
FT                   /translation="MRTLAKIQQNLNYGAEMAVYSTNEFKNGLKVMVDDAPCSILDCEF
FT                   VKPGKGQAFTRIKIRNLKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEHWHFMVPD
FT                   TFEQYAVTENVLADAAQWLKEQDVCVVTLWNNEPIQVTPPNFVILAITETDPGLKGDTS
FT                   GGGGKPATLETGAVVRVPLFVQTGELIKVDTRKGEYVSRAKE"
FT   gene            342646..343626
FT                   /locus_tag="lpg0288"
FT   CDS_pept        342646..343626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0288"
FT                   /product="L-lysine 2,3-aminomutase, radical SAM domain
FT                   protein"
FT                   /function="Amino Acid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0288"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26395"
FT                   /db_xref="GOA:Q5ZYS3"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS3"
FT                   /protein_id="AAU26395.1"
FT                   /translation="MRDTSLSWQKILAQGFTSTTDLLDFLELPRSEGNLFAEKQFPSRI
FT                   PLGFAKRMQKGNPKDPLLLQVLAKEDELSEADDYVIDPLSESNTLIKGLLHKYHGRVLL
FT                   TLTGVCAVNCRYCFRRHFPYQANNPGRRGWKEVCAYIANDSSITEVILSGGDPLLAANL
FT                   VLEELLQSLEEISHIHTLRIHTRIPIVLPERIDKGLLDLLTNTRFKKVIVVHCNHPQEL
FT                   DESVLRACSDLKKAACYLLNQSVLLAGINDDAGILSKLSHALFDYGIMPYYLHLLDKVK
FT                   GSAHFDMPLLRAQSIYHQLQSLVPGYLLPRLAREEPGRSSKTLLI"
FT   gene            complement(343695..345779)
FT                   /gene="ppk"
FT                   /locus_tag="lpg0289"
FT   CDS_pept        complement(343695..345779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="lpg0289"
FT                   /product="polyphosphate kinase"
FT                   /function="Energy Metabolism"
FT                   /EC_number="2.7.4.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0289"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26396"
FT                   /db_xref="GOA:Q5ZYS2"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS2"
FT                   /protein_id="AAU26396.1"
FT                   /translation="MEFLMDTTLDNPDYYINREFSAIAFNQRVLMLANDERVPLLERMR
FT                   FLSICSSNLDEFFEIRVAGLKEKIAMSSGKLTIDGLRADEAFSQISHKAHALIDQLYNI
FT                   FNKQLLPALRKENIHFLETDQWTDDIHLWAKHYFKHEILPVISPIALDLAHPLPRLINK
FT                   SLNFIISLSGKDAFDRNINYAVVHAPRSIPRMIHLPSELCGDAHYFVYLSSIIKTHINS
FT                   LFPGMEISGCYSFRLTRNSDLFLREEEIDDLAKAVQREIFSRHYGHVVRLEIENKCPEK
FT                   IVDFLLQKYHLRHEDTYYCDGPVNLQRYMSAINSIDRPDLNYPAFTPQYPKFSKSQRNL
FT                   FNILDEQDILLHHPYQAFDLVIDFVRQAASDPNVLAINQTLYRTHSESVMVDALVNAAH
FT                   SGKEVTAVIELRARFDEESNLKLANKLHAAGILVLYGVVGYKTHAKMTLVVRRTHGKLK
FT                   RYVHLSTGNYHEQTAKRYTDLGLLTSEPTITSDAQLIFQQLTGLGKVVKLKALSHSPFT
FT                   LQKTLLQFIEQCSTAATGGIDTEIILKVNGLTDKVMIQALYKASQAGVKINLLVRGVCC
FT                   LKPGLPGVSENIRVLSFIGRFLEHHRVFYFRINEEEHYFCSSADLMERNLYNRIEIMFP
FT                   IYDEGCKKRIKNEIIKNYLKDNNNVWEMQSDGTYKHLMQNGGCAQEKLIALYEEEDKSI
FT                   "
FT   gene            complement(345808..347013)
FT                   /locus_tag="lpg0290"
FT   CDS_pept        complement(345808..347013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0290"
FT                   /product="lipoprotein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26397"
FT                   /db_xref="GOA:Q5ZYS1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS1"
FT                   /protein_id="AAU26397.1"
FT                   /translation="MKRIFFVVFLLCIETACNTAKNNPLPAQLADKALVPGFKEVRTEF
FT                   TRSDDPIIKKQSLERVKQLAKAYPDTMFHQKGSFSLLIISGGGDYGAFGAGLLNGWTKS
FT                   GSRPTFTTVTGISTGALIAPLAFAGPKYDATLKKVYTTITTKDVLSNKPVLWTLLTGGS
FT                   ALKGTKPLQDLIARHVDEKLLDDIAKGYYQGRRLYVGTSNLYSRKLVVWDMTRIAASKN
FT                   PERVQLFRKILLASASIPVVMPPVYFDVMANGKPYTEMHVDGSTTFAVFLSRLGSDIKT
FT                   AKKHFKLKQKPNVKIYVIRNNQNQFHYKVIKPKLLVIGKRAIESVTASQGAADVIFIYL
FT                   CALIEGVDFNLANVPNEFDSNSEELFDTQRMNQLYQIGYSKAVKGYPWQKIPPDVRALH
FT                   GD"
FT   gene            complement(347089..347622)
FT                   /locus_tag="lpg0291"
FT   CDS_pept        complement(347089..347622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0291"
FT                   /product="chromate transport protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0291"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26398"
FT                   /db_xref="GOA:Q5ZYS0"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYS0"
FT                   /protein_id="AAU26398.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   GPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAICFFVVR"
FT   gene            complement(347619..348296)
FT                   /locus_tag="lpg0292"
FT   CDS_pept        complement(347619..348296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0292"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26399"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR9"
FT                   /protein_id="AAU26399.1"
FT                   /translation="MPKQIKSSSVSKTENEILIMQRLVWNFEFSSEQTTPLTTLGHDAQ
FT                   DNLKWEKRYFWPTDQIIRLNTIDSSLLDLANYQKKHKEDYYYLLPDSDHNIKQRRNELL
FT                   YKPVIKQSGSALGFGSKIHLETPQTLPCHGDAGQLNRQELLKKIKEKGIVVFVKKEAFV
FT                   FKFPTTPTVKLELARLEVKDKVYFSACIEGRSLNLVETISVLLFGTQPSFEYVTFLKKT
FT                   LKI"
FT   gene            348415..350853
FT                   /locus_tag="lpg0293"
FT   CDS_pept        348415..350853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0293"
FT                   /product="long chain acyl-CoA dehydrogenase"
FT                   /function="Lipid Metabolism, Metabolism of Complex Lipids"
FT                   /EC_number="1.3.99.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0293"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26400"
FT                   /db_xref="GOA:Q5ZYR8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR8"
FT                   /protein_id="AAU26400.1"
FT                   /translation="MAIVFFLIYLAFTLVVLSRRINPLVWEIGSIIYLIPATFYFGFPW
FT                   IIGLFIWFFIIAAVLVVRVEPLRLFIGDYLYKTAGKSVPKLSKTEEEALNAGDTWLEQD
FT                   IFTGKPDWQKLSAVSTELTAEEQAFLDNETHTLCSMLDEWEISQEYDLSPKVWNYIKEK
FT                   GFLGLVIPKEFGGKGFSARAHSDIVMKIATRSRVAAVTVMVPNSLGPGELINYYGTDEQ
FT                   KAYYLPRLAKGVEIPCFALTEPGAGSDATSIQSEAIVVKKKIDGKSVLGLNITLDKRWI
FT                   TLAPVATLIGLAVNLKDPDGLLNGEGEEGITCLLIPRDTKNLEIGNRHLPADQPFMNGT
FT                   LRGKDIFVPIDTIIGGQKKAGSGWQMLVECLSIGRSISLPALGAGSSSISYLTTGAFAR
FT                   IRRQFNVEIAQFEGVEEKLAEIAGLNYLINSTRLLTVAAVNEHKKPSVASAITKYFNTE
FT                   LARITVNASMDVHAGRAIVVGPRNYLNSLYQSVPISITVEGANIMSRNLLIFGQGSMAC
FT                   HPFIRDEFYAISSENKEAFREIIWKHIHYFMQNFAKTICSAWTSGLFIAVPENSMKREY
FT                   KKLARLSYAYSWLADLSLIYLGGDLKRKERLSARLADGMSYLYMAMAALRNVQLNQDHP
FT                   DEQLHARWAVSYCFYHAQKSMIALCHNFPSKFLGFIARVVAFPFGQTMRYPSDKLDHQL
FT                   ARLMTGNNHYRDRLKKSVFLSGDPKQPVDRMEHALQLIIEADGLSKKVSDLKRYKWSKL
FT                   KEKLKEKVESGQLSQQEMEELLAVEDARWDAILVDEFTFDSMKKKTLHSVIEKMKSPLA
FT                   "
FT   gene            350967..351659
FT                   /locus_tag="lpg0294"
FT   CDS_pept        350967..351659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0294"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR7"
FT                   /protein_id="AAU26401.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTKAKLLPE
FT                   CNDMLEKIKEYAQFVKFKLLSSAQVWSGQERPTSDYQNTQENKAEFLASHLEGLPSGLK
FT                   LEVAIGDDAKILRGFSSNGKMVEGDQLKTMDGLLEGWLAKNSLAISGGAVVKIDNTGNQ
FT                   TKVDPQEIRQLINDSEKGVAKYFADKGVGMEVAQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
FT   gene            complement(351696..352358)
FT                   /locus_tag="lpg0295"
FT   CDS_pept        complement(351696..352358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0295"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /function="Carbohydrate Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0295"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26402"
FT                   /db_xref="GOA:Q5ZYR6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR6"
FT                   /protein_id="AAU26402.1"
FT                   /translation="MKTAMILAAGRGERLRPLTDKMPKALCTVRNKPLIEHHIINLANA
FT                   GFERLIINHAYLGGQIRQYIGNGKQWGLNVIYSPEPPGGLETGGGIVNALPLLGEEPFL
FT                   TVNADIYTDFDFAKLQLKNIDTFHLLLIPKNPSLLHHGDFGLINGSHLTNTNQAYTFSG
FT                   IACYNPKVFANCRQGRYSVTPLLRKYVEQNSATGSVHSGIWYDIGSFDRLQAANQFT"
FT   gene            complement(352355..353401)
FT                   /locus_tag="lpg0296"
FT   CDS_pept        complement(352355..353401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0296"
FT                   /product="hypothetical phosphotransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0296"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26403"
FT                   /db_xref="GOA:Q5ZYR5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR5"
FT                   /protein_id="AAU26403.1"
FT                   /translation="MKLLFIKMGVYQPHSVNKNGKYTMHERENALKEWLAQTIQQKDFV
FT                   LLPLAGDASFRRYFRIQYNGLTQVVMDAPPEKENIEPFLHIANVLDKIKIPVPDILAIN
FT                   KREGFLLLSDLGDQLLLNKLNHETVDNYYNQAMNLLLQIQKCPTDDPELPLFDKSFMLK
FT                   EMNLCLEWFLKAYLSLDLKQDELQLFQHTIEWIASEVATQPRVFIHRDYHSRNLMLVKN
FT                   KDSCLATIDFQDAMLGPVTYDLVSLLKDCYISWPREKVLEWVTYFHEQSPLASIYSLTD
FT                   FIRAFDLCGLQRHLKVLGVFCRLYLRDNKAGYLGDLPLTLKYALECAETYEELHPFFNF
FT                   LQKRVYLP"
FT   gene            353425..356094
FT                   /gene="ostA"
FT                   /locus_tag="lpg0297"
FT   CDS_pept        353425..356094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="lpg0297"
FT                   /product="organic solvent tolerance protein"
FT                   /function="Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0297"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26404"
FT                   /db_xref="GOA:Q5ZYR4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYR4"
FT                   /protein_id="AAU26404.1"
FT                   /translation="MLAVNMRFYKKLIISGFISFIALLRGLLYCHLKRLFKKWPESLFS
FT                   VKWILMAIGITACVLSLINYQGLAYSAALINEPIQACVIAREVDLTDDIRTKFAQCLGW
FT                   QADQSSPVCLGFYKPIAVTPLASPDEVRILADTASFYRTQRSTLSGHVEMQQGQRVVNA
FT                   QTAYVYRDPKTNEVTKIEFLNHVRYLEPDRMMIARKAVVYPQDKSGEVEDVLYRFNTNR
FT                   SNALLPAWGRASLIKRFANQDYFLKEATYTTCAPQDKAWAIEAESISIDNEKGKGIARN
FT                   AKLRIHEWPVLYTPYLSFPTNRDRKSGFLMPIVGYSNVGGADLGIPYYWNMAPNYDMTL
FT                   VPHLYTKRGLMLGGQFRYLTSKSTGTFNGNFLPKDKAFGRFLQDNEVEFPQIRGLSTNR
FT                   WEVNFVDSTQFLSDLQLNVNFQQVSDDYYLQDFSTNLASVTQRQLLRQADLTYTTENWT
FT                   FRGMGQSYQTLHPINEIPVSPVYERLPQLMARGYYDDLPFNAQFNILGQYDQFHWPNDS
FT                   WNIALNNMPQGPRFHLNPILSVPMMKPWGYVTPSVQFVENYYDISRNYTWGTSRANYNL
FT                   TIPRYSLDGGLYFERDLHLKGTYYIQTLEPRLFYLRVPYYNQTLIPVYDSGFMIFNVDQ
FT                   LFRTNRFSGFDRIGDANQLSYALTTRWLEDESGAEKANFSIGQIKYFSERRVQLCQSPT
FT                   GFCTDNPDTFGNLSSTFGTSPVASRAVYKFNPAWGITGDYIWDPATRATNNADLNLHYQ
FT                   PARNAIINGGYSYLVNGDVTQVRNNDTENNALHQAILSAAWPLSEKWSGIGAYSYNISK
FT                   NYSMMSFLGVQYDSCCWAMRILGGRIFRSLNEEFEPQYNNNIYLQILLKGLGSVASSDP
FT                   SGILNTYIPGYYDPFRRR"
FT   gene            356219..357559
FT                   /gene="surA"
FT                   /locus_tag="lpg0298"
FT   CDS_pept        356219..357559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="lpg0298"
FT                   /product="peptidyl-prolyl cis-trans isomerase D (SurA)"
FT                   /function="Toxin production / other pathogen functions"
FT                   /EC_number="5.2.1.8"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26405"
FT                   /db_xref="GOA:Q5ZYR3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYR3"
FT                   /protein_id="AAU26405.1"
FT                   /translation="MTKNNINCPKNVNEDYGMFKRIALVCALFSGVCFAEGKQLLDKVV
FT                   AIVNDNVITSSELNAQVELSKKQIIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNG
FT                   ITIENAEIDEAIEKIAASNHLNLSQMRDEITKQGISWQEYRQNIRKEMLISRVQQKAVG
FT                   KDIIVTNEQVEQYLKTSGRIENSNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNKI
FT                   KKGEDFSRLAIEESSGEFALEGGDLGERHLAELPEVFAKEVVHMKVGQVAGPIRAGNGF
FT                   HLIKLVAVGGENQRHVITQTHVRHILLKPDASMVPSEAIKQVNNIYRQIQSGKDFALMA
FT                   KQYSLDAASAVKGGDLGWVNPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARR
FT                   QKDDSEAFKKQQVRQFLQQRKFVEAVQNWQQHLRSQAYINIVDKDLA"
FT   gene            357556..358530
FT                   /gene="pdxA"
FT                   /locus_tag="lpg0299"
FT   CDS_pept        357556..358530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="lpg0299"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxA"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="1.1.1.262"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26406"
FT                   /db_xref="GOA:Q3V872"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V872"
FT                   /protein_id="AAU26406.1"
FT                   /translation="MNPLLISSGEPAGIGPDLCLALAETDLPVVILGDLSLLEARASEL
FT                   NLSIKFLEYSPHQSFKKKAGYLTVWPVPCAAPVISGELNPQNAAYVMELLTLGASLCSK
FT                   GEFSALVTAPVHKANINAAGITFTGHTEFFADFFEVETVVMMLACSQMKVALVTTHLPL
FT                   RMVPDAISSLLIIKVIQQLHHSLKHDFGIQSPKINVAGLNPHAGESGYLGREEIEIITP
FT                   ALNTLKNQGIDVLGPLPADTMFITNHINHCDAYVAMYHDQGLPVLKYAGFNEAVNITLG
FT                   LPIIRTSVDHGTALELAGKNKANPGSMLAAVKMAKDMALTRIK"
FT   gene            358532..359023
FT                   /locus_tag="lpg0300"
FT   CDS_pept        358532..359023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0300"
FT                   /product="dihydrofolate reductase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="1.5.1.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26407"
FT                   /db_xref="GOA:Q5ZYR2"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR2"
FT                   /protein_id="AAU26407.1"
FT                   /translation="MSLISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMG
FT                   RKTYESIGKPLPGRLNIVISQSIQSIPGVVVVDSLGRAIKETADASEVMIIGGAKIYSQ
FT                   AISMANRLYITRIHHQFTADVFFPKINELAWCCRSKEYRQHDDKNQYDMTFCVYERISI
FT                   "
FT   gene            complement(359030..359575)
FT                   /locus_tag="lpg0301"
FT   CDS_pept        complement(359030..359575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0301"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0301"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26408"
FT                   /db_xref="InterPro:IPR006616"
FT                   /db_xref="InterPro:IPR024518"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYR1"
FT                   /protein_id="AAU26408.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCRAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
FT   gene            359862..361336
FT                   /locus_tag="lpg0302"
FT   rRNA            359862..361336
FT                   /locus_tag="lpg0302"
FT                   /product="16S ribosomal RNA"
FT   gene            361478..361553
FT                   /locus_tag="lpg0303"
FT   tRNA            361478..361553
FT                   /locus_tag="lpg0303"
FT                   /product="tRNA-Ala"
FT   gene            361720..364621
FT                   /locus_tag="lpg0304"
FT   rRNA            361720..364621
FT                   /locus_tag="lpg0304"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(362950..363300)
FT                   /locus_tag="lpg0305"
FT   CDS_pept        complement(362950..363300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0305"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY06"
FT                   /protein_id="AAU26409.1"
FT                   /translation="MASSFSWKPGINDFSVPKGQNHFAPQSYGKPDLPSLPPYMQVPGQ
FT                   PTPGSPSLLRPHFTTYKKSRNINLVPIDYALQPRLRGRLTLLRLTSCRKPGTSGVWAFH
FT                   PHYRYSCQHSHF"
FT   gene            complement(363791..364132)
FT                   /locus_tag="lpg0306"
FT   CDS_pept        complement(363791..364132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26410"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY05"
FT                   /protein_id="AAU26410.1"
FT                   /translation="MALPFRTTGSLRPTFVPARAVTLAVKHPFAFTLLVRCPTVPRVPL
FT                   CSSVTLWEETAPVKLPIIHCPHPGLLDQVRTSITTGWYFKGGSMRTSVLTSQPPTYPTQ
FT                   SSSKSSAKL"
FT   gene            complement(363909..364190)
FT                   /locus_tag="lpg0307"
FT   CDS_pept        complement(363909..364190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0307"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26411"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY04"
FT                   /protein_id="AAU26411.1"
FT                   /translation="MNSWAVSACYPRSTFYPLSDGPSIQNHRITKTNFRSCSSRHSRSQ
FT                   APFCLYTLGTMSDRTEGTFVLLRYSLGGDRPSQTTHHTLSSSRITGPS"
FT   gene            364723..364840
FT                   /locus_tag="lpg0309"
FT   rRNA            364723..364840
FT                   /locus_tag="lpg0309"
FT                   /product="5S ribosomal RNA"
FT   gene            364946..365021
FT                   /locus_tag="lpg0310"
FT   tRNA            364946..365021
FT                   /locus_tag="lpg0310"
FT                   /product="tRNA-Thr"
FT   gene            365094..365178
FT                   /locus_tag="lpg0311"
FT   tRNA            365094..365178
FT                   /locus_tag="lpg0311"
FT                   /product="tRNA-Tyr"
FT   gene            365199..365272
FT                   /locus_tag="lpg0312"
FT   tRNA            365199..365272
FT                   /locus_tag="lpg0312"
FT                   /product="tRNA-Gly"
FT   gene            365325..365400
FT                   /locus_tag="lpg0313"
FT   tRNA            365325..365400
FT                   /locus_tag="lpg0313"
FT                   /product="tRNA-Thr"
FT   gene            365435..366625
FT                   /gene="tuf2"
FT                   /locus_tag="lpg0314"
FT   CDS_pept        365435..366625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf2"
FT                   /locus_tag="lpg0314"
FT                   /product="elongation factor Tu (EF-Tu)"
FT                   /function="Translation"
FT                   /EC_number="3.6.5.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0314"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26412"
FT                   /db_xref="GOA:Q5ZYP5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP5"
FT                   /protein_id="AAU26412.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            366685..366760
FT                   /locus_tag="lpg0315"
FT   tRNA            366685..366760
FT                   /locus_tag="lpg0315"
FT                   /product="tRNA-Trp"
FT   gene            366774..367145
FT                   /gene="secE"
FT                   /locus_tag="lpg0316"
FT   CDS_pept        366774..367145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="lpg0316"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0316"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26413"
FT                   /db_xref="GOA:Q5ZYQ6"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYQ6"
FT                   /protein_id="AAU26413.1"
FT                   /translation="MKSSNENQGKMKDIMSWLAIILATAGAFVCTYYYTFTGPIQSIIW
FT                   LAWLILILFLGYLTTTGKRVFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFI
FT                   LWGVDSIMMWAIAKLTHLG"
FT   gene            367142..367696
FT                   /gene="nusG"
FT                   /locus_tag="lpg0317"
FT   CDS_pept        367142..367696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="lpg0317"
FT                   /product="transcription antitermination protein NusG"
FT                   /function="Transcription"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26414"
FT                   /db_xref="GOA:Q5ZYQ5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYQ5"
FT                   /protein_id="AAU26414.1"
FT                   /translation="MNMVEENKAKQWYVVHAYSGYENFVMREITSRAKHHNLQDKIGEV
FT                   VVPSEEVVEMRSGQKRKSTRKFFPGYVLVHMVMDDQTWHMVRGIPRVLGFIGGTSQTPT
FT                   PISDKEAQAIMQRVEDGVTKPRPKILFEPGEVIRVKEGPFVDFNGVVEEVNYEKNRLRV
FT                   AVLIFGRSTPVELEFSQVEKT"
FT   gene            367807..368241
FT                   /gene="rplK"
FT                   /locus_tag="lpg0318"
FT   CDS_pept        367807..368241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="lpg0318"
FT                   /product="50S ribosomal protein L11"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26415"
FT                   /db_xref="GOA:Q5ZYQ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYQ4"
FT                   /protein_id="AAU26415.1"
FT                   /translation="MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAA
FT                   TQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVS
FT                   QLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE"
FT   gene            368251..368946
FT                   /gene="rplA"
FT                   /locus_tag="lpg0319"
FT   CDS_pept        368251..368946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="lpg0319"
FT                   /product="50S ribosomal protein L1"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26416"
FT                   /db_xref="GOA:Q5ZYQ3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYQ3"
FT                   /protein_id="AAU26416.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
FT   gene            369119..369652
FT                   /gene="rplJ"
FT                   /locus_tag="lpg0320"
FT   CDS_pept        369119..369652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="lpg0320"
FT                   /product="50S ribosomal protein L10"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26417"
FT                   /db_xref="GOA:Q5ZYQ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYQ2"
FT                   /protein_id="AAU26417.1"
FT                   /translation="MTLNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEA
FT                   RKSGVYLRVVRNTLTRRAFKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFE
FT                   KLEIRALSVGGKVYNANQIDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLAR
FT                   TLAAVKDKKAGNPA"
FT   gene            369683..370063
FT                   /gene="rplL"
FT                   /locus_tag="lpg0321"
FT   CDS_pept        369683..370063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="lpg0321"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26418"
FT                   /db_xref="GOA:Q5ZYQ1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYQ1"
FT                   /protein_id="AAU26418.1"
FT                   /translation="MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAP
FT                   AAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGV
FT                   SKDEAASIKKELEEAGATVEVK"
FT   gene            370155..374261
FT                   /gene="rpoB"
FT                   /locus_tag="lpg0322"
FT   CDS_pept        370155..374261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="lpg0322"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /function="Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0322"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26419"
FT                   /db_xref="GOA:Q5ZYQ0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYQ0"
FT                   /protein_id="AAU26419.1"
FT                   /translation="MAVAEAKPQYSHAEKKRFRKSFGKQTDIMPIPNLLEIQLKSYRDF
FT                   LQTDTKLSEQLNTGLHAAFSSVFPIESFSGNARLEYVGYKLGEPAFDVRECKLRGLTYS
FT                   APLRVKIRLVVLDKDASDDPKPIKDIREQDVFMGEIPLMTDVGTFVVNGTERVVVSQLH
FT                   RSPGVIFEHDKGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVYVRIDRRRKLPVTIL
FT                   LRALGYEAEDILSEFFETTHCHLKNGEYHIDLIPQRLRGEIASFDIHVPETGELIVEQG
FT                   RRITARHIKQMEKSQMQDLVVPRDYLIGKTLAKNIIDTSTGEFLAQANDEITEELLDAM
FT                   ANHGILQIDMIYTNDLDHGSYISDTLKIDPTGSQLEALVEIYRMMRPGEPPTKEAAEAL
FT                   FKNLFFVEERYDLSAVGRMKFNRRVGIKSDEGPGTLTKEDILSVIKTLIDIRNGIGMVD
FT                   DIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVESENLMPQDLINAKPVSAAI
FT                   KEFFGSSQLSQFMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPI
FT                   ETPEGPNIGLINSLSVYARTNEYGFIETPCRKVVNGRVTDEVEYLSAIEEVDQYIAQSN
FT                   VELDAQGNILADLVPCRHQNEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPTLRSEKPLVGTGMERIVASDSGVSVVAKRGGVIDLVDASRIVVRVND
FT                   DETTAGETGVDIYNLTKYFRSNQDTCINQRPIVSTGDRIQRGDVLADGPCTDMGELALG
FT                   QNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIARDTKLGTEEITADIPN
FT                   VGESALSNLDESGVVYIGAEVKAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKD
FT                   SSLRVPSGMNGTVIDVQVFTRDGLEKDARAKSIEEEHLARVRKDLIDERRIREEDIYHR
FT                   VSHLLLDKVATGGPGSLKPGSKITQDYLDKVEREKWFDIRIEDDAISQQLEQLSKQLEL
FT                   LTKEMEKRFNDSRKKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIV
FT                   VPVEDMPHMEDGTAVDIVLNPLGVPSRMNIGQVLETHLGLAAKGLGRKIAQMLDEKQTP
FT                   EAIKAYLEKIYNHDGVQRVNLKCLNDDELMTLADNLRAGVPMATPVFDGATEQEIKSML
FT                   QLADLPADGKTVLIDGRTGNKFDNPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVGGRTKIYKNIVDGDHRMDP
FT                   GMPESFNVLLKEIRALGIDIELEHD"
FT   gene            374308..378555
FT                   /gene="rpoC"
FT                   /locus_tag="lpg0323"
FT   CDS_pept        374308..378555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="lpg0323"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /function="Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0323"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26420"
FT                   /db_xref="GOA:Q5ZYP9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP9"
FT                   /protein_id="AAU26420.1"
FT                   /translation="MATLSNDPMKKAPVMSDLLGILKQQGQSEEFDAIKIALASPELIR
FT                   SWSYGEVKKPETINYRTFKPERDGLFCAKTFGPVKDYECLCGKYKRLKHRGVICEKCGV
FT                   ELALAKVRRERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFEAFVVVDP
FT                   GMTELERGQLLNDEAYLDAMEQYGDEFDARMGAEAIRDLLRQIDLEDEIRNLREELPTT
FT                   NSETKIKKITKRLKLLEAFYESGNKPEWMIMDVLPVLPPDLRPLVPLDGGRFATSDLND
FT                   LYRRVINRNNRLKRLLDLNAPDIIVRNEKRMLQESVDALLDNGRRGRAITGTNKRPLKS
FT                   LADMIKGKQGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKKMALELFKPFIFSKL
FT                   EFRGLATTIKAAKKMVEREESVVWDILDDVIREHPILLNRAPTLHRLGIQAFEPVLIEG
FT                   KAIQLHPLVCTAYNADFDGDQMAVHVPLTLEAQLEARSLMMSTNNILSPASGEPIIVPS
FT                   QDVVLGLYYLTREKVNALGEGKIYSSAQEAQNFYEAGHLDIHAKIKIRMPKEDGETGYH
FT                   LVETTVGRAILAEILPKGMPFDYINRTMTKKVISKVIDSCYRKFGLKETVIFADQLMYT
FT                   GFKYATRSGASIGIEDMEIPDDKASIIEHADNEVREIESQFRSGLVTNGERYNKVIDIW
FT                   SRTNELVAKSMMSKIATEEVTDAKGNKVRQESFNPIFMMADSGARGSAAQIRQLAGMRG
FT                   LMAAPDGSIIETPITANFREGLNVFQYFISTHGARKGLADTALKTANSGYLTRRLVDVA
FT                   QDVVITEDDCGTDTGILMQPLIEGGDIVEPLHERVLGRVVASDVYIPTQTEPVVKAGTL
FT                   LDEEWVEKLEKHGVDQVMVRSPITCQTRFGLCAKCYGRDLARGHLVNTGEAVGIIAAQS
FT                   IGEPGTQLTMRTFHIGGAASRATAANNIQIKTKGVIRLHNIKTVTHENKNLVAVSRSGE
FT                   VTIVDEFGRERERYKVPYGAVISAQDNSPVEAGQVIATWDPHTHPVISEVSGRLKFVDL
FT                   IDGITMNRQTDELTGLSNIVIIDAKQRSAAGRDLRPMVKLVTDEGDDIYLAGTNVPAQY
FT                   YLPVDAIVNFEDGSLVGIGDVIARIPQERSKTRDITGGLPRVADLFEARKPKDSAVMAE
FT                   VSGLVNFGKETKGKRRLIINVSEDQCHEELIPKWRHISVFEGEHVERGEIIAEGALNPH
FT                   DILRLLGVGALANYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKRVITFAGDSKFLVG
FT                   EQVEESAMLQENDKLLAEGKQIARGTPILLGITKASLATESFISAASFQETTRVLTEAA
FT                   VSGKVDELRGLKENVMVGRLIPAGTGYTYHQSRKAKRARVAAGGDSSATHTVTASDVEH
FT                   ALSEALNADNHEH"
FT   gene            378669..379049
FT                   /locus_tag="lpg0324"
FT   CDS_pept        378669..379049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0324"
FT                   /product="30S ribosomal protein S12"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0324"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26421"
FT                   /db_xref="GOA:Q5ZYP8"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP8"
FT                   /protein_id="AAU26421.1"
FT                   /translation="MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKP
FT                   NSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVNDRKQGRSKYGTKKPKDKK"
FT   gene            379070..379597
FT                   /gene="rpS7"
FT                   /locus_tag="lpg0325"
FT   CDS_pept        379070..379597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpS7"
FT                   /locus_tag="lpg0325"
FT                   /product="30S ribosomal protein S7"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0325"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26422"
FT                   /db_xref="GOA:Q5ZYP7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP7"
FT                   /protein_id="AAU26422.1"
FT                   /translation="MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYG
FT                   ALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQ
FT                   VPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMA
FT                   KANQAFAHFRWN"
FT   gene            379612..381696
FT                   /gene="fusA"
FT                   /locus_tag="lpg0326"
FT   CDS_pept        379612..381696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="lpg0326"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /function="Translation"
FT                   /EC_number="3.6.5.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26423"
FT                   /db_xref="GOA:Q5ZYP6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="PDB:5TY0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP6"
FT                   /protein_id="AAU26423.1"
FT                   /translation="MATPLKLYRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGA
FT                   ATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVL
FT                   DGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGST
FT                   PVVLQLPIGAEEEFKGVIDLIKMKAIHWDEENKGMTFKYVDIPADLKSTCEEYRAHIIE
FT                   AAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVI
FT                   EYLPSPTDIPDIQGVDEHGDVIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILK
FT                   SGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKV
FT                   VILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMG
FT                   ELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKI
FT                   EPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFH
FT                   EVDSSEMAFKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQ
FT                   GMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAIIKKQ
FT                   "
FT   gene            381717..382907
FT                   /gene="tufB"
FT                   /locus_tag="lpg0327"
FT   CDS_pept        381717..382907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="lpg0327"
FT                   /product="translation elongation factor Tu (EF-Tu)"
FT                   /function="Translation"
FT                   /EC_number="3.6.5.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26424"
FT                   /db_xref="GOA:Q5ZYP5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP5"
FT                   /protein_id="AAU26424.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            382913..383230
FT                   /gene="rpsJ"
FT                   /locus_tag="lpg0328"
FT   CDS_pept        382913..383230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="lpg0328"
FT                   /product="30S ribosomal protein S10"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26425"
FT                   /db_xref="GOA:Q5ZYP4"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP4"
FT                   /protein_id="AAU26425.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
FT   gene            383265..383915
FT                   /gene="rplC"
FT                   /locus_tag="lpg0329"
FT   CDS_pept        383265..383915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="lpg0329"
FT                   /product="50S ribosomal protein L3"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0329"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26426"
FT                   /db_xref="GOA:Q5ZYP3"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP3"
FT                   /protein_id="AAU26426.1"
FT                   /translation="MMIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDG
FT                   YSAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFT
FT                   AGQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKM
FT                   AGHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
FT   gene            383912..384520
FT                   /locus_tag="lpg0330"
FT   CDS_pept        383912..384520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0330"
FT                   /product="50S ribosomal protein L4"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26427"
FT                   /db_xref="GOA:Q5ZYP2"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP2"
FT                   /protein_id="AAU26427.1"
FT                   /translation="MMEITTIDTKSKLKLNKEIFAYTYNEGLVHQAVVTFMNNARSGNS
FT                   AQKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTFASKKRDYSQKLNKKMYKR
FT                   ALRSIISELCRTGNLVVVSDFQCDNHKTKDFLKKMNQMEISNALIIMSEVGENEYLGSR
FT                   NLIDYDICDVTTIDPVSLLRFEKVVVTEAAIKKIEEQLQ"
FT   gene            384535..384813
FT                   /gene="rplW"
FT                   /locus_tag="lpg0331"
FT   CDS_pept        384535..384813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="lpg0331"
FT                   /product="50S ribosomal protein L23"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0331"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26428"
FT                   /db_xref="GOA:Q5ZYP1"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP1"
FT                   /protein_id="AAU26428.1"
FT                   /translation="MMVLREPHTSEKATVMADKFKQFTFKVLKNATKTEIKLAVEHIFN
FT                   VKVKSVSVVNVKGKSKRFKQTSGKRSDWKKAFVSLHADQDIDFTVTE"
FT   gene            384825..385652
FT                   /locus_tag="lpg0332"
FT   CDS_pept        384825..385652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0332"
FT                   /product="50S ribosomal protein L2"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26429"
FT                   /db_xref="GOA:Q5ZYP0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYP0"
FT                   /protein_id="AAU26429.1"
FT                   /translation="MALLKSKPTSPGKRGEIRVVHHDIYKGKPHAALVEKLKKTGGRNN
FT                   QGRITVRHIGGGQRQKYRIIDFKRNKDGILGRVERLEYDPNRTALIALISYKDGEKRYI
FT                   IAPSNLEVGATIQSGADSPISVGNCLPLKNIPVGTTIHCVEMKPGKGAQMLRSAGCSGQ
FT                   LVAKEGVYATLRLRSGEMRKIHVLCRAVIGEVSNSEHNLRALGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGLPTKGYKTRSNKRTDTFIVRGRKKK"
FT   gene            complement(385874..386176)
FT                   /locus_tag="lpg0333"
FT   CDS_pept        complement(385874..386176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0333"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0333"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26430"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYN9"
FT                   /protein_id="AAU26430.1"
FT                   /translation="MPTFRSSISAPLLFSAFAIADSNNLSINLAPFFGVNLRTSSAPDT
FT                   FILRIISATNLPFCADKGAPFNLAVTSIISSYLPLAFLSPEWPLNVRVMANSPNL"
FT   gene            385956..386294
FT                   /gene="rplV"
FT                   /locus_tag="lpg0334"
FT   CDS_pept        385956..386294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="lpg0334"
FT                   /product="50S ribosomal protein L22"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26431"
FT                   /db_xref="GOA:Q5ZYN8"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN8"
FT                   /protein_id="AAU26431.1"
FT                   /translation="MMEVTAKLKGAPLSAQKGRLVADMIRNMNVSGALDVLKFTPKKGA
FT                   KLMLKLLESAIANAENNNGADIDDLKVGMVCVDEATTLKRISPRAKGRANRICKRTCHI
FT                   TIKVSDEE"
FT   gene            386297..386953
FT                   /gene="rpsC"
FT                   /locus_tag="lpg0335"
FT   CDS_pept        386297..386953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="lpg0335"
FT                   /product="30S ribosomal protein S3"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0335"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26432"
FT                   /db_xref="GOA:Q5ZYN7"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN7"
FT                   /protein_id="AAU26432.1"
FT                   /translation="MGQKVNPIGIRLGIIKDWNSKWFAGKRYAEFLIQDIKLRNDLKKK
FT                   LMAAAVSKILIERPANNAVVTILTARPGVIIGKKGGGIETLRKEISDNLGVPVHLNIEE
FT                   VKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKAGAKGIKICVSGRLGGAEIAR
FT                   SEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIFKGEILPQKKRSTESAQ"
FT   gene            386970..387383
FT                   /gene="rplP"
FT                   /locus_tag="lpg0336"
FT   CDS_pept        386970..387383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="lpg0336"
FT                   /product="50S ribosomal protein L16/(L10E)"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0336"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26433"
FT                   /db_xref="GOA:Q5ZYN6"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN6"
FT                   /protein_id="AAU26433.1"
FT                   /translation="MLQPKRTKYRKQMKGRNRGLALRGSKISFGEFGLKAVERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLF
FT                   EMEGVSKELAMEAFDLAKAKLPFKVMFEERTVM"
FT   gene            387383..387577
FT                   /gene="rpmC"
FT                   /locus_tag="lpg0337"
FT   CDS_pept        387383..387577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="lpg0337"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26434"
FT                   /db_xref="GOA:Q5ZYN5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN5"
FT                   /protein_id="AAU26434.1"
FT                   /translation="MKKIDELRNMSVEELQNELLSLRKDQFNLRMKKASGSLDKTHLIT
FT                   MVRKSVAKVKTILTEKAGK"
FT   gene            387579..387833
FT                   /gene="rpsQ"
FT                   /locus_tag="lpg0338"
FT   CDS_pept        387579..387833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="lpg0338"
FT                   /product="30S ribosomal protein S17"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26435"
FT                   /db_xref="GOA:Q5ZYN4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN4"
FT                   /protein_id="AAU26435.1"
FT                   /translation="MSTNSESNARTMIGKVVSDKMDKTIVVMIERTVKHPKYGKIMKRR
FT                   TKLHAHDENQVCRVGNTVKIRESRPLSKTKSWVLVEVIS"
FT   gene            387922..388287
FT                   /gene="rplN"
FT                   /locus_tag="lpg0339"
FT   CDS_pept        387922..388287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="lpg0339"
FT                   /product="50S ribosomal protein L14"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26436"
FT                   /db_xref="GOA:Q5ZYN3"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN3"
FT                   /protein_id="AAU26436.1"
FT                   /translation="MIQMQTVLEVADNSGARKVMCIKVLGGSHRRYARVGDVIKVSVKD
FT                   AIPRSKVKKGAVMRAVVVRTAQGVRRDDGSLIRFDDNAAVLLNNQNEPIGTRIFGPVTR
FT                   ELRERFMKIISLAAEVL"
FT   gene            388300..388629
FT                   /gene="rplX"
FT                   /locus_tag="lpg0340"
FT   CDS_pept        388300..388629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="lpg0340"
FT                   /product="50S ribosomal protein L24"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26437"
FT                   /db_xref="GOA:Q5ZYN2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN2"
FT                   /protein_id="AAU26437.1"
FT                   /translation="MKRIKSGDEVIVIAGKSKGHIGKVLRVIDDAVVVEGGNLIKKHIK
FT                   PNPQKPENKGGIIAREAPLHVSNVAHYNPVTKKADKVGFKYLESNGVSKKVRYYKSNNE
FT                   IIDRI"
FT   gene            388636..389196
FT                   /locus_tag="lpg0341"
FT   CDS_pept        388636..389196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0341"
FT                   /product="50S ribosomal protein L5"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0341"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26438"
FT                   /db_xref="GOA:Q5ZYN1"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN1"
FT                   /protein_id="AAU26438.1"
FT                   /translation="MIEMARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGE
FT                   AVGDKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLD
FT                   RLISITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSA
FT                   KTNEEAKALLEAFNLPLKDKDRK"
FT   gene            389224..389511
FT                   /gene="rpsN"
FT                   /locus_tag="lpg0342"
FT   CDS_pept        389224..389511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="lpg0342"
FT                   /product="30S ribosomal protein S14"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0342"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26439"
FT                   /db_xref="GOA:Q5ZYN0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYN0"
FT                   /protein_id="AAU26439.1"
FT                   /translation="MLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQAKLAKL
FT                   PVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW"
FT   gene            389540..389929
FT                   /gene="rpsH"
FT                   /locus_tag="lpg0343"
FT   CDS_pept        389540..389929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="lpg0343"
FT                   /product="30S ribosomal protein S8"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26440"
FT                   /db_xref="GOA:Q5ZYM9"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM9"
FT                   /protein_id="AAU26440.1"
FT                   /translation="MHDPIADMLTRIRNGQQAKHQQVTLVSSKLKEEIARVLKEEGYIQ
FT                   DFFIETLPNGLKSITLKLKYYHGRPVIEFIKRISRPGLRVYKSYKDLHSIPGFGVAILS
FT                   TSKGIMTHVSAKVKGVGGEVICEVA"
FT   gene            389947..390486
FT                   /gene="rplF"
FT                   /locus_tag="lpg0344"
FT   CDS_pept        389947..390486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="lpg0344"
FT                   /product="50S ribosomal protein L6/(L9E)"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26441"
FT                   /db_xref="GOA:Q5ZYM8"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM8"
FT                   /protein_id="AAU26441.1"
FT                   /translation="MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQH
FT                   SKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKS
FT                   ISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKG
FT                   VKYAGEQIVRKEAKKK"
FT   gene            390443..390856
FT                   /gene="rplR"
FT                   /locus_tag="lpg0345"
FT   CDS_pept        390443..390856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="lpg0345"
FT                   /product="50S ribosomal protein L18"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0345"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26442"
FT                   /db_xref="GOA:Q5ZYM7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM7"
FT                   /protein_id="AAU26442.1"
FT                   /translation="MLESRLFVKKLRRNKVLTMNKQNARHRRGLKAKALIRKTGRSRLV
FT                   VYRSGVHIYSQIVKSDQLGDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKA
FT                   AGITQVAFDRAGYKYHGRVKALAEGAREAGLDF"
FT   gene            390866..391372
FT                   /gene="rpsE"
FT                   /locus_tag="lpg0346"
FT   CDS_pept        390866..391372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="lpg0346"
FT                   /product="30S ribosomal protein S5"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0346"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26443"
FT                   /db_xref="GOA:Q5ZYM6"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM6"
FT                   /protein_id="AAU26443.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
FT   gene            391375..391560
FT                   /gene="rpmD"
FT                   /locus_tag="lpg0347"
FT   CDS_pept        391375..391560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="lpg0347"
FT                   /product="50S ribosomal protein L30/(L7E)"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0347"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26444"
FT                   /db_xref="GOA:Q5ZYM5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM5"
FT                   /protein_id="AAU26444.1"
FT                   /translation="MGKKIKITLVKSTIGRKPKHVAIAKQLGLGKTNSSVVHSDTPAIR
FT                   GLVNEINYLLLVEESA"
FT   gene            391560..391994
FT                   /gene="rplO"
FT                   /locus_tag="lpg0348"
FT   CDS_pept        391560..391994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="lpg0348"
FT                   /product="50S ribosomal protein L15"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26445"
FT                   /db_xref="GOA:Q5ZYM4"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM4"
FT                   /protein_id="AAU26445.1"
FT                   /translation="MNLNTLSPDPGSRPSRRRVGRGIGSGLGKTCGKGHKGQKSRAGGY
FT                   HKINFEGGQMPIQRRLPKMGFKSRVGRTIDEVSLGELAKLNDEVIDLVALRKAGLINNS
FT                   IKDVKVILSGELTAAIKLKGLRVTKGARSAIESLGGSIEE"
FT   gene            391991..393325
FT                   /gene="secY"
FT                   /locus_tag="lpg0349"
FT   CDS_pept        391991..393325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="lpg0349"
FT                   /product="preprotein translocase SecY"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26446"
FT                   /db_xref="GOA:Q5ZYM3"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYM3"
FT                   /protein_id="AAU26446.1"
FT                   /translation="MTMKNQKHNGSKPRGGLAELKSRLMFVVLGILVYRLGAHIPVPGL
FT                   DPAKLANFFSEQQNTIFGLFNMFSGGALSRVTVFAIGIMPYISASIIIQLFSVVSPKLE
FT                   QLKKEGESGRRKINQYTRYLTLLLSIFQSMGMARWLASQQIAMQPDFSFYFTAVVTLVT
FT                   GTMFLMWLGEQITEKGVGNGISLIIFSGIVSSMPNAIGSVLQQVKEGQMQALTLVIIAA
FT                   VVIVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAAQTSHLPLKINMSGVIPPIFASSII
FT                   LLPATLAQFFSQTKGLGWLSDVGMALSPGQPLYLIVYAAAILFFAFFYAALVFNPKDTA
FT                   DNLKKSGAYIPGIRPGEQTTKYIDSVMTRLTLVGAIYLVLVCLLPQILMYTWHVPFYFG
FT                   GTSLLIIVVVIMDFVAQVQAHLMTQQYDSLLKKANFRGTKLPGLL"
FT   gene            393342..393455
FT                   /gene="rpmJ"
FT                   /locus_tag="lpg0350"
FT   CDS_pept        393342..393455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="lpg0350"
FT                   /product="50S ribosomal protein L36"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0350"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26447"
FT                   /db_xref="GOA:Q5ZYM2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM2"
FT                   /protein_id="AAU26447.1"
FT                   /translation="MKVRASVKRICRNCKIIKRSGTIRVICKDARHKQKQG"
FT   gene            393533..393889
FT                   /gene="rpsM"
FT                   /locus_tag="lpg0351"
FT   CDS_pept        393533..393889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="lpg0351"
FT                   /product="30S ribosomal protein S13"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0351"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26448"
FT                   /db_xref="GOA:Q5ZYM1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM1"
FT                   /protein_id="AAU26448.1"
FT                   /translation="MARIAGVNIPDHKHVVIALTAIYGIGKTTSLKLCKTVDIDPSVKV
FT                   SQLSDAQLESLRTEIAKITVEGDLRRVVTMNIKRLMDLGCYRGLRHRRGLPLRGQRTKT
FT                   NARTRKGRRKGTSS"
FT   gene            393913..394311
FT                   /gene="rpsK"
FT                   /locus_tag="lpg0352"
FT   CDS_pept        393913..394311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="lpg0352"
FT                   /product="30S ribosomal protein S11"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26449"
FT                   /db_xref="GOA:Q5ZYM0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYM0"
FT                   /protein_id="AAU26449.1"
FT                   /translation="MAITKSKQQKTRKKVKRVVSDGIVHIHASFNNTIVTFTDRQGNAL
FT                   CWATSGGSGFRGSRKSTPYAAQVATERAAAVAKEYGMKSVAVFVHGPGPGRESTIRELI
FT                   TQDFKIVEITDVTGIPHNGCKPPKKRRV"
FT   gene            394328..394948
FT                   /gene="rpsD"
FT                   /locus_tag="lpg0353"
FT   CDS_pept        394328..394948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="lpg0353"
FT                   /product="30S ribosomal protein S4"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0353"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26450"
FT                   /db_xref="GOA:Q5ZYL9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYL9"
FT                   /protein_id="AAU26450.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTVSVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
FT   gene            394967..395959
FT                   /gene="rpoA"
FT                   /locus_tag="lpg0354"
FT   CDS_pept        394967..395959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="lpg0354"
FT                   /product="DNA-directed RNA polymerase alpha subunit RpoA"
FT                   /function="Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0354"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26451"
FT                   /db_xref="GOA:Q5ZYL8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYL8"
FT                   /protein_id="AAU26451.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQITLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHDD
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
FT   gene            395978..396361
FT                   /gene="rplQ"
FT                   /locus_tag="lpg0355"
FT   CDS_pept        395978..396361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="lpg0355"
FT                   /product="50S ribosomal protein L17"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0355"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26452"
FT                   /db_xref="GOA:Q5ZYL7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYL7"
FT                   /protein_id="AAU26452.1"
FT                   /translation="MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEHELIRTTLPKAKDLR
FT                   RYIEPLITVSKSDSVASRRRAFDILRSKSAVGKLFTDLGPRFAKRPGGYIRIIKCGYRD
FT                   GDNAPMAIVELMDRPVSSDDTEE"
FT   gene            complement(396429..396917)
FT                   /gene="ssb"
FT                   /locus_tag="lpg0356"
FT   CDS_pept        complement(396429..396917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="lpg0356"
FT                   /product="single strand binding protein"
FT                   /function="Replication and Repair"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26453"
FT                   /db_xref="GOA:Q5ZYL6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL6"
FT                   /protein_id="AAU26453.1"
FT                   /translation="MISMARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKD
FT                   KTTGEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEI
FT                   VASDIQMLDSKGSSATNYDDMPSFQGTSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
FT   gene            complement(396992..398359)
FT                   /locus_tag="lpg0357"
FT   CDS_pept        complement(396992..398359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0357"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0357"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26454"
FT                   /db_xref="GOA:Q5ZYL5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL5"
FT                   /protein_id="AAU26454.1"
FT                   /translation="MKYSWNKTVFPIAAIFSFRLLGLFLLIPVFTLYATNLKGATPTLI
FT                   GLALGSYGLAQGLLQIPFGMLSDKLGRKPMIAIGLLLFAGGSLLGAVTHSIAGMITARI
FT                   LQGAGAIGSVLIALLADLTLDEQRTKAMAIVGITIGTSFSLAMIISPALTHYYGLSGVF
FT                   YLTAALAVLGIMILYLIIPNPSKEQFHADSEPSLSLIKPVVTDQHLQRLNFGIFCQHFI
FT                   LTATFFAIPMLLKYQIENGHLHQQWHFYLPLMLFSFILMVPFIIISERKKRLKTVFVIS
FT                   VLLTTFTQGLLVLASQNWYWFCILMFVYFVSFNVLEATLPSLVSKLASPGSKGTAMGIY
FT                   STSQFLGIFFGGSLAGILYQWYDNQAIFLINMILSCLWFIISLSMKSNVYFSTLILPFT
FT                   ANNEESKLVVNQLLKVAGIKEVILSKDENTLYVRVDNEEYSTGSAEKILHQSTIYQ"
FT   gene            398521..399279
FT                   /locus_tag="lpg0358"
FT   CDS_pept        398521..399279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0358"
FT                   /product="glucose-1-dehydrogenase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0358"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26455"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL4"
FT                   /protein_id="AAU26455.1"
FT                   /translation="MSSLVFSGKVGLITGGARGIGKATALKLAQSGCDIAIVYYNSSDE
FT                   AQSLVNEITGMGRKAVALQADVADCQSVKEMFSQFREHFKHLNFLVSNAASGVLKPALK
FT                   MSTKHWRWCLETNALALNHLVTEGLALMPKNSRVIALSSLGASRAIPNYAFIGASKAAL
FT                   EALVRSLSLELASYGITVNTVSAGVVDTDALKHFPNREQLLDEYQAHALADRALTPEDV
FT                   ANAIYLLCLPEAAMINAHTLYVDAGYSQVG"
FT   gene            399350..399763
FT                   /gene="acpP"
FT                   /locus_tag="lpg0359"
FT   CDS_pept        399350..399763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="lpg0359"
FT                   /product="acyl carrier protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26456"
FT                   /db_xref="GOA:Q5ZYL3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL3"
FT                   /protein_id="AAU26456.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
FT   gene            399760..400659
FT                   /gene="fabA"
FT                   /locus_tag="lpg0360"
FT   CDS_pept        399760..400659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="lpg0360"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /EC_number="4.2.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26457"
FT                   /db_xref="GOA:Q5ZYL2"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL2"
FT                   /protein_id="AAU26457.1"
FT                   /translation="MMRFLFVDRIVQLSPGEWIKGIKHVTRDDAYLTTDDHGRLCFMPS
FT                   LIGETLGQLAAWNVMQHNHFTARPVAGVVSSARLYRPAYVGETILLESNIDSLDEKAVQ
FT                   YHSIAKVGNDIIFTIDGALGPMLPMTEFISTEVIRQQFAEIYRPGDWSSVLALSSPVLI
FT                   EENCSDCGMINSSMQFDRILASQPGISLIAEKRITRSASYFPDHFPKRPVLPMTVLLEC
FT                   KLNLAKEFIARAKYDRAYRISELRKIKMNEFVHPGDVVVCQVKVKQQMDDELILSYRCE
FT                   VDGKRVCVVDIVLIPKGK"
FT   gene            400664..401956
FT                   /gene="fabF"
FT                   /locus_tag="lpg0361"
FT   CDS_pept        400664..401956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="lpg0361"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   C-terminal"
FT                   /function="Lipid Metabolism"
FT                   /EC_number="2.3.1.41"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26458"
FT                   /db_xref="GOA:Q5ZYL1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL1"
FT                   /protein_id="AAU26458.1"
FT                   /translation="MKRRVAITGLGVVSPLGNDVSTTWMNLIAGHSGIDSIKQFDASAF
FT                   PTTIAAEVKNFSPDTSISGKHTRFIMSFTHFALEAARQAFEDASIFPTKQTSDRWGIVT
FT                   GSGMMTAEFEYLTRFQQACAAGGEIDWGKLQSNSRDFYNLVDFGKTTSNSGLSLLIQQY
FT                   GITGYASSVHTACASGGQALGLAMQVIRRGEADFMLAGGFDSMINPLGLSSFCLLGALS
FT                   TYNETPQTASRPFDATRNGFVLGEGAAFLILEEWSKAKARGAKIYAELAGEGNSLSSYR
FT                   ITDSHPNGDGAIQAIKRALEDAGVQPRDVDYINAHGTSTKMNDLSETNAIKVVFGDRIA
FT                   NLPVSSTKSQTGHLIAAAGALEAVLSVKSIEQAQVPKTANLKTPDPECDLDYVVDGPRE
FT                   KSLGVVLSNSFGFGGSNSCLLFKHPEFEETK"
FT   gene            401957..403234
FT                   /gene="fabF"
FT                   /locus_tag="lpg0362"
FT   CDS_pept        401957..403234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="lpg0362"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   N-terminal"
FT                   /function="Lipid Metabolism"
FT                   /EC_number="2.3.1.41"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0362"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26459"
FT                   /db_xref="GOA:Q5ZYL0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYL0"
FT                   /protein_id="AAU26459.1"
FT                   /translation="MSQANRVFITGRSALTASGATADETWNAIISGQCGIDEINFWELS
FT                   EWSHRLGGEIKDFQPSKMLPDRKLIKVISRQDIMGINAAVQAVEHSKMIAYRDSLADAD
FT                   LFNEQTAIYVGSPGNKYFQQYDFIPLLAKTHGDMRSFANQLFDEVHPMWLLRILPNNVL
FT                   AYTGITYGFKGPNHNVTNHAVGGTQAILEAYHAIRSGQAERAVVVAYDIGTEPQGLFYY
FT                   EKLGVVSNRHLKPFDKEHDGTILAEGAAALVLESEASVKSRAATCYGEIVGGLSASEAT
FT                   GLFSIEADGQHLASLMGQTLSTSGINSEEIGLIVTHGNGNSKSDDSEALAIKSVFKQEE
FT                   VPATAFKWSMGHTLCASGVLDAVLTTYALETKCVPGIANFQQIAPTCEGLSVSREHREI
FT                   ISNSYAMMINRGFASMNVCLVIKACE"
FT   gene            403227..404072
FT                   /gene="waaM"
FT                   /locus_tag="lpg0363"
FT   CDS_pept        403227..404072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaM"
FT                   /locus_tag="lpg0363"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="2.3.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0363"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26460"
FT                   /db_xref="GOA:Q5ZYK9"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK9"
FT                   /protein_id="AAU26460.1"
FT                   /translation="MNNLAQQIEALPITLAGRFIYRFLPYRRRLIFSNISQVYNDQLNE
FT                   SQKKRLAKAYYSHLAKSLKEALQLRFMSEKKLRAQVEVIGHEKMLAVVAQKKGVLVVTG
FT                   HFGNWEFAPLGGVLNFKEFKGQFHFIRRTLRFKFIERIMFKNYYQAGLNVIPKKNSLEQ
FT                   VCVALEQNHAVIFVLDQHASLVNRDGIAVEFFGKKAGTYRSLATISRHTGIPVIPAASY
FT                   RLPNGKHVLEFHDPIPWKDYDTTQESLYRNTLAYNQALEKIILAHPEQWNWMHKRWKLS
FT                   "
FT   gene            complement(404182..404487)
FT                   /locus_tag="lpg0364"
FT   CDS_pept        complement(404182..404487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0364"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26461"
FT                   /db_xref="GOA:Q5ZYK8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="PDB:4Q63"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK8"
FT                   /protein_id="AAU26461.1"
FT                   /translation="MDERRKYFRLKNHGEINASLDNNSIEIVEISSNGAVVVKQKTDIP
FT                   KEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKNKT"
FT   gene            complement(404662..407352)
FT                   /locus_tag="lpg0365"
FT   CDS_pept        complement(404662..407352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0365"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26462"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK7"
FT                   /protein_id="AAU26462.1"
FT                   /translation="MVDFDKPVSKNDILASLLLIADLNRPSLNQTLSWEQALKSFLSLN
FT                   DPLIKTEIFIKWLSQLNPDQLQSSPEIVLLLKHIVEQKLLPYTLKKILIQRENFTTSQI
FT                   NWLCNHCLIVAPDQTTLPDIIKLGSWSWLENHMKRNELLNFDLLKIAILNKDYLASINN
FT                   SKESQLDFIYALNANKFNYQQILELIALAQDSQIKSLLITCLLSKKEYLDNLKEKSFLA
FT                   HLNQSEFHSPPRLNPLIHQLNLSCLTVAQIELLQPEACVTLLCSIPHFHQLSEKQVEKI
FT                   LLKYPKPDMIAYWLNHYSSRPNAHFILAHLMNLVDVHVVDELNKMDSTKKETIIMNMVE
FT                   HLELFDPTHPLLINQNEEKRLITAIQRYLYGQHHDAYVTYIKLLVYKLLNRNYQFSPQA
FT                   MQLLICLNNLEEFKELNNKIAYLTNYYLRASAQSGDSSLFYNDSRINITSMTQLVQLAP
FT                   KIPTKSKEKSLLSSIFCGIKISESSVMTPTNDIPEHPLINKLIKNKRTVKSIDYFLMHY
FT                   KGDKQVLSKIINDYLSYYVQEGCTEIHRRSIYHLIVLMSLSDISASVREAIFTAFLNYP
FT                   ELHDEQINFSLFVYDAKRTIRHFGAQASEDSYARVIDLCEGALKKLNPNKHKEIISIAT
FT                   QALTEAKIELSFGENTGFIAQLISRLKRCWYYGWTGFFSPNPPTFVAAIDSPIKPSEKK
FT                   TSPLLQQRKYFTTKLETNLSIILDDIKSGYTQQKLNELIEALSIFSLQSNPKNELKIRQ
FT                   KLHRLFHYLLLESKNDLTLDAWLIKNQQLLIANRFRLLEMQLMKGARNEVESLLKEFDE
FT                   DSAHFSPISKEFTHSLPEQNPYKCESVSSNQTPGATILDSATELATSLKSTLGNLGVFF
FT                   SNNIMSAIYPNNKSTPQSTSTMISP"
FT   gene            complement(407663..408496)
FT                   /gene="dapF"
FT                   /locus_tag="lpg0366"
FT   CDS_pept        complement(407663..408496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="lpg0366"
FT                   /product="diaminopimelate epimerase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="5.1.1.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26463"
FT                   /db_xref="GOA:Q5ZYK6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYK6"
FT                   /protein_id="AAU26463.1"
FT                   /translation="MGIKFTKMHGLGNDFIVLDGVNQSIQLTVEQIQKLANRHTGIGFD
FT                   QCLLIESSQTEGIDFNYRIFNADGQEVGQCGNGARCIALFARYYGLTAKNKLTVATKTT
FT                   LMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPEYSLELNNGNTVNLHAISVGNPHA
FT                   VLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIINHEKINLRVYERGCGETIACGS
FT                   GAVAAAAIARLFYNLSDKITVHLPGGDLCIQWPCPTAPIILTGPAAFVYEGTLLS"
FT   gene            complement(408711..409034)
FT                   /locus_tag="lpg0367"
FT   CDS_pept        complement(408711..409034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0367"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0367"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26464"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK5"
FT                   /protein_id="AAU26464.1"
FT                   /translation="MVPIQTGYMEVLAKVSFHKIRFSYTGTEMEKTVILLNVQIDYLKR
FT                   NLKCCINCSWIINTLWKRYSRHPIIDFSLFRHAIPKHYFTKERHKIRNKLSACLTQAQN
FT                   IHI"
FT   gene            409033..409140
FT                   /locus_tag="lpg0368"
FT   CDS_pept        409033..409140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0368"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26465"
FT                   /db_xref="GOA:Q5ZYK4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK4"
FT                   /protein_id="AAU26465.1"
FT                   /translation="MQISSGGIKAIIYLVAIMALLDLLNEPAVRSQFSC"
FT   gene            409315..409992
FT                   /locus_tag="lpg0369"
FT   CDS_pept        409315..409992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0369"
FT                   /product="carboxylesterase/phospholipase"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0369"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26466"
FT                   /db_xref="GOA:Q5ZYK3"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK3"
FT                   /protein_id="AAU26466.1"
FT                   /translation="MRGEFVLSVYMKEPLEKAQACVIWMHGLGADASDMMGLADQLTIE
FT                   DTALRHVFLDAPRRPVTLNGGMVMPAWYDIYGLGFVDEEDKFGIEQSELLIRKVVDAQY
FT                   NCGFKPHQIFLAGFSQGGAMALHTALHMTERLCGVIALSAYLPLAKHNKPQLDKNTPIF
FT                   MGAGQFDPLVLPKWTLQSKDWLLANGYNEVSFHQYPMEHSICFEEIKDLSLWLNKQVQG
FT                   VLQ"
FT   gene            409989..410423
FT                   /locus_tag="lpg0370"
FT   CDS_pept        409989..410423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0370"
FT                   /product="oligoketide cyclase/lipid transporter protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26467"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK2"
FT                   /protein_id="AAU26467.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKS"
FT   gene            410410..410682
FT                   /locus_tag="lpg0371"
FT   CDS_pept        410410..410682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0371"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26468"
FT                   /db_xref="InterPro:IPR005346"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR037021"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK1"
FT                   /protein_id="AAU26468.1"
FT                   /translation="MVKVELVYIANSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
FT   gene            complement(410771..411115)
FT                   /gene="smpA"
FT                   /locus_tag="lpg0372"
FT   CDS_pept        complement(410771..411115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="lpg0372"
FT                   /product="small protein A, tmRNA-binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0372"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26469"
FT                   /db_xref="GOA:Q5ZYK0"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYK0"
FT                   /protein_id="AAU26469.1"
FT                   /translation="MAKFFMVGKKMRIMTFFICFILTLTLTQCASYDFSRRITQQGNLL
FT                   PQSKIARLKTGMSKNDVAILMGTSIMSPTFNNDRWDYAYTWRRGKGNLEIRNVVLYFSR
FT                   GSLVKIEHKP"
FT   gene            412548..413186
FT                   /locus_tag="lpg0373"
FT   CDS_pept        412548..413186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0373"
FT                   /product="components of sensory transduction system"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0373"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26470"
FT                   /db_xref="GOA:Q5ZYJ9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ9"
FT                   /protein_id="AAU26470.1"
FT                   /translation="MPMNFPIIAYNLYLFQFDKIIFAVMYSLFLIIVLLTVRLNSKLLS
FT                   KVRALSITDSLTGLFNRRHFDMVFSNELSRAKRNKYPISLVFIDIDNFKYINDTFGHSA
FT                   GDRFLIHVSNILKQTLRRSSDSMFRIGGDEYAAILINMPPNEVTTVCVSMQEQFNKKNQ
FT                   YKNVSLSMGVISIDSMRVVDQQSAITAADKTLYQAKKAGKNQIKSKSLG"
FT   gene            complement(413499..413885)
FT                   /locus_tag="lpg0374"
FT   CDS_pept        complement(413499..413885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0374"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0374"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26471"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ8"
FT                   /protein_id="AAU26471.1"
FT                   /translation="MKKWTVLAASSLLMVNAYANESFCGYKDFFHLGDKTHPGIYVVSG
FT                   YNDSDVVLQIVGPRSFVIRDGFDCRAGYAHVTVAYDNANWCVLDINDGPFMNHPVVSAS
FT                   CNGLRYINTTYDGFGSYSYSINIE"
FT   gene            414141..414740
FT                   /locus_tag="lpg0375"
FT   CDS_pept        414141..414740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0375"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26472"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ7"
FT                   /protein_id="AAU26472.1"
FT                   /translation="MYSSLFLKKDLGHLPEKVIFLDFDGTVALPARKENGEYDVQPDGS
FT                   IGATHLNKEKFRRLVQFSIHTDIPLYFLSGRPDLQSCVDLMTDFIASVDGFHSGIGGFK
FT                   KDSLFFISKMIIEEGKLIRKEITTKAQVIQSVHHEKYSYLPKESILLVDDIQEYLDPVR
FT                   ELGYNTLLANPESLEHFNEVEEFIGVTLQKTIAFNT"
FT   gene            complement(414780..419069)
FT                   /gene="sdhA"
FT                   /locus_tag="lpg0376"
FT   CDS_pept        complement(414780..419069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="lpg0376"
FT                   /product="SdhA, GRIP coiled-coil protein GCC185"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0376"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26473"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ6"
FT                   /protein_id="AAU26473.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTNFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKRLAESWKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVDPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGTLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPEDLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQPNGIPYPELQDHNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLIQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   PDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLTYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   SESRAITPVSSVENNGTIELNQLAPSA"
FT   gene            complement(419232..419975)
FT                   /locus_tag="lpg0377"
FT   CDS_pept        complement(419232..419975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0377"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0377"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26474"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ5"
FT                   /protein_id="AAU26474.1"
FT                   /translation="MNNLPPDIMKNIALLISCEHAVNTVPYEYQTLFEPHKDILESHRG
FT                   IDFGALEIAQSIHKNNPCSLFQATCTRLLVDCNRSINHPHCFSEITKNLSSDKKKKILD
FT                   EFYLPFRNRVMDHIHQLISQGLQVWHLSTHSFTPVMNNIIRMTDIGLLYDPRSNSEKIL
FT                   ARQWQKEIKILHPQLKVRMNYPYKGISDGFTTSLRKKYSHHEYIGIELEVNQKLVFHNH
FT                   SLDALKNTLPLSVSNTIKAYQKSER"
FT   gene            complement(419956..421212)
FT                   /locus_tag="lpg0378"
FT   CDS_pept        complement(419956..421212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0378"
FT                   /product="AF2307"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0378"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26475"
FT                   /db_xref="GOA:Q5ZYJ4"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ4"
FT                   /protein_id="AAU26475.1"
FT                   /translation="MSSYNEFAGNMVMSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLI
FT                   LRALAGHQVNEIELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQ
FT                   HNLLLLPTGAHPWMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSN
FT                   EEEFCQLHNATRLILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIP
FT                   EFIRTEREYQEQILEPMYRDISPYDPEGILQYQWLNSRAAIPKFDMKAIEIRILDSQEC
FT                   VEADIAIAKAINAILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHIDNKRLLEQ
FT                   WQLPLQGMSVNTIWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSCVNHDSL
FT                   KQVYTQLAHCLLRNEQFTP"
FT   gene            complement(421169..422623)
FT                   /locus_tag="lpg0379"
FT   CDS_pept        complement(421169..422623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0379"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /function="Amino Acid Metabolism, Metabolism of Other Amino
FT                   Acids, Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0379"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26476"
FT                   /db_xref="GOA:Q5ZYJ3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ3"
FT                   /protein_id="AAU26476.1"
FT                   /translation="MQTVIVTDDLDSWSFLSELAPIVHALEYLSGDEYHQNKSFRVINL
FT                   CRSYNYQSIGYYVSLLAQARDHKALPSVHSIQDVLNVSLSKLISQDTHEEIQHSLHDIK
FT                   GNEFVLSLYFGQNLAKRYATLAKQLHGLFPLPLIRFYLEKKKQWRIKTVVPLSLSDVPE
FT                   HHLEFMRQSAENYLSKKRVHQWRKKQRFHDLAILVDPSEPNAPSNKKALELFVSCGEEL
FT                   GLNVDIIDKNEAKAIAEYDALFIRATTSVNHYTYRVSRRAAQENLVVIDDPQSIIKCSN
FT                   KVYLAELLSSHQIMTPDTLFISKYDKELPKIEFPCVLKKPDSAFSHGVVKIDDEKSLQK
FT                   SLNQFFKNSDLVVVQPFIPTEFDWRIGILDNKALFACRYFMAKGHWQIYDWHCQEENKE
FT                   GDSETLPLHEVPEQIIKIALKSTRLIGDGLYGVDIKSHGNKYYVIEVNDNPNIDHGLED
FT                   KILGQNLYEQIMSVFLQRIRRKHGYV"
FT   gene            complement(422627..423346)
FT                   /locus_tag="lpg0380"
FT   CDS_pept        complement(422627..423346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0380"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26477"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ2"
FT                   /protein_id="AAU26477.1"
FT                   /translation="MPMIDLIIQTQPDDETCGPTSLHAIYLYYGLDLPLNEIIQGVDKS
FT                   LSGGTLTPMLGKHALLHGFRTTVYIYNLNIFDLTWFHNGEVNNSFLMDKLEAQMKYKND
FT                   PYITKASLAYLDYLKLGGTIRSKSLNVDLLKNYFNKKIPILTGLSATYLYRSAREYFTP
FT                   EGKSVYDDIRGEPCGHFVVLCGYDVKKRLVIIADPHAENPLSHNNYYKVSINRLINSIM
FT                   LGVLTYDANLLIIEPKE"
FT   gene            complement(423535..424008)
FT                   /locus_tag="lpg0381"
FT   CDS_pept        complement(423535..424008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0381"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26478"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ1"
FT                   /protein_id="AAU26478.1"
FT                   /translation="MSPLTQFKFFLWFFSHFKVALIGYLKPKLIQLTDNEIVVRLPLTR
FT                   RSRNHLHSMYFGALAVGADIAGGLHGFYHAKQAKCKVSLAFKSFQAQFLRRPESDVYFI
FT                   CTEGDVVKKMIEESKKSGERINKPIHIKAYINYLTHPEEIADFILELSLKVIK"
FT   gene            complement(424005..424571)
FT                   /gene="osmY"
FT                   /locus_tag="lpg0382"
FT   CDS_pept        complement(424005..424571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="lpg0382"
FT                   /product="osmotically inducible protein Y"
FT                   /function="Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26479"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYJ0"
FT                   /protein_id="AAU26479.1"
FT                   /translation="MEDTTMPKCMHFILATALIFVTSTFYASNLREIEQEVSDSVITAK
FT                   ITAKFAESRHLNPLKISIDTEKGIVTLSGYAPDKQAFIDALQIAKNTKGVKAVHAKELH
FT                   IKKVNTAFTDAFITAEVETAVLKAKILDDESIPLVGINASTTNGEVTLSGHVKSARSIA
FT                   AIIKRVNEIPGVKKIVTNLEIQENT"
FT   gene            complement(424815..425297)
FT                   /locus_tag="lpg0383"
FT   CDS_pept        complement(424815..425297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0383"
FT                   /product="hypothetical protein"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0383"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26480"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI9"
FT                   /protein_id="AAU26480.1"
FT                   /translation="MMRNRDFNMKSLIKNLLFIVVFSINSSALYAINGNTRVIQWAQQT
FT                   LMDTLSVSYTSKPQDFVAVRKNYSLNAWSGITGFLGGNMQSIREKQLTLHPVLLPDTQI
FT                   LSTGLYSGMSYWIIRQSVAIDELNTKLTFTLTILGRSGAAGSPYIVQSLSILLNAL"
FT   gene            425369..428224
FT                   /gene="uvrA"
FT                   /locus_tag="lpg0384"
FT   CDS_pept        425369..428224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="lpg0384"
FT                   /product="excinuclease ABC A subunit"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0384"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26481"
FT                   /db_xref="GOA:Q5ZYI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI8"
FT                   /protein_id="AAU26481.1"
FT                   /translation="MHTITIRGARTHNLKNLDLELPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDSIEGLSPAISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHTSLHAQTISQMVDQVLALPEDSKVMILAPVIRERKGEHV
FT                   QFLQQLQAQGYVRARIDGELYELDSPPKLGLRTKHTIEVVIDRFKVRPDLAQRLSESFE
FT                   NALNLADGLVIVSSMDGHFNELLFSSRFACSECGYSLSELEPRLFSFNNPVGACSSCDG
FT                   LGVDQFFDPSRVVHDATASLAEGAIRGWDRKTTYYFSMLESLARHYGFDTSTPFCDLSE
FT                   AMQQIVLYGSGREIIEFQYHRPHGGYMVKRHSFEGIIPNMQRRYRESDSGMIREELAKY
FT                   LSSRPCQSCQGARLREEARHVFIDNKNLPEITSYSIEQAYQFFKELKLSGYRGEIAAKI
FT                   NKEIVERLGFLVNVGLDYLSLARSAETLSGGEAQRIRLASQIGSGLVGVMYILDEPSIG
FT                   LHQRDNDRLLSTLMHLRNQGNTVIVVEHDEDAIRSADFVLDIGPGAGVHGGEVVASGSP
FT                   EEVMNNPASLTGQYLSGKKEIEIPKDRIPVNHDRMIHLKGVSCNNLQNVDVSIPLGLLT
FT                   CITGVSGSGKSSLINDTLYPIAANALNRASLMTIGEVKDISGLHLCDKVIDIDQSPIGR
FT                   TPRSNPATYTGLFTHIRDLFSGTPESRARGYQPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVSCDVCQGKRYNRETLEIHYKGKNIHEVLDMTVEDACAFFAAIPVIARKCLTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRIKLARELSKRDTGNTLYILDEPTTGLHFHDTKQLL
FT                   TVLTRLREQGNTIVIIEHNLDVIKTADWIVDLGPEGGSKGGKIIATGTPEMVAENPQSF
FT                   TGQFLRQILSKSNELLLQKCK"
FT   gene            428407..428988
FT                   /locus_tag="lpg0385"
FT   CDS_pept        428407..428988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0385"
FT                   /product="LemA protein"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0385"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26482"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI7"
FT                   /protein_id="AAU26482.1"
FT                   /translation="MKTFFIAILIIIALAFVWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKDAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
FT   gene            428999..430018
FT                   /gene="htpX"
FT                   /locus_tag="lpg0386"
FT   CDS_pept        428999..430018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="lpg0386"
FT                   /product="heat shock protein HtpX"
FT                   /function="Detoxification / adaptation, Protein fate /
FT                   hydrolases / secretion"
FT                   /EC_number="3.4.24.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0386"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26483"
FT                   /db_xref="GOA:Q5ZYI6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI6"
FT                   /protein_id="AAU26483.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYIFVGLIVDAF
FT                   VLQSMYPHASLENIIHALITFKVVPFATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEANYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
FT   gene            complement(430045..430818)
FT                   /locus_tag="lpg0387"
FT   CDS_pept        complement(430045..430818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0387"
FT                   /product="ABC transporter, permease protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26484"
FT                   /db_xref="GOA:Q5ZYI5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI5"
FT                   /protein_id="AAU26484.1"
FT                   /translation="MGFKYQLIALYTLVRREVVRMFRISSQVFLPPVITTTLYFLIFGS
FT                   LIGPRIGDIEGVDYSQFIAPGLIMMSVIINSYGNVSNSLFSVRFQKSIEEMLISPMHNG
FT                   LLLLGYVIGGVLRGLIVAILVFVISTFFLPVELDHLPMTLLVVVLVAAIFSLAGFTNAM
FT                   VARNFDDIMLIPTFILTPLTYLGGVFYSINMLPPFWQKISLFNPILYMVNALRHTMIDQ
FT                   EEVSITLAMIIIFLMLIALTVGNMILLKKGVGFRE"
FT   gene            complement(430808..431722)
FT                   /locus_tag="lpg0388"
FT   CDS_pept        complement(430808..431722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0388"
FT                   /product="ABC transporter, ATP binding component"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0388"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26485"
FT                   /db_xref="GOA:Q5ZYI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI4"
FT                   /protein_id="AAU26485.1"
FT                   /translation="MHALEIKQLSKTYSNGVEALKGIDLTVNTGDFFALLGANGAGKST
FT                   TIGLITSLVNKTSGNIKIYGFDLDAYPEKAKSCLGLVPQEVNLNIFENCEQILLNQAGY
FT                   YGISRKKAFPRAEALLEQLGLWDKRRSIVRHLSGGMKRRLMIARALIHQPKLLILDEPT
FT                   AGVDIEIRHSMWDFLARTNAEGTTIILTTHYLEEAEQLCKNIAIIDKGQIIKNTSMKAL
FT                   LQTLRHQTFIFNTENPIDYLPDIHPFNVTPIDPTTFELRVDNNFSLNEVFSVLTKQGIK
FT                   IHSMRNKTNRLEELFMDLIKNGI"
FT   gene            431782..431895
FT                   /locus_tag="lpg0389"
FT   CDS_pept        431782..431895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26486"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI3"
FT                   /protein_id="AAU26486.1"
FT                   /translation="MDFNSSLTSNGLILGMKEELTLAMNHRYEDIFLLLHF"
FT   gene            complement(431953..433011)
FT                   /gene="vipA"
FT                   /locus_tag="lpg0390"
FT   CDS_pept        complement(431953..433011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vipA"
FT                   /locus_tag="lpg0390"
FT                   /product="VipA"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0390"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26487"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI2"
FT                   /protein_id="AAU26487.1"
FT                   /translation="MKHYDSMDQELITMPISNAFLKLFSEFVDNYARNGTPSFYHWAKE
FT                   QNHEVINKFFHELLEIIKSNTETFHDVSIIEHLNATVLLSAKTNPYLLDCWISFITKYN
FT                   AETNSFTPIGASMHIKVGPEGTPSERIIRELKESLVMTQQAFILAQKANATEVDSLKRQ
FT                   LEQTKQENERLVTQNQFLKDQVRAEKTFADLNPQINNARQQLSALTELIQTLSEITNAK
FT                   PKIETVSSLSIPVVTENKSELLKENSCSVASVSKEVTPAISQEPKKRPVPPPPNDTDGQ
FT                   ALSPNIPPKEDVSIKVTIPSMPKPNSTQPAAKNSGFFSGDGFLKELNAKIKERKERPKD
FT                   EPHTTPVEKKNL"
FT   gene            complement(433098..433637)
FT                   /locus_tag="lpg0391"
FT   CDS_pept        complement(433098..433637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0391"
FT                   /product="SM20-related protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26488"
FT                   /db_xref="GOA:Q5ZYI1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI1"
FT                   /protein_id="AAU26488.1"
FT                   /translation="MAYELKQQNLFRNAKIGQNLQAQQNDKIRSDQIFWIDADSPYPPI
FT                   QAYLKKLISLGNILNQTMYLGLAEFETHFAIYLPGTFYRKHIDQFESTKTRKISFVYYL
FT                   NDTWQKEFGGELLLYNIEDELIQNISPLGNRFVCFDSQLPHEVYPTQRTRFSMTGWMKT
FT                   RSTSVLADNKLTKITQ"
FT   gene            complement(433822..434529)
FT                   /locus_tag="lpg0392"
FT   CDS_pept        complement(433822..434529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0392"
FT                   /product="zinc metalloprotease"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26489"
FT                   /db_xref="GOA:Q5ZYI0"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYI0"
FT                   /protein_id="AAU26489.1"
FT                   /translation="MHIQIDGIPIEILRKPIKNLNLRIYPPDGLVKVSVPLKYSEQLIK
FT                   QQLQEKSKWIRAQCEQIRARSFYREPSLQTGATIPFKGKSYLLIVEEHYGPSQILIKNE
FT                   LIYCYTKPDLTPQQKQNILDRWYRKEMNLVIPRLIQQWEAIMKVKINQWGIKKMKTRWG
FT                   SCNPRAQRIWLNLNLIKKPLECLEYVLVHEMVHILEASHNKRFYALMTQFMPKWQEYQR
FT                   ILEGTPNASTFAR"
FT   gene            435144..436007
FT                   /locus_tag="lpg0393"
FT   CDS_pept        435144..436007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26490"
FT                   /db_xref="InterPro:IPR041321"
FT                   /db_xref="PDB:4R0G"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH9"
FT                   /protein_id="AAU26490.1"
FT                   /translation="MLSSTKEYLQALRDGKYLLFLQWPKFIAEYYGKSDKNQEADEMVS
FT                   LLIFEWLNNGFCLDDIKKFAILYAVHEMESRPLREGLSYALTTISIALFPCMVYLTNNL
FT                   QEHYITSKKLSSKEVLQLMTMNNAYLEKQRFVEFLGQEQDKFFTWVKEADSSAVSKAFD
FT                   QIYSVTYLKYLIEDYLSLLESAHLPTDQLKSSRISLVVRLAKYLHEQTELTQDVHDEIA
FT                   VYVKKLWEMQPAEFEEEFLKKISPLPFIDNTVRILTGLSARFFSILQPPSPPLNINSDT
FT                   DKNPKV"
FT   gene            complement(436108..436563)
FT                   /locus_tag="lpg0394"
FT   CDS_pept        complement(436108..436563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0394"
FT                   /product="methylated DNA protein cysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0394"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26491"
FT                   /db_xref="GOA:Q5ZYH8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH8"
FT                   /protein_id="AAU26491.1"
FT                   /translation="MLLMSIFNTPVGNLEVAHDEHFIFNASFTDKSGAPAQNQLAHLIA
FT                   SELKAYFDNPHHRFQLPLKPQGSLFQQKVWNTLLVIPVGRTVTYGELATKLQSSPRAVG
FT                   QACKCNPLALFVPCHRVVGKHDLGGYMGNPNAISYKKNLLAHEAKII"
FT   gene            complement(436579..436944)
FT                   /gene="rplS"
FT                   /locus_tag="lpg0395"
FT   CDS_pept        complement(436579..436944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="lpg0395"
FT                   /product="50S ribosomal protein L19"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26492"
FT                   /db_xref="GOA:Q5ZYH7"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYH7"
FT                   /protein_id="AAU26492.1"
FT                   /translation="MTNIIDQINAEQMQGKEIPDFNPGDTVLVQVKVIEGNRERLQAFE
FT                   GVVIAKRNRGLNSAFTVRKISHNVGVERVFQTYSPIVDSITVKRRGDVRRAKLYYLRNL
FT                   AGRAARIKEKLSGKKGD"
FT   gene            complement(436971..437741)
FT                   /gene="trmD"
FT                   /locus_tag="lpg0396"
FT   CDS_pept        complement(436971..437741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="lpg0396"
FT                   /product="tRNA (guanine N1) methyltransferase"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26493"
FT                   /db_xref="GOA:Q5ZYH6"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYH6"
FT                   /protein_id="AAU26493.1"
FT                   /translation="MGYEFLVALHLGVITLLPEIIQGIHYGVTGRAIEQGLVKIDCWNP
FT                   RDWSSRPYKQVDDKPYGGGPGMVMMYEPLHAAIKHARSEMKENCKTIYLSPQGKVVRQN
FT                   DLKQIAAQKQSLLFVAGRYEGIDERIISHHVDEEWSLGDFVLSGGELAAMVFIDAIIRL
FT                   IPGSLGHLGSAEQDSFMNGLLDCPHYTRPATINGLDVPDVLLGGNHKEIERWRRKQSLG
FT                   KTWLKRPDLLEKVQLSETDKQLLAEFKCEHGDSC"
FT   gene            complement(437723..438232)
FT                   /gene="rimM"
FT                   /locus_tag="lpg0397"
FT   CDS_pept        complement(437723..438232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="lpg0397"
FT                   /product="16S rRNA processing protein RimM"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26494"
FT                   /db_xref="GOA:Q5ZYH5"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYH5"
FT                   /protein_id="AAU26494.1"
FT                   /translation="MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFL
FT                   NKQWQPLKLLTIEVRSKAIIAQIEGYPKRELVSALTNLDIGVQESQLAALAPGEYYWYQ
FT                   LIGMSVINSKGDLFGKVVEIMPTGSNDVLVVEGEKRHLIPYLPGQFVINVDESQQVITV
FT                   DWDMNF"
FT   gene            438107..438241
FT                   /locus_tag="lpg0398"
FT   CDS_pept        438107..438241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0398"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26495"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH4"
FT                   /protein_id="AAU26495.1"
FT                   /translation="MPVIVPQDIISRVCEGMYRDKAFNTMGSAKTADDNPICLVIHFG"
FT   gene            complement(438238..438498)
FT                   /gene="rpsP"
FT                   /locus_tag="lpg0399"
FT   CDS_pept        complement(438238..438498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="lpg0399"
FT                   /product="30S ribosomal protein S16"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0399"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26496"
FT                   /db_xref="GOA:Q5ZYH3"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYH3"
FT                   /protein_id="AAU26496.1"
FT                   /translation="MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARG
FT                   QEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEHSKKSETAA"
FT   gene            complement(438585..439961)
FT                   /gene="ffh"
FT                   /locus_tag="lpg0400"
FT   CDS_pept        complement(438585..439961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="lpg0400"
FT                   /product="signal recognition particle protein Ffh"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0400"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26497"
FT                   /db_xref="GOA:Q5ZYH2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH2"
FT                   /protein_id="AAU26497.1"
FT                   /translation="MFDNLTERLTRTFKNLRGQGRLTEDNIQHALREVRLSLIEADVAL
FT                   PVIKEFIEQVKQKSLGQEVLTSLNPDQAFIKIVHDELIHVMGNERVELDYKTQPPAVFL
FT                   MAGLQGSGKTTSTAKLARYLKETENKKVMMASVDVYRPAAIHQLKVLAEQIDVAFFDSD
FT                   PNEQPIKIAQKALESARKQYVDVLILDTAGRLHVDEDMMSEIKSLHKAVNPIETLFVVD
FT                   SMTGQDAANTAKAFHEALPLTGVILTKTDGDARGGAALSVKQITGKPIKFIGSGEKIEA
FT                   LEPFHPERIASRILGMGDILTLIEEVERKADKQASEKLAKKLKKGKGFDLEDFKQQLLQ
FT                   MNNMGGISGMMSKLPGVGQLPKQAMQQVNDKAMAQTIAIINSMTPKERRIPKIIVGSRK
FT                   KRIALGSGTQIQDVNRLLKQFEQMQKMMKKFTKPGGMQKMMRGIGGMAGLKGMFPDDLK
FT                   "
FT   gene            complement(440213..440887)
FT                   /locus_tag="lpg0401"
FT   CDS_pept        complement(440213..440887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH1"
FT                   /protein_id="AAU26498.1"
FT                   /translation="MESLMPKAFTHLCKKVNLSLYNDTLTVYPKSSVLPKPIQIRSELD
FT                   LLMVLLFSQMDCNSAQVDKFFMMRSNELGVYRFIHRDDTDHDLYHQDEFSMDDNHYHAQ
FT                   FDKIIDEIKLENILGILEKHSLISSEEHVSFIEAYHKANTLPEDMPKLETTLSSPLPVS
FT                   SPSVHTTKKQPVVKEKEVDTPTTFAGLRVGFFLTSTKTTTKPLSRSHDDEKKTGMDGHG
FT                   FH"
FT   gene            441321..443024
FT                   /gene="legA9"
FT                   /locus_tag="lpg0402"
FT   CDS_pept        441321..443024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legA9"
FT                   /locus_tag="lpg0402"
FT                   /product="putative ankyrin-repeat containing protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26499"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYH0"
FT                   /protein_id="AAU26499.1"
FT                   /translation="MHSLYLGVVKVMAKIILVYANCVNSTAKGDFALAGQIAKDLVREK
FT                   TSDDIDVVLTSTLDGIARFESLYGKAVDGRVIIEGTSVGLCALELFESVDNEVVAFIEA
FT                   NRCKYAPSDILKRVLSPDSKFLFIGAANQKAIATGDKFTKSWLYISHKGDQPNVYEHFD
FT                   EDDSLIQSVGLGDDRLGLPSLPKVDELPEMNSTQSQKIPSGEYGFMYLAAVHGIDDVYL
FT                   MNQYMSLTEMGQYVLVGEYAKQSKEVQMVLHSLQYKGSSVSLTMPQIFFHDSVDNCLMR
FT                   NMVSKSSGPLVVSTGVMSSIEAMQDGKLTYYQTMSNNTQFVASYLIAVKSICSSDTTLF
FT                   GSMPKLIIDLSNLLFAEKPLKESQMKEIKSLLGMSSVTSRLGEMNKRIIAKANGTVAGE
FT                   LLSFIGKPKTTQSHKQCISVCMSLRKSGETTSPIFDQALRRAAAWGRLFELKVLIASMS
FT                   TSDLNKKDKTGNQYTALHWAVMQGHLDCARLLVKSGASVDIQDKSGKSPLHYAIKRGDK
FT                   ETIKLLVQAGASLEIMDDSGAKPCDGSESWVPEYIKSCYEKSGHKSSSLF"
FT   gene            443204..444748
FT                   /gene="legA7"
FT                   /locus_tag="lpg0403"
FT   CDS_pept        443204..444748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legA7"
FT                   /locus_tag="lpg0403"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="1700007B22 gene product; conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0403"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26500"
FT                   /db_xref="GOA:Q5ZYG9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG9"
FT                   /protein_id="AAU26500.1"
FT                   /translation="MNSLWIASGSRDMIYVLICIMLVCGLVVYQLMPKLLSYSTSLISK
FT                   KQDTSELTHDGITNVLTQLGHPKFEGVCYGFTLNWALAVAQGKESFFYRQLHHLRTHQF
FT                   GLPETLQQIKEKKERNQSLSKDEKIIETLPQLGKKICIAQDPLQYKEKYKKLVWQPDIN
FT                   SILKAINADSSVAKHIFYKTHSFLNQDEATEYLELLKRTGIREDVAVIISTADHAMGFK
FT                   LAGNVWRFININDLYQQDKNKPYFEFSSRNLVKELYRVCAENLQGSRLTVNTDFVSVNP
FT                   EEKLSRALQNLFPVFPVRTKTSYPERLAFFSMAATQGDMNSVKKCIHSGWSIFSRQRLS
FT                   DDSPILTAIYLGRRDVVRAMLSTSRHRVNQKRKSDSSTLLHIACRYGGSGIVEDLLNIR
FT                   GIKIDPRDSKGRTPLMYACKKSVVTEDRKLFNLLFAKGASLSIKDNDGLTALDHALKNE
FT                   HTLAIQMIEERLEKEACAQENSTSRRFKFSETKGTLFQRGVKTISYQSQQPRFGMK"
FT   gene            445085..446488
FT                   /locus_tag="lpg0404"
FT   CDS_pept        445085..446488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0404"
FT                   /product="amino acid antiporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0404"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26501"
FT                   /db_xref="GOA:Q5ZYG8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG8"
FT                   /protein_id="AAU26501.1"
FT                   /translation="MSNKKHSLTIFSLTMITVGSVDSIRNLPATALFGSQLIFYFILGA
FT                   LFFLIPTALVSAELASGWARQGGVYIWVKEAFGKKSGFLAIWLQWIENVIWYPTILSFV
FT                   AGTIGYLINPSLTTNPYFLWAVIVSCFWGATIVNLRGMKSSAMFSNICSLAGLLLPMSL
FT                   IIGLGAVWIAQGNPLQISFDMPSIVPHLSDKGMWVSLTAIILSFCGIEIATVHANDVKD
FT                   PQHAFPKALVYSVGIILSTLILGSLAIAVVLPQKDINLVAGIMQAFSAFFLKYHMDWMM
FT                   PVVAVMLVLGGLGGVSNWIIAPTKGLLVAAEEGNLPEVFQRTNGKGAPAMMLYTQATIV
FT                   TVLSALFLFMPSVNGSYWLLTALAAQLYMLMYLIMFVAAIKLRISQPYHPRPFKIPGGM
FT                   AGMLFVAGIGIIGVVTTLAVSFIPPEGINVGSATRYELTLIIGLLLMCAPPFIASWLQA
FT                   KEADLEPAV"
FT   gene            446478..447068
FT                   /locus_tag="lpg0405"
FT   CDS_pept        446478..447068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0405"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26502"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG7"
FT                   /protein_id="AAU26502.1"
FT                   /translation="MLYNLTRQVKFNNPSCLCNFQKMGYIDELLEELSARLPELEWKIN
FT                   GLSSSISIHNLPKGIFSSVIEFNGPACIKEIQDDIHALQKHKDESIACFLAERIQKKIN
FT                   VLVVLCQMDKKNNKPESKISFDLTTLSTRQQWIKTMEEKICALEEQYQAMRKTLEQMKS
FT                   CSNPATILHLQTELGNVEKRLTLAKETLNRAIS"
FT   gene            447268..447609
FT                   /locus_tag="lpg0406"
FT   CDS_pept        447268..447609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0406"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0406"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26503"
FT                   /db_xref="GOA:Q5ZYG6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="PDB:5DIK"
FT                   /db_xref="PDB:5DIP"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG6"
FT                   /protein_id="AAU26503.1"
FT                   /translation="MSDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDK
FT                   KTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEA
FT                   LEAFEEFSK"
FT   gene            complement(447822..448265)
FT                   /locus_tag="lpg0407"
FT   CDS_pept        complement(447822..448265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26504"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG5"
FT                   /protein_id="AAU26504.1"
FT                   /translation="MRLLFISLILASGYLQADTINNYMNIANNIPQMEMKADPQAQAWA
FT                   RSARHVLTITSESIAETLIQANEAAKTQGKPIFCLPQGVQLNSFVMNELIQQTYKEISS
FT                   QQSDKDKMTVSQVALLGLSKKYPCEPSPQEKQIQHVASLLSPQ"
FT   gene            complement(448284..448832)
FT                   /locus_tag="lpg0408"
FT   CDS_pept        complement(448284..448832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0408"
FT                   /product="inner (transmembrane) protein"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26505"
FT                   /db_xref="GOA:Q5ZYG4"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG4"
FT                   /protein_id="AAU26505.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFIAVGLCFVMNLMLGIRASHYGLMLLATLLGLSISVRQMYIHLTPGDPGYGGLIFGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGFMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
FT   gene            449520..450248
FT                   /locus_tag="lpg0409"
FT   CDS_pept        449520..450248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0409"
FT                   /product="hypothetical, SURF1 family"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26506"
FT                   /db_xref="GOA:Q5ZYG3"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG3"
FT                   /protein_id="AAU26506.1"
FT                   /translation="MPSLTCFNFRFTSNWPMLILTAVCFFLFISLGFWQIHRADEKTAM
FT                   ITAQQALAKQEPIIWQPGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPML
FT                   LDDDSIVMVDRGWVSGDITRRTFPNVQTPNGKFKLFGMVYFPSKKQWVLGPSFEEKENK
FT                   VTLLELIDEEILKQLLQKKVYPFIIRLDKNELFGFVREWEIVSMPPQRHFAYAIQWFAM
FT                   ALVILIIFVIFNLKKNEKTI"
FT   gene            450232..450777
FT                   /locus_tag="lpg0410"
FT   CDS_pept        450232..450777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0410"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26507"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG2"
FT                   /protein_id="AAU26507.1"
FT                   /translation="MKKPYKYMTLLLLVVIFAAPGITAYLFYKHPSWLGTSKVNKGILL
FT                   SPPIALKPLDSSAKWRIIYWNPNGCDKTCLKQLNMLGRVRLSFGRKLYQVDEWLLLSNK
FT                   DSLIAEELKPILKEQDIHVAALSLTEMSKLSTLYPEAKIFIANPDNYLILSYQPGCNPG
FT                   DIYKDLKLLLNTTEIKSG"
FT   gene            450758..451789
FT                   /locus_tag="lpg0411"
FT   CDS_pept        450758..451789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0411"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0411"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26508"
FT                   /db_xref="GOA:Q5ZYG1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYG1"
FT                   /protein_id="AAU26508.1"
FT                   /translation="MKLRADKLMSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCP
FT                   DWPGCYGRMVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQV
FT                   WFKRCQDQDLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRF
FT                   RLQIAQLKGQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGVWFPEL
FT                   HFTKGFNLFSTIGANYQGGVLESEVRASIQFIHRIGAILTATYLLALSLIIVFKTHSIY
FT                   LRATAIIMAMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDREVS
FT                   HAY"
FT   gene            451779..452663
FT                   /locus_tag="lpg0412"
FT   CDS_pept        451779..452663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0412"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /function="Energy Metabolism"
FT                   /EC_number="2.5.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26509"
FT                   /db_xref="GOA:Q5ZYG0"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYG0"
FT                   /protein_id="AAU26509.1"
FT                   /translation="MRTEYAARLPVDWRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVS
FT                   LRLIAFTLLGIGLCAGSAAAINHLVDRHIDSIMARTKKRPVAYGRVSVKQALWFAVIIG
FT                   LMGLSLLILFVNQLTALLTFVTLIGYAGVYTGYLKRATSQNIVIGGLAGAAPPLLGWTA
FT                   VTDQLDPQALLLVLIIFTWTPPHFWALAIYRYKEYQDAEIPMLPVTHGIQFTKLNIYLY
FT                   TVLLLVVSLLPFVVSMSGWIYLLGALVLGIRFLVWAHKLYFTDKPVVAMQTFRFSILYL
FT                   MLLFVFLLVDHYF"
FT   gene            452673..453314
FT                   /locus_tag="lpg0413"
FT   CDS_pept        452673..453314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0413"
FT                   /product="hypothetical, SCO1/SenC family protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26510"
FT                   /db_xref="GOA:Q5ZYF9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF9"
FT                   /protein_id="AAU26510.1"
FT                   /translation="MNIKIKGGAVTITVLALVSLLAGIYISQNFHFKKKINVADFHGTY
FT                   LENPRTVNNFSLTGTDQKVFDNSSLQGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEK
FT                   KGVKNLPQVVMISIDPQRDSLDKLGSYVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKI
FT                   NSKESSEPENYDIQHSGAVMLFNPQGELNAFFTTPHHADLLAKDYVLLVS"
FT   gene            453681..454589
FT                   /locus_tag="lpg0414"
FT   CDS_pept        453681..454589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0414"
FT                   /product="glutathione synthase, ribosomal protein S6
FT                   modification protein"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0414"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26511"
FT                   /db_xref="GOA:Q5ZYF8"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYF8"
FT                   /protein_id="AAU26511.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
FT   gene            complement(454593..454838)
FT                   /locus_tag="lpg0415"
FT   CDS_pept        complement(454593..454838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0415"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26512"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF7"
FT                   /protein_id="AAU26512.1"
FT                   /translation="MLNKRFSERLNKELDNIGVPEATAERIEILSKLIKIPKFKAEALL
FT                   NGITSPDEAVLKTLAQELEVNADWLIGKSDSKSGAH"
FT   gene            455156..456646
FT                   /gene="zwf"
FT                   /locus_tag="lpg0416"
FT   CDS_pept        455156..456646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="lpg0416"
FT                   /product="glucose-6-phosphate-1-dehydrogenase"
FT                   /function="Carbohydrate Metabolism, Metabolism of Other
FT                   Amino Acids"
FT                   /EC_number="1.1.1.49"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26513"
FT                   /db_xref="GOA:Q5ZYF6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF6"
FT                   /protein_id="AAU26513.1"
FT                   /translation="MLLKAESKYPCDLILFGTLGDLSCRKLLPALYQLELANLLHEKTR
FT                   IIGCAREELDFSAYVDLIKNKIQQFLFDEIDEAVWLRFIKKLAYCKLDLNQSDDYQKLT
FT                   DYVNPSERVVISYLAIPPSLYSQTCRSLARLNLTQKPSRVVLEKPIGHDLPSSVATNEQ
FT                   VACFFAEDQIYRIDHYLGKETVLNLLVLRFANSIFSTNWDNRVIDRVEISVAEEIGVEG
FT                   RWEYYDKSGQVRDMLQNHLLQILSLVAMEPPLSLSAESIRSEKLKVLKSLRFINKSNVH
FT                   DHTVRAQYVANTLANGKKIPGYLEEVGANQASTTETFVAIKAYVDNWRWSGVPFYMLTG
FT                   KRLPKKQSEVVIYFKPQPYNIFHPLNEELYPNQLIIRLQPDEGVEVRIMNKIPGLGERM
FT                   MLHDSKLDLNFHHSFKTQRIADAYERLLLEVMLGNQYLFVSREEIEQAWQWIDSIVSAW
FT                   EEDNIPLYTYPACTWGPKEVIRLFNGQAHVWGDHNAVS"
FT   gene            456615..457346
FT                   /gene="pgl"
FT                   /locus_tag="lpg0417"
FT   CDS_pept        456615..457346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="lpg0417"
FT                   /product="6-phosphogluconolactonase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="3.1.1.31"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0417"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26514"
FT                   /db_xref="GOA:Q5ZYF5"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF5"
FT                   /protein_id="AAU26514.1"
FT                   /translation="MFGVITMQFHNFRDAKQLIHDMVEKLRTILSDAIKRRGQAFLVVS
FT                   GGRTPIDLFKELALADLPWEKVVITLTDERCVNLFDPHRNELLVREFLLQEKAKKAKFI
FT                   SLFDEKEDPLGHLNEVNSQIDSLPMFDAVVLGMGEDGHTASLFPCSDELSAGLDDKANA
FT                   VLIVKPRTASFQRVSLSKRRLLNSSTIFLHLVGQRKRVVLEQAMATNNPEILPICAILN
FT                   APDANVQVMYAPSDEEKECIL"
FT   gene            457334..459172
FT                   /gene="edd"
FT                   /locus_tag="lpg0418"
FT   CDS_pept        457334..459172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="lpg0418"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="4.2.1.12"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26515"
FT                   /db_xref="GOA:Q5ZYF4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF4"
FT                   /protein_id="AAU26515.1"
FT                   /translation="MHPVINQVTENIQNRSAARRAAYLNQIDKARTKGPQRSILHCGNL
FT                   AHGFAACAKQDKAILRGNAKANIAIVSAYNDMLSAHQPYAVFPDLIKEAISAAGGVAQF
FT                   AGGVPAMCDGITQGQPGMELSLLSRDVIALSTAVALSHNMFDGGLLLGICDKIVPGLLM
FT                   AALAFGHLPFIFVPAGPMPSGISNQEKARIRQLYAAGQVDKNALLDVEAASYHTAGTCT
FT                   FYGTANSNQLVIELMGLQLPGSSFVNPNTPLRNELTKAAAYQILSLTDLNSDYMPIGQM
FT                   LDVKNIVNGIIGLLASGGSTNHTMHLVAIAAMAGYWVNWDDFAQLSAIIPLIARIYPNG
FT                   QADINHFQRAGGMAYFVKTLLEADLLHPDVNTVVGFGLDKYTQQPQLIDNRVVWVNGPD
FT                   SSSNNEVLTSATDPFKPQGGLQVLSGNLGRAIIKTSSLYDEHYVIEAPAVVCSSQEEFE
FT                   HLFNQGLLNKNCVVVVRFQGPKACGMPELHQLTPKLGVLMDKGFHVALVTDGRMSGASG
FT                   KVPAAIHVTPEAVDGGGIAKIETGDMILIDCERGILQLLVSDEELAGRSPVAIEGYSSV
FT                   LGMGRELFGNLRLHFTGAEQGACSLFKGNEFFYDAS"
FT   gene            459147..460154
FT                   /gene="glk"
FT                   /locus_tag="lpg0419"
FT   CDS_pept        459147..460154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="lpg0419"
FT                   /product="glucokinase"
FT                   /function="Carbohydrate Metabolism, Metabolism of Complex
FT                   Carbohydrates, Biosynthesis of Secondary Metabolites"
FT                   /EC_number="2.7.1.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26516"
FT                   /db_xref="GOA:Q5ZYF3"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF3"
FT                   /protein_id="AAU26516.1"
FT                   /translation="MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCA
FT                   EFISLESALLTYKNRHSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEV
FT                   LEVMNDFTAIAMSLPVLSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSA
FT                   FAGEGGHADWGAKTEQEWFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEF
FT                   LSAAQIISLALNQECFIAHKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSL
FT                   VHQSDFRIQFEDKGRFSDFNALIPTYVIAAAQPGILGASVSLKQILTGASHVLF"
FT   gene            460141..460803
FT                   /gene="eda"
FT                   /locus_tag="lpg0420"
FT   CDS_pept        460141..460803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="lpg0420"
FT                   /product="multifunctional: 2-keto-3-deoxygluconate
FT                   6-phosphate aldolase/(4-hydroxy-2-oxoglutarate aldolase"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0420"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26517"
FT                   /db_xref="GOA:Q5ZYF2"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF2"
FT                   /protein_id="AAU26517.1"
FT                   /translation="MSFSEWKTQPGAVFAASPVIPVIVIKELEDALPLAEALFAGGIHV
FT                   LEVTLRTPVAIKALELLINTFPDELIGAGTVITPGQFHDVVAAGARFAISPGQTRELLI
FT                   AGQKSEIPLIPGVASVSELMEGLGMGYNHFKFFPAAAAGGIPMLKAISGVFPQVKFCPT
FT                   GGINSKNYEEYLCLPNVACVGGSWIVPEEAIKNHNWSLITELCMAVSSQKRELCSQN"
FT   gene            460916..462337
FT                   /gene="ywtG"
FT                   /locus_tag="lpg0421"
FT   CDS_pept        460916..462337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywtG"
FT                   /locus_tag="lpg0421"
FT                   /product="D-xylose (galactose, arabinose)-proton symporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0421"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26518"
FT                   /db_xref="GOA:Q5ZYF1"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF1"
FT                   /protein_id="AAU26518.1"
FT                   /translation="MAWIVAIIGSIAGFLFGYDEGIIAGSLGLVKNHFNLNATHIGVMA
FT                   SALPFGALFGSLLIGAFMASKCVKRFGRRSLLSFAGFLFFVGALGAGFAETVSVLILSR
FT                   LILGLAIGMASVLTPLYLAETAAVQSRGAVVAIYQLALTVGIVCSYSVNYLLIEQQAWR
FT                   AMFASSAIPALLLTLGILFMPESPRWLCSVGRHGAAANSLRKLRGKQSVEQELKDIEAT
FT                   LANEPKQGNWLLLFQKPLLPVLMLGTILFCLQQLSGINVVIYFAPEIFKNLGLGSTTGQ
FT                   ILATMGIGLVNLLVTIIAILYVDKLGRRKLLLLGFAGTSLSLFALSLFSLNHVAWLSYL
FT                   SVICLMVYIFSFAISVGPIPHIAMAEIFPLHVRGAGMGMSSMSNWLFNTIVIFSFPVLH
FT                   QMFGIEMTFVLYAVICFLGFIYAYIYMPETRNISLEQIETYIMSGKPLRFLGREDEEVN
FT                   AVSTKSESSLLASTN"
FT   gene            complement(462427..463776)
FT                   /gene="legY"
FT                   /locus_tag="lpg0422"
FT   CDS_pept        complement(462427..463776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legY"
FT                   /locus_tag="lpg0422"
FT                   /product="glucoamylase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="3.2.1.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26519"
FT                   /db_xref="GOA:Q5ZYF0"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYF0"
FT                   /protein_id="AAU26519.1"
FT                   /translation="MATFFFKTNYYQEIMLKRIFFLMIFFVSQTMASVFTHEEVQILKK
FT                   HFLNNFQTNGAIVASPSQYNPNYYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVS
FT                   WTEKIQHQADPIAGQDILGEPKFYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDH
FT                   NEIDYVKSHLYNNTMDPQSMGTIKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMAQQKA
FT                   LTDGAILAHQLHDRQAAVFYEMQANLINSRLKQHLDHQNKIIQATLLPHPGPQKTLELD
FT                   SSVMLGILINPQKEGVFAPHHTFVQNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTY
FT                   DGYQTNSIGNPWFILTATMAEYYFTMAHNLSPNSINKLHIQNYLKKGDNYLRLIKQYGP
FT                   DLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLREQLENRIKTTGWNTY"
FT   gene            complement(463902..464138)
FT                   /gene="yozG"
FT                   /locus_tag="lpg0423"
FT   CDS_pept        complement(463902..464138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yozG"
FT                   /locus_tag="lpg0423"
FT                   /product="transcriptional regulator, cro family"
FT                   /function="Transcription factors / DNA binding proteins,
FT                   Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0423"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26520"
FT                   /db_xref="GOA:Q5ZYE9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE9"
FT                   /protein_id="AAU26520.1"
FT                   /translation="MSIIVNLDVMMAKRKCRLRDLAEAIGITEANLSILKNGKAKAIRF
FT                   ATLEAICAYLHCQPGDLLEYQSIEDNHLIKDRA"
FT   gene            complement(464225..464764)
FT                   /locus_tag="lpg0424"
FT   CDS_pept        complement(464225..464764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0424"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0424"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26521"
FT                   /db_xref="GOA:Q5ZYE8"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE8"
FT                   /protein_id="AAU26521.1"
FT                   /translation="MKKIKSVSHLLFLLFKTLAYGLPLVTTYFILFHFESMLNWGGWHS
FT                   LLSTPVKDPSHFSLLHRFIILLIEALPLSINVLICHQLAKLFRLYEHGYLFEEENIRLI
FT                   KNISIYLISGELIQLLYQPLITAALTFTNPSGQRIASITLGTANLSTLITAFIILIASW
FT                   IIKEAHKLKTDALLTI"
FT   gene            complement(464892..465890)
FT                   /gene="hemH"
FT                   /locus_tag="lpg0425"
FT   CDS_pept        complement(464892..465890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="lpg0425"
FT                   /product="ferrochelatase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="4.99.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0425"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26522"
FT                   /db_xref="GOA:Q5ZYE7"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYE7"
FT                   /protein_id="AAU26522.1"
FT                   /translation="MMRRGLLLLNLGTPNNADIRAVKLYLREFLTDKRVIDLPTIPRYI
FT                   LVYCLILPFRSPKSAQAYQSIWTEKGSPLLYHSQNLVTKLQSALKDEYKIALGMRYGTP
FT                   SITTALAELKDCHSLTILPLFPQYSSAATGSAIEKTLSHLANQEIIPSIKIIRDFYQRP
FT                   EYIQAQAKIMKPYIKDNFHLLFSYHGIPERHIHKSGCDTLCPQTCTPIYDKNQACYRAQ
FT                   CYQTSLLLAKELQLGTHQYTTAFQSRLGKTPWIKPYTDEIFAELISKGIKNIVVSCPSF
FT                   VADCLETLEEIGIRAKEQWEKLGGEQFILTPCMNDHPEWIKAIQSIVNEQF"
FT   gene            complement(465998..466231)
FT                   /gene="cspD"
FT                   /locus_tag="lpg0426"
FT   CDS_pept        complement(465998..466231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="lpg0426"
FT                   /product="cold shock protein CspD"
FT                   /function="Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26523"
FT                   /db_xref="GOA:Q5ZYE6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE6"
FT                   /protein_id="AAU26523.1"
FT                   /translation="MARGEVKWFNNAKGWGFIIPEGGGEDIFVHFSSIHGTGYKTLVPG
FT                   QAVTYDVVNGERGLHASNVVALSENAEQEEIA"
FT   gene            466588..466899
FT                   /locus_tag="lpg0427"
FT   CDS_pept        466588..466899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0427"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase,
FT                   histidine triad family protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0427"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26524"
FT                   /db_xref="GOA:Q5ZYE5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE5"
FT                   /protein_id="AAU26524.1"
FT                   /translation="MDIQEIHQLEKSDRFLLIEEINQLSLLASDYFKPDKLNIGALGNI
FT                   VPQLHIHIVIRRKSDPLWPQGIWQASMPSIPYPESELKSLLPTLGDLVGAYDKPQSLC"
FT   gene            complement(467113..467541)
FT                   /locus_tag="lpg0428"
FT   CDS_pept        complement(467113..467541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0428"
FT                   /product="glyoxylase domain hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0428"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26525"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE4"
FT                   /protein_id="AAU26525.1"
FT                   /translation="MFIIVIYNSSNGESIFKFQQGALMIKKIAFTMYPVQNMDRARQFY
FT                   EKTLGLEVGKISAEGAWVEYDLPQGGCFAITTLAQGVIPSAHSGGSVAFEVDNLDDLVF
FT                   QLKSKGVQFKIDLFASPVCRMAIAVDSEGNAFTLHQLT"
FT   gene            467559..468911
FT                   /gene="oprM"
FT                   /locus_tag="lpg0429"
FT   CDS_pept        467559..468911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="lpg0429"
FT                   /product="outer membrane efflux protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26526"
FT                   /db_xref="GOA:Q5ZYE3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE3"
FT                   /protein_id="AAU26526.1"
FT                   /translation="MMCMLKKLMFLLLLGAGLLSCGQSTDQQISNIITPKQFPSSPMDY
FT                   RPVQELPYLAWWKQFQDPELDRLIDTGLKTNMDIHIAMANLQQAQGELQQVKLSWIPNV
FT                   QILGGYSTNPALGVPGGFYGIWPSYILNIMQLYTQQKRAQYQVQYHQAAIDGLRLTLIG
FT                   QVAAAYFTLIAQLEQLKLLYKLDRDLKSLIALSRKEINIGLKNDIDLAQLQSNERLIAA
FT                   QIKPIKHNIVVSQNALRYLINENPGLIKSKNNFAQLDFTRFKPGSLPATVLGNRPDMKM
FT                   AEYSLKAARAGIFVAYSDFFPVMQLDDFIGEAHLPDSTFEQATDAYVNWTINPNTLGKI
FT                   SVSKGVYNAKLAEYVKTVRLILKEVDNAFSANKRMREQFLSYRHAQEDYQHKYKLQNGL
FT                   LKSGLMSYKELLESKVYLDTLALSTNQAKLELAMSLVMLYQDLAGGYACSD"
FT   gene            469036..470088
FT                   /locus_tag="lpg0430"
FT   CDS_pept        469036..470088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0430"
FT                   /product="multidrug resistance efflux pump PmrA"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26527"
FT                   /db_xref="GOA:Q5ZYE2"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE2"
FT                   /protein_id="AAU26527.1"
FT                   /translation="MVGYFMKKLMEYGGKIKEYLLRLKPKRWFTLTNVIIFIGFLTAII
FT                   YVFSYLIPFTDNAFVVNNVRPVAALTSGYITELYVKNGDAVRKGQKLFTVFKKPYEYTV
FT                   EQLSADLAGAQAKLAVLKATYERDLKLSGNEQKIYKKLAQDDQKYLKGYAIKSVSLITL
FT                   QNSQQETKAAKDKWQASLKQLEIDQHQITVQENEIKSIQARLKNAKVNLDLTDVYAQGN
FT                   GVIQNLFFTIGTPVNINQPLFSLVDQDNIYIQANFNETDLRDVRKGSKVLIFPRMYLGR
FT                   KIFHGVIDSDYWSANRQLVDDRTQLQNVINENQWILLPQRLPVIIKVTDPDPKYPLRVG
FT                   ASAYVYVEVY"
FT   gene            470060..470998
FT                   /locus_tag="lpg0431"
FT   CDS_pept        470060..470998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0431"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26528"
FT                   /db_xref="GOA:Q5ZYE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE1"
FT                   /protein_id="AAU26528.1"
FT                   /translation="MLMSMSKFIEWIDEVDPYAVQRIALYKSLFIATVMAYVYWVFRPT
FT                   NFTAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSI
FT                   IALASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFI
FT                   CLRFFPNQYLSVWKRALAKFIQSLELDIEGSFTHRGPKFMQEEMTHLGMLRQYRRLIPK
FT                   KYMIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYTLRCAIKTNTSCGTPKMS
FT                   IMPESKLQQYVMRCLQQAFSQWNQLCMILQH"
FT   gene            470965..471864
FT                   /locus_tag="lpg0432"
FT   CDS_pept        470965..471864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26529"
FT                   /db_xref="GOA:Q5ZYE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYE0"
FT                   /protein_id="AAU26529.1"
FT                   /translation="MESIMHDTSALKKKLDYARFIHLVIMFMVAMLIFLFSTFPEKWWV
FT                   LITVLSVSAGIEPGLIIRRAKHRIGGTLLALIILIPLLYLLQLNYRLISILFVLAIVGL
FT                   SVATLNTRRYDISVFFITLVVFFLMAQTEEATSPRGPFEMVLNRGICTLFGVFIVLAGD
FT                   YFLFQAYRYSHRLYFFHQVIVYDFLNDIVRKIDESNTEKINTLLFVEKLRGQFTEHYLP
FT                   ISISSENLKLDFKTSEHTKKRIDIFQETIWEIRRLVFALCISEFVLHSSTASEQHLQRF
FT                   KLLMNKARTHFIQFEGRY"
FT   gene            471886..472266
FT                   /locus_tag="lpg0433"
FT   CDS_pept        471886..472266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0433"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26530"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD9"
FT                   /protein_id="AAU26530.1"
FT                   /translation="MSHPHYSVYNEKCPSQNVLEGISDKWSILVISLLSQKIYRFGELK
FT                   REIGGISPKMLTQTLLKLERYGFVQRQSYPVLPMKVEYSLTRLGKELSAILVLLTRWTE
FT                   TNMDKIINAEKTFCEQRLGCHA"
FT   gene            complement(472268..472795)
FT                   /locus_tag="lpg0434"
FT   CDS_pept        complement(472268..472795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0434"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26531"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD8"
FT                   /protein_id="AAU26531.1"
FT                   /translation="MAQELVLDDITAMMARYQKTCRYTYTNQSPIIMHPDLKDLLDYRN
FT                   HKIITRYNMDYPTAAMQAEEALHELMKFIWLCHKHKTDKLLYPDDKNLDFSCVIHAEMA
FT                   DIDKMWHTFLLFTRDYHEFCDTRLNGIFFHHDPLIGENTPVSEEDYTLELTRYLTYIHD
FT                   HLGSETLIKWFQ"
FT   gene            472961..473572
FT                   /locus_tag="lpg0435"
FT   CDS_pept        472961..473572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0435"
FT                   /product="SAM-dependent methyltransferase"
FT                   /function="Detoxification / adaptation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0435"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26532"
FT                   /db_xref="GOA:Q5ZYD7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD7"
FT                   /protein_id="AAU26532.1"
FT                   /translation="MNKRNWTAYYNSTKQNTLPRKSLLKAIANFDKEKINLSKSAIDLG
FT                   CGAGIDVMELLRCGWSVIAIDSQLSAIDSLLSSAQELTCANKLKTIISSFEALDSLPKV
FT                   NLINASFSLPFLKPVYFYKFWSVILKGLKPGGRFSGSFFGFNDFWNTRTDMTFLNREMI
FT                   CHLFSQFKIEYFQEEEKDEMDALGYYKHWHKFFIVAKKIA"
FT   gene            complement(473739..474548)
FT                   /gene="legA11"
FT                   /locus_tag="lpg0436"
FT   CDS_pept        complement(473739..474548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legA11"
FT                   /locus_tag="lpg0436"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0436"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26533"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="PDB:4ZHB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD6"
FT                   /protein_id="AAU26533.1"
FT                   /translation="MIKMGRSEMKIASAELRELMKAVSEGHYETVNTILDKDPELVNQY
FT                   APPTYDSPLARVLNKKHIDYKMLDILVKHHVDFDYPINYHKETPIELACKNQDLQLFKY
FT                   LVQHNAPISEQAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCDAEGNRFG
FT                   EQARKSQLINRFGGIVKYDYMQLLQSVYPIVDREVDAPTIHGSTEVLTNLLNKIRGQFS
FT                   SKETYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNAL"
FT   gene            474811..476811
FT                   /locus_tag="lpg0437"
FT   CDS_pept        474811..476811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0437"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26534"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD5"
FT                   /protein_id="AAU26534.1"
FT                   /translation="MQNLDEILKKLRKDLKKTSKETTEKLSVLSKKVAEDVVKVSNQTV
FT                   QKINEVTKKFTVDTTVSTIDTQKILDDFMKNIRFSRFKQIWQAIEKTPKSKHILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKALLPLLIEKVDTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQKTNINLNKYLSLVGNKTDISEFLILTIGLFTSLKIGDKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEKEVQKILEASGNLKRFKPTSNNPRRF
FT                   FETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAGAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMTEYKEDLDLQNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
FT   gene            complement(477096..477314)
FT                   /locus_tag="lpg0438"
FT   CDS_pept        complement(477096..477314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26535"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD4"
FT                   /protein_id="AAU26535.1"
FT                   /translation="MQIFYLFEFNLSTAQLMVIKKLMNMFKALVYTLPEWHLLALSLWH
FT                   NLFILFQDKGQTSLNKHHRKVRNAAVK"
FT   gene            complement(477490..478539)
FT                   /locus_tag="lpg0439"
FT   CDS_pept        complement(477490..478539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0439"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26536"
FT                   /db_xref="GOA:Q5ZYD3"
FT                   /db_xref="PDB:5L0L"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD3"
FT                   /protein_id="AAU26536.1"
FT                   /translation="MADHSPFIKFMFLNIKLSILQYNIILKAIIKLKVAILMTNCKTSN
FT                   TLLLKPILGYSCFNFSISVFILILFYIPLTSGTCWAKKSVNHNEVVMRGKKEFLKHEYS
FT                   PGHWSIDYTRAGTSIAVITVRNKYHYSVILNPTDCRGYRIIIRYLNEGDSTLSSAFNRP
FT                   YTVSEQRGLNDVASLMTQVYEKLGLIVQFSQLGNNSQSFDKGTGVTLIGSEEEPSMLHL
FT                   HMWGRGDPDMEYIAGVPLRGPEPGLMFDLIAKNKTHPINQHAIKWNEEELKACLAMFKL
FT                   KLAEYVNSPEFTEEFGDTLKVTIHDKKDLGEAKESSFGFFHKMKSASDGITTLEKTLAL
FT                   EDDKINPFA"
FT   gene            478631..478843
FT                   /locus_tag="lpg0440"
FT   CDS_pept        478631..478843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0440"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26537"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD2"
FT                   /protein_id="AAU26537.1"
FT                   /translation="MDIHSTYKMLAKMQGNKELSSHKIAETEQAEADTVPQLKLQAEPE
FT                   AKPDMQNILSNMLGISSNKKHSPMD"
FT   gene            479014..479274
FT                   /gene="icmT"
FT                   /locus_tag="lpg0441"
FT   CDS_pept        479014..479274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="lpg0441"
FT                   /product="IcmT"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0441"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26538"
FT                   /db_xref="GOA:Q5ZYD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD1"
FT                   /protein_id="AAU26538.1"
FT                   /translation="MAGGFSATSHWRDSARSARFFVVDARAAFPIFLFLMHIRVWTGVL
FT                   VLVSAIFFGIIEHYGFTVPVFLRWLRSFLAGSVRSARPWWR"
FT   gene            479275..479619
FT                   /gene="icmS"
FT                   /locus_tag="lpg0442"
FT   CDS_pept        479275..479619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmS"
FT                   /locus_tag="lpg0442"
FT                   /product="IcmS"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0442"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26539"
FT                   /db_xref="InterPro:IPR022250"
FT                   /db_xref="PDB:5X1E"
FT                   /db_xref="PDB:5X90"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYD0"
FT                   /protein_id="AAU26539.1"
FT                   /translation="MERDISKCMAKIAASMNAKFYLNDRFVSFDEVFSETGLLPAIAKR
FT                   ADQLCSLCLGYGLGATYDESEGALLGIRVVFDEVTPNVLRLLCMTDVMNELIQGGPSRD
FT                   YTPLDELMYD"
FT   gene            479719..480081
FT                   /gene="icmR"
FT                   /locus_tag="lpg0443"
FT   CDS_pept        479719..480081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmR"
FT                   /locus_tag="lpg0443"
FT                   /product="IcmR"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0443"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26540"
FT                   /db_xref="PDB:3FXD"
FT                   /db_xref="PDB:3FXE"
FT                   /db_xref="PDB:4EYY"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC9"
FT                   /protein_id="AAU26540.1"
FT                   /translation="MGNNTDDSARNPFGFYTPPRVKEIGEPDVTDATLGSVYSEIISPV
FT                   KDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQPILTTKTERMFGAAESEK
FT                   SSEPPSHDERGFKLSS"
FT   gene            480148..480747
FT                   /gene="icmQ"
FT                   /locus_tag="lpg0444"
FT   CDS_pept        480148..480747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmQ"
FT                   /locus_tag="lpg0444"
FT                   /product="IcmQ"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0444"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26541"
FT                   /db_xref="InterPro:IPR013365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC8"
FT                   /protein_id="AAU26541.1"
FT                   /translation="MVPISIEVMKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGK
FT                   KLIAIRDRFLKRIGAASQAKLKAESHLANRIALRSGQQEIYVSLYSSDGSNLQSWEKIV
FT                   GSLPRQMISRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGK
FT                   PLLTLKDKSISLENISRFVHVSGVYRYSNGRLIKNA"
FT   gene            480922..482064
FT                   /gene="icmP"
FT                   /locus_tag="lpg0445"
FT   CDS_pept        480922..482064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmP"
FT                   /locus_tag="lpg0445"
FT                   /product="IcmP (DotM)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0445"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26542"
FT                   /db_xref="GOA:Q5ZYC7"
FT                   /db_xref="PDB:6EXA"
FT                   /db_xref="PDB:6EXB"
FT                   /db_xref="PDB:6EXC"
FT                   /db_xref="PDB:6EXD"
FT                   /db_xref="PDB:6EXE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC7"
FT                   /protein_id="AAU26542.1"
FT                   /translation="MYIEMAQQQQQSGSDNSMAPVWIVILLFITAYFVWALAHQYIVSF
FT                   VFTINIWQARLVNLFLNNQLLANQIYLMQTLDPNTVNWDQMVTVMRAVGDYMRYPVICI
FT                   LVVLAFVLYNSNVTLKYRKTYDMKSLRAQEQFNWPAIMPIVKEDLVSQDVNKGPWAMAL
FT                   TPMEFARKYNLLRKDDALLDNPVPGEEMTAGIRRGDAKRVFTMQLGPYWDGFERCSPQA
FT                   YALSAVFMARMNRDRDAANNILKVLDKTFVDGKPDFSVARPVMKKYQNSELVQEVVAKH
FT                   AYVLTVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYMLNCVGRQTPYSEVAGPFAHWK
FT                   AEKEMGRRSLVPMIDEAIRALEIAVKEVRLTPRQMEELEP"
FT   gene            482061..484412
FT                   /gene="icmO"
FT                   /locus_tag="lpg0446"
FT   CDS_pept        482061..484412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmO"
FT                   /locus_tag="lpg0446"
FT                   /product="IcmO (DotL)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0446"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26543"
FT                   /db_xref="GOA:Q5ZYC6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="PDB:5X1E"
FT                   /db_xref="PDB:5X42"
FT                   /db_xref="PDB:5X90"
FT                   /db_xref="PDB:5XNB"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC6"
FT                   /protein_id="AAU26543.1"
FT                   /translation="MMRGIDSRHELDPTLLLRDTRTFTQRLADFFADPTNISIVLISLA
FT                   AVSYYFSEAATFLLIMGGIFFLYSYTRKQKLPFRLPQISRAKDYNDLKPGINKPNIARG
FT                   ITFFGNDRKTGEELWFANDDMRTHALIFGSTGSGKTETLVSLSYNALVQGSGFIYVDGK
FT                   GDNSLYAKVFSMVRSMGREDDLLLINFMTGARDIVGPQEKRLSNTLNPFCQGSSSMLTQ
FT                   LVVSLMGSSGQSSDGDMWKGRAIAFVEALMRLLVYMRDEGAILLDANTIRNYFDLQRLE
FT                   SIVIDKVFPRDDQESVNIETIPKLVTDPLRNYLNTLPGYNKEKKGKQVSQVLEQHGFIT
FT                   MQLVRSFSSLADTYGHIIRTNLAEVDFKDVVLNRRILVVLLPALEKSPDELSNLGKIIV
FT                   SSLKAMMAAGLGEEVEGDYRDVILRKPTNAPTPYMCILDEYGYYAVQGFAVVPAQARSL
FT                   GFSAIFAGQDLPAFQKASKEEAASIGANTNIKICMKLEDPTETWDFFTKTAGEAYVTKV
FT                   DSFQTKETSIANSYMDTKSSSFEKRARVDLLDLKEQTEGEAHIFFKSKIVRARMFYANP
FT                   KPVKQLKINQFLKVEPPPDDYLMKLQKQLASFQSILESGDLSINKAVENEEITLISKAL
FT                   KESTIVEPIERGVAALIAFHGQNEPEPVEDIVEEEVEGALTIFSKLRIDPNAPPILVAD
FT                   KEVFSEPLLPINETRNQMITIERLAGAKDKYAGTVANELIKDFQIATSYPPEERDVIDV
FT                   QELTGIIRDLSAKISAEREKANKKAAEELT"
FT   gene            484816..485385
FT                   /gene="lphA"
FT                   /locus_tag="lpg0447"
FT   CDS_pept        484816..485385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lphA"
FT                   /locus_tag="lpg0447"
FT                   /product="LphA (DotK)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0447"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26544"
FT                   /db_xref="GOA:Q5ZYC5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC5"
FT                   /protein_id="AAU26544.1"
FT                   /translation="MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRV
FT                   DGACDATIIKMMTDLNKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEIAA
FT                   FLKQFRKIAITVTSYSSKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDK
FT                   PITSYTLGGDRSPNARVEITFRRAVA"
FT   gene            485397..485681
FT                   /gene="icmM"
FT                   /locus_tag="lpg0448"
FT   CDS_pept        485397..485681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmM"
FT                   /locus_tag="lpg0448"
FT                   /product="IcmM (DotJ)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0448"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26545"
FT                   /db_xref="GOA:Q5ZYC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC4"
FT                   /protein_id="AAU26545.1"
FT                   /translation="MSRETWALIKRNKNFNVHIYRRGLTLLILSLGLSCGLSGLIYYVH
FT                   MHEPERDFYATSGITPPIQLKPMSTPNMSSEALLPPDPPDEDSQRIIPQ"
FT   gene            485697..486335
FT                   /gene="icmL"
FT                   /locus_tag="lpg0449"
FT   CDS_pept        485697..486335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmL"
FT                   /locus_tag="lpg0449"
FT                   /product="IcmL (DotI)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26546"
FT                   /db_xref="GOA:Q5ZYC3"
FT                   /db_xref="InterPro:IPR021055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC3"
FT                   /protein_id="AAU26546.1"
FT                   /translation="MAEDALTVVALRNKFYKDSQRKVILALLIAIVVNVVLASLVVYMI
FT                   THPPAPKYFATSINGRITPLFPLDEPNQSDSAVLQWANQAAIAAFTYNFVNYRDELQAS
FT                   SGFFTAEGWDQFLGALEQSNNLDAVKAKKLVVSAVATRAPIILQKGVLNGRYSWRVQMP
FT                   ILVTYQSASEFTQQNNVVTMLITRVSTLNSPRGIGISQFVVGPASGGVS"
FT   gene            486335..487420
FT                   /gene="icmK"
FT                   /locus_tag="lpg0450"
FT   CDS_pept        486335..487420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmK"
FT                   /locus_tag="lpg0450"
FT                   /product="IcmK (DotH)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0450"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26547"
FT                   /db_xref="InterPro:IPR022073"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC2"
FT                   /protein_id="AAU26547.1"
FT                   /translation="MMKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQ
FT                   QKLSQNPSPDAQSGAGDGGDNAASDSTQQPNQSGQANAPAANQTATAGGDGQIISQDDA
FT                   EVIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKAATPGTPPKPTATSQFVNLSPG
FT                   STPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYN
FT                   YGNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLL
FT                   HVLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQ
FT                   KSPVLLVSWHGKVMQLKVEGL"
FT   gene            487425..490571
FT                   /gene="icmE"
FT                   /locus_tag="lpg0451"
FT   CDS_pept        487425..490571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmE"
FT                   /locus_tag="lpg0451"
FT                   /product="IcmE (DotG)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0451"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26548"
FT                   /db_xref="GOA:Q5ZYC1"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC1"
FT                   /protein_id="AAU26548.1"
FT                   /translation="MASKKENLKSLFSNTRTRVIIIFTAALLIIAVVIGFFKIRGATTG
FT                   SIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQAL
FT                   GEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGSCSKSVITKVVNQGAQLTDLK
FT                   AACSCVQLKDSGYGLQELEQVCECKELKSAGYNARQLKEAGYSAGRLRNCGFDACELRN
FT                   AGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQA
FT                   GVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLRRAGFSAAELKDAGFTARDLL
FT                   NAGFTPADLAKAGFSDAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIR
FT                   QYAGCSAQALKAAGFTDADLANAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGV
FT                   SAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPVSIIAD
FT                   GRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAG
FT                   FSAKELKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAA
FT                   GFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKS
FT                   AGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIP
FT                   SIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLTAATQLVQDW
FT                   KQVETQVYTEGTEETKTSGGESAVPGTGTGTGSNNQPVDQGAVSAQNQAIIKTGDIMFA
FT                   VLDTSVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISI
FT                   SAYAIDPNTARTALASRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNN
FT                   ITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI
FT                   "
FT   gene            490586..491395
FT                   /gene="icmG"
FT                   /locus_tag="lpg0452"
FT   CDS_pept        490586..491395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmG"
FT                   /locus_tag="lpg0452"
FT                   /product="IcmG (DotF)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0452"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26549"
FT                   /db_xref="GOA:Q5ZYC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYC0"
FT                   /protein_id="AAU26549.1"
FT                   /translation="MMAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASYQSGKEGLTK
FT                   KKDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTSKPAIPPVTQVATPQPVQTIP
FT                   TTTPIQQVQPTTIIEDDPDLKKKVSAIEMTQQSLRSEVNALSEQINAVNNNIKNLNAQI
FT                   VNLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPIVQARIIYYIQAVIPGRAWL
FT                   IGSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS"
FT   gene            491403..491987
FT                   /gene="icmC"
FT                   /locus_tag="lpg0453"
FT   CDS_pept        491403..491987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmC"
FT                   /locus_tag="lpg0453"
FT                   /product="IcmC (DotE)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0453"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26550"
FT                   /db_xref="GOA:Q5ZYB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB9"
FT                   /protein_id="AAU26550.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSIKEPVMYLMVGALLIYFPSLVSSVLQTTFGYSNP
FT                   LAYSGGVSSGSDTISALFGSGSLVGRPLVMIIRVIGLIAFVRGWVLIARSASQGQPPGG
FT                   TGKGLIHVFGGILAINIVGTVDMINNTLYGT"
FT   gene            492130..492411
FT                   /gene="icmD"
FT                   /locus_tag="lpg0454"
FT   CDS_pept        492130..492411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmD"
FT                   /locus_tag="lpg0454"
FT                   /product="IcmD (DotP)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0454"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26551"
FT                   /db_xref="GOA:Q5ZYB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB8"
FT                   /protein_id="AAU26551.1"
FT                   /translation="MASQITGSFTSLTKLITAGSYLAGLGFSIGAIMKFKQHKDNPTQI
FT                   PIGTPIALIFIAAALLFLPSILGVAGVTMFGGSGGKTAGPTGTIYKTN"
FT   gene            492591..493235
FT                   /gene="icmJ"
FT                   /locus_tag="lpg0455"
FT   CDS_pept        492591..493235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmJ"
FT                   /locus_tag="lpg0455"
FT                   /product="IcmJ (DotN)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0455"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26552"
FT                   /db_xref="GOA:Q5ZYB7"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="PDB:5X1H"
FT                   /db_xref="PDB:5X42"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB7"
FT                   /protein_id="AAU26552.1"
FT                   /translation="MNVNQTMADNQQRCELKLIASPGSWRLYSARKIDERFKSYEQKIF
FT                   QRDRYTCQFCGFQARLYQDIVNLDGDYTNNRLSNLVTACCFCAQCFFVESVGVGGYGGG
FT                   TLIYLPELTQAELNSLCHVLFCAITNDTGYKSSAQNIYRSFKFRSQIVEEKFGEGTSDP
FT                   AIFGQLMIDSGVNSEEIREKLFKNIRLLPSRAKFRKQIEKWAASALEEIAD"
FT   gene            493271..496300
FT                   /gene="icmB"
FT                   /locus_tag="lpg0456"
FT   CDS_pept        493271..496300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmB"
FT                   /locus_tag="lpg0456"
FT                   /product="IcmB (DotO)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0456"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26553"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB6"
FT                   /protein_id="AAU26553.1"
FT                   /translation="MANWSESFFEGVDTFFAWLSTSLKQTTESYIDLETADSPTVLVNH
FT                   DGSLLSVLKIEGITGLAGPEEFERLVEGLANSFQAAMGRPGHALQVYFSHDKQNIVKMI
FT                   KDIYDPAEATASRLELNLRDLFEERVNYLSQYCAEERVYFVLYTRPFNLASDQLKAANK
FT                   AKMKMIKDTKAPPFKNTQTIFAAVPEIRDTHDAYVRAILNDLDALNVIAKLLEVHDAVH
FT                   AIRMTGDPDYTADDWRATLPGDKIPVRELNNFEGDPSDLLWPPLSRQVLPRDAEIIDLR
FT                   TVRVGDKIYASTYIDLFPKDVRPFISLFSRILPSHVPWKISFLLESEGLSTIKLKGLLA
FT                   AILSFSSAQNRLISDSVNLLKYIQLNTDEAIVRLRVVATTWAPEGNIPLLRRRSSELVK
FT                   AIEGWGSTDVSEICGDPFAGFVSSMLATTLNSSAVASVAPLSDVISMLPITRPASPWKT
FT                   GALLFRTPDGKPWPFQPGSTEQTTWIDLVYARPGSGKSVLSNALNLALCLSGGLMRLPR
FT                   IAIIDIGPSSSGLISLLKEALPASKRHLVAYHRLRMTPDYSINPFDTQLGCRYPTALER
FT                   SFLVNFMTLLTTPLGAAKPYDGMADLAGMVVDELYKSMADEFNPTPYAPGIEEFIDGIL
FT                   EEIGFVRDAKSTWWEVTDALYSAGFVHEAMLAQRYAMPLLADAASICRTPSIEDLYEKI
FT                   TAPTGESLINAFSRMISSAVREYPILSRVTSFDIGDARVVSLDLDEVAKSGGDAADRQT
FT                   AVMYMLARYVLARHYYLTEESLNNVPEQYKEYHKQRVLEIREDHKRIVYDEFHRTAKSS
FT                   AVREQVIIDMREGRKWKVQISLLSQAVDDFDPVMIDFATAIYVMDAGPSQAVEKTSQIF
FT                   GLSETAKIALRTRVHGPRQGGATFLAQFATKTGINVQLLTLTLGPVELWAFSTTAEDAT
FT                   VRNLLYRHLGPSEARRLLAALFPNGTVTKELEARLASMKQKVGLIEDDEREGMINQLVN
FT                   DILDAYSKDPNVKSLPAKVG"
FT   gene            complement(496446..497702)
FT                   /gene="tphA"
FT                   /locus_tag="lpg0457"
FT   CDS_pept        complement(496446..497702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tphA"
FT                   /locus_tag="lpg0457"
FT                   /product="TphA (ProP)"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0457"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26554"
FT                   /db_xref="GOA:Q5ZYB5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB5"
FT                   /protein_id="AAU26554.1"
FT                   /translation="MKQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFV
FT                   SLIATFSLFAIGFIMRPIGGLLLGHYADHVGRRKALILSMSVMTISTALIAVLPDFNSW
FT                   GIIAPLLFSVLRLIQGLAVGGELPGSTTYLIEHMFQQSRGLAGSLVLSSAFLGIFIGAL
FT                   TASIFSTLFTGDALLNWGWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKV
FT                   VFTRFKQQLFLSVIITSILAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVL
FT                   IPLMGFLSDVVGRKPIFLIGLFALCLLIFPFFWLLLSGSWWKALCSELLLAIALAPINA
FT                   TVPTIIAEMFPTSVRASGISISYNIGQALFGGTMPLVAFSLIELSSNKMAPAWYLFLWT
FT                   LIVIPITISIRESYQKELT"
FT   gene            complement(497705..500626)
FT                   /gene="icmF"
FT                   /locus_tag="lpg0458"
FT   CDS_pept        complement(497705..500626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmF"
FT                   /locus_tag="lpg0458"
FT                   /product="IcmF"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0458"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26555"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB4"
FT                   /protein_id="AAU26555.1"
FT                   /translation="MDNSLRALCDAIKKILSQLKPQTNQLSFVVITGKNAQGKSALLKQ
FT                   SNMEEMPVFSEEHAKLYFNQKGIIVELGENWLTNSKTLLLTTLKQLNKCNRHLKITGLI
FT                   LCVDVNDLLIAEPAQFTEQKKSHLQLIQRLGVNLGYQAELALIFTKMDTLAGFSEFYQM
FT                   DHVNDLSKPLGFSLDCVNQLSKKIETFSLQFNQLIEALGQQVINKMHPARSTIKRSLIR
FT                   EFPLQLASLRAPIQSLIQGISPKLFHVHSIFFTSAEQGGVSVDRLNKKIQHEYALVVQD
FT                   TFPQATNFRSYFVEGALQTIQEQCIQVPQTTKFSQKPFIAVAVSLAGLSLLTLVYNHYK
FT                   TSHILDEASKELLAYEALNNQGTSGAQALYHLSQAANKMNHITSNSISLPTVHQLKLNL
FT                   HNNAQNRLQGEFLPSLANELEQVITSPGNTPITRYKALKIYLMLGNSKYFSSQPILDWF
FT                   QQQWQGRAPGTTQKQLALLKQTLSNPPQNIPIKSQIISDARNYLNALPTSYLYYSIAKE
FT                   YFPQEKQKIVIEGFSIPTDEVPTYFTKTGFTKIINELPKITSTLQSENWVLARQDLSQL
FT                   HNMLIQAYCFDYVTWWQTFMKKSQPLRYQDYQQGRQLTKLIQQSNSFYKFANLIQQETK
FT                   PDLTEGISTFNQFIANQFTDLNLTTLSSIKELDFRISELERFIATLSVVNDGGKTAFTI
FT                   TRSRFLNENSSDPVSLLYSQARQLPEPLSSWTKQIAGDIWVILIRDSRQYINNQWQKTV
FT                   YREFQNSIAQRYPFDSSQTAEIDIADFNRFFSTHGLLNTYSEQYIKPFLDTSSPEWKPK
FT                   AVNDFILPISNEVIDELIRANIITNMFFPDHSDESKIDFSLQKISLDPVVSNLVLEIGG
FT                   TKLMDNQTSDSLIRFTWPQNNAKLALDSIEGNHYELAEYGTWAIFKLLEKVNVLVDEQD
FT                   SSSLQILFEVNSNSGRYLLKTNNQINPFTPGILNGFTLNDHIA"
FT   gene            complement(500626..501411)
FT                   /gene="icmH"
FT                   /locus_tag="lpg0459"
FT   CDS_pept        complement(500626..501411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmH"
FT                   /locus_tag="lpg0459"
FT                   /product="IcmH (DotU)"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26556"
FT                   /db_xref="GOA:Q5ZYB3"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB3"
FT                   /protein_id="AAU26556.1"
FT                   /translation="MTTEQYPSSLVNRLAITEPALVPSGYYRSKLFIAPFSTNVLVAAA
FT                   GPILSLLERLCLSPSLPPVEDIRENIQHELRAFHSKLDASKYPLDIISIAQYLLSATID
FT                   EILGKSYLRVYNLTTEFKSFTPLSSDGAQPQQRFFEILNYIKERPNQFLDLIELAYFCL
FT                   IAGFEGEYHLKADGRQCLDNTIEDLYQIIQKYRFNKPHRLFNENPLPKTIKKNYKATWI
FT                   TTIAAVGIVILAFVTSHVLLENKAKTVLFGHTQLAMLEN"
FT   gene            complement(501696..503285)
FT                   /gene="purH"
FT                   /locus_tag="lpg0460"
FT   CDS_pept        complement(501696..503285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="lpg0460"
FT                   /product="phosphoribosylamineimidazolecarboxamide
FT                   formyltransferase"
FT                   /function="Nucleotide Metabolism, Metabolism of Cofactors
FT                   and Vitamins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0460"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26557"
FT                   /db_xref="GOA:Q5ZYB2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB2"
FT                   /protein_id="AAU26557.1"
FT                   /translation="MAKKQIYSSFKPRRALLSVSDKRGIRELGQVLHDQGVELIATGNT
FT                   AAILREHKLPVTDVSECTGFPEIMDGRVKTLHPAIHAGLLARGEEDSPVLRQHGIKPID
FT                   LLIVNLYPFEQVINHPDCDFNKAIENIDIGGPAMVRAAAKNHAHTYVIVDPNDYSKLIH
FT                   YLQDQKAPSHWNFALAKKAFAHTAAYDAAIANYLTTLDNDYVPTGFPDILTCQFNKITD
FT                   LRYGENPHQQAIFYADKNSHPGSLSTATLLQGKQLSYNNILDADAALDCVKSFSNEKSV
FT                   CVIVKHTNPCGIALSDTSLDAYLKAFQSDPISAYGGIIAFNGTLDSDTAKAILEKQFVE
FT                   VIIAPDANEEAKKILATKENTRVLLTGFWQQGNNFRLSMKKVDGGLLVQEHDSLSLESC
FT                   ELQTVTQIKPTDEQLQNLMFAWLAAKHVKSNAIVYANDLTTIGIGGGQTSRVMSARIGL
FT                   WQAEQMGFDPKGAVMASDAFIPFPDTIEIAAKAGISAIIQPGGSIRDEKIISCADQHNI
FT                   AMIFTGVRHFKH"
FT   gene            complement(503312..504181)
FT                   /gene="prmA"
FT                   /locus_tag="lpg0461"
FT   CDS_pept        complement(503312..504181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="lpg0461"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /function="Translation"
FT                   /EC_number="2.1.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0461"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26558"
FT                   /db_xref="GOA:Q5ZYB1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYB1"
FT                   /protein_id="AAU26558.1"
FT                   /translation="MWFQLKIEHCPNDKIEEITEELEECGALSITLTDKNDNPVLEPEP
FT                   GTTPLWPEVIIHALFAQAEEAQYAREQLVAKRPSLHCSLELLADKNWERAWMDDFRPQR
FT                   FGNRLWVCPTWLPPPEPDAVNLILDPGLAFGTGTHATTSLCLTWLEQADLKNKSIIDYG
FT                   CGSGILSLAAIKLGAKHVYAVDIDNQALQATQSNAHANHITESQLSISFPEALQNPVHL
FT                   VIANILLAPLISLKERFHQLLPSGAHLVTSGILEEQAPLLIDAYDSAFTHIATEYCEGW
FT                   SLLVFTSK"
FT   gene            complement(504183..505532)
FT                   /gene="accC"
FT                   /locus_tag="lpg0462"
FT   CDS_pept        complement(504183..505532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="lpg0462"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /function="Lipid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0462"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26559"
FT                   /db_xref="GOA:Q5ZYB0"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYB0"
FT                   /protein_id="AAU26559.1"
FT                   /translation="MFMLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVR
FT                   LADETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRF
FT                   IGPRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAA
FT                   GGGGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKG
FT                   HAIHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLF
FT                   QDGCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECR
FT                   INAEDPRNFMPSPGTIKLLHQPGGPGIRFDSHIYSSYVVPPNYDSMIGKLISYGATRAE
FT                   AIARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
FT   gene            complement(505539..506021)
FT                   /locus_tag="lpg0463"
FT   CDS_pept        complement(505539..506021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0463"
FT                   /product="acetyl CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /function="Carbohydrate Metabolism, Lipid Metabolism,
FT                   Biosynthesis of Secondary Metabolites"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0463"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26560"
FT                   /db_xref="GOA:Q5ZYA9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA9"
FT                   /protein_id="AAU26560.1"
FT                   /translation="MDIRKIRKLIELLEETGISEIEIKEGEESLRLSRHSNIVAETAPQ
FT                   IHYVAPSAVKQTASAPSSNTSTTESHVIENKQVTSASSGHKIRSPMVGTMYTAPSPESP
FT                   PFVTVGQSVKAGDTLCIIEAMKMFNEIEADRAGKIVEILVKNGDPVEYDQALFIIE"
FT   gene            complement(506035..506472)
FT                   /gene="aroQ"
FT                   /locus_tag="lpg0464"
FT   CDS_pept        complement(506035..506472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="lpg0464"
FT                   /product="3-dehydroquinate dehydratase type II"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="4.2.1.10"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0464"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26561"
FT                   /db_xref="GOA:Q5ZYA8"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZYA8"
FT                   /protein_id="AAU26561.1"
FT                   /translation="MKKILVLHGPNLNLLGSREPSIYGHASLTQINGDLIQEADNAGIR
FT                   LSCFQSNAEAELIQAVHQAGIDKINYIIINPAAFTHTSIALRDALSAVAIPFIEVHLSN
FT                   IFSRETFRHHSYFSDIAVGVISGLGTKGYLLALQAIIKELK"
FT   gene            complement(506479..506718)
FT                   /locus_tag="lpg0465"
FT   CDS_pept        complement(506479..506718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0465"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26562"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA7"
FT                   /protein_id="AAU26562.1"
FT                   /translation="MGITQGDICYKRFRHKLFLAQEINKNIINLKSVHSLSTIHCFLLN
FT                   IKFLAKLAEILPISSQIYRHVHKVQAKSANLRLY"
FT   gene            506656..508464
FT                   /locus_tag="lpg0466"
FT   CDS_pept        506656..508464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0466"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /EC_number="6.4.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0466"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26563"
FT                   /db_xref="GOA:Q5ZYA6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA6"
FT                   /protein_id="AAU26563.1"
FT                   /translation="MSQEELMSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVG
FT                   FWAMEVWGGATFDACLRFLKEDPWSRLRQLRQMLPNTQLSMLLRGQNLLGYRNYADDVV
FT                   RAFVKLAVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFL
FT                   ELGKKLAEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHY
FT                   EAVLAGCNHIDTAISSFSGGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRK
FT                   KYSQFESEAQNIDPRVQLYQVPGGMISNLYNQLREQNALDKMDAVHKEIPRVRKDLGYP
FT                   PLVTPTSQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTE
FT                   VIEVRPGDLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLL
FT                   TQSSAPDNSVMSEFDIILHGESYHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELH
FT                   DKIERSSVNNKIGPGDITVAIPGSIIAIHVSVGDEVKAGQAVLVIEAMKMETEIKAPAN
FT                   GVVAEILCQKGDKVTPGQVLIRVEVS"
FT   gene            509030..510661
FT                   /locus_tag="lpg0467"
FT   CDS_pept        509030..510661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0467"
FT                   /product="zinc metalloprotease"
FT                   /function="Toxin production / other pathogen functions,
FT                   Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.24.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0467"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26564"
FT                   /db_xref="GOA:Q5ZYA5"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA5"
FT                   /protein_id="AAU26564.1"
FT                   /translation="MHPNYYLSPLAVAIALGIASPVKAADPIPLQKSSFSEVTQKFQLT
FT                   LPGVMKGAVVSTNSLQFIRQHTDGNKVTHVRMQQQYAGFPVFGGYAILHSKNATPSLAT
FT                   AKSDVKMNGVIYDGLQAELGQPKPSFVKNASLALQQFKDKYANKQISEDQVTPMIYIDE
FT                   KHQAHWAYKVSVLVIHDDRIPERPTAIIDAETNKPFVQWDDVKTEKVQAKGMGFGGNRK
FT                   IGEYQFGKDLPLLEITRDSSVEMCFMENTDVKVVDMGHKYYSNNKPMQFTCKETPDTQS
FT                   TKTYYTGYSADGYDRDNGAASPTNDALYAGYVIKHMYHDWYGVEALTKSDGSPMQLVMR
FT                   VHYGQGYENAYWDGKQMTFGDGDTMMYPLVSLGVGGHEISHGFTEQHSGLEYFGQSGGM
FT                   NESFSDMAAQAAEYYSVGKNSWQIGPEIMKEDSGYDALRYMDKPSRDGMSIDVADDYYG
FT                   GLDVHYSSGVYNHLFYILANQPNWNLRMAFDVMVKANMDYWTPYSTFDEGGCGMLSAAK
FT                   DLGYNLDDVKKSLSEVTINYQSCYVD"
FT   gene            complement(510663..511514)
FT                   /locus_tag="lpg0468"
FT   CDS_pept        complement(510663..511514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0468"
FT                   /product="lipase A"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0468"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26565"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA4"
FT                   /protein_id="AAU26565.1"
FT                   /translation="MMKTKILSIPGLSIACKVWGNPDNPPILALHGWLDNANSFDNIAE
FT                   HLQNDYYFIAVDLPGHGHSSHLPPGCIYHFTDGIFTVVEIINALGLNKLHLLGHSMGAC
FT                   LGSLVAGVAPDRFLSLSLIEGLGPFSHPAETACQQLSKYLDYLSQKQSKKAKGYNKFEH
FT                   AALARSVKGYVSLDIAKSLCERGIQQENGLYYWRHDRRLLAPSPLQMTEAQVLSCLTEI
FT                   KAQTYLIWASKGFSFDSDKMKARIQAVKNIKIERLDGGHHIHMEKPEVISRLLAKFYQS
FT                   IK"
FT   gene            511961..512734
FT                   /locus_tag="lpg0469"
FT   CDS_pept        511961..512734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0469"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26566"
FT                   /db_xref="GOA:Q5ZYA3"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA3"
FT                   /protein_id="AAU26566.1"
FT                   /translation="MRDRVSMQPEVRSVSLITYNIHKGFGVGAVRFLLPEMRDAIAGLN
FT                   PDFVFLQEVQGKHRKREKRIVSWPDSPQCEYIAENIWPHYVYAKNAVYQSGHHGNAILS
FT                   KYPFESFESINLSNMNRASRGILHTQLKLDNNIIHLLCVHLGLFKAERTEQCKALIQRI
FT                   KDVVPKNEPLIMAGDFNDWRHVISKILAENLGIEEAFVALEGQHARSFPAIKPALCVDR
FT                   VYFRGMKVQEVACLQGKPWRMLSDHLPLYARFELL"
FT   gene            complement(512912..513922)
FT                   /locus_tag="lpg0470"
FT   CDS_pept        complement(512912..513922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0470"
FT                   /product="fructose bisphosphate aldolase"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="4.1.2.13"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26567"
FT                   /db_xref="GOA:Q5ZYA2"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA2"
FT                   /protein_id="AAU26567.1"
FT                   /translation="MSYEELSNTMEQMLHEGKGILAADESNSTIGKRFASINTENTEEN
FT                   RRDYRLLLATTPDLEQYINGVILFEETFTQTDEHGTPIPELFANKGIIPGIKVDKGLVD
FT                   LANTEHEKVTQGLDGLTERLLHFKKLGAKFAKWRNVYSISEYTPSLTAIKTGAENLGRY
FT                   AAACQSVGIVPIVEPEVLMDGNHSIEHCAEVCEMVLHELFHTLFIHQVELEHIILKPSM
FT                   VTCGKEVAPFSDPEEVADYTISVFRNNVPASVPTINFLSGGQTPQQATANLNAINQIGH
FT                   QPWLLSFSFGRALQEDCLKEWCGNKANIAKAQEALIKRARLNSMACLGEYQNDME"
FT   gene            complement(514072..514818)
FT                   /gene="poxF"
FT                   /locus_tag="lpg0471"
FT   CDS_pept        complement(514072..514818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxF"
FT                   /locus_tag="lpg0471"
FT                   /product="phenol hydroxylase"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26568"
FT                   /db_xref="GOA:Q5ZYA1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA1"
FT                   /protein_id="AAU26568.1"
FT                   /translation="MIFLMQINTFPITLEESFMISPKVKHFIFNCELSPPFEYLPGQFI
FT                   TIHFEHDGKNLKRSYSIANEPKKDNRIEFAAGYFEGGPGTELLYNLKPGDVIHINGPFG
FT                   RLIFRDETPGRYILVATSTGTTPYRAMLNELGQRIEKHPDLQVVILQGVQRSEEILYPD
FT                   DFQAFAKKYPQASFRPYLSRVQKQDLKDNEYSGYVQHAFPELNLNPTRDMVYLCGNPGM
FT                   IDEAFNYLKEHGFSMQHIVREKYISR"
FT   gene            514890..515432
FT                   /locus_tag="lpg0472"
FT   CDS_pept        514890..515432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0472"
FT                   /product="IcmC (DotV)-like"
FT                   /function="Transport and binding, Toxin production / other
FT                   pathogen functions, Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0472"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26569"
FT                   /db_xref="GOA:Q5ZYA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZYA0"
FT                   /protein_id="AAU26569.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
FT   gene            complement(515576..515872)
FT                   /locus_tag="lpg0473"
FT   CDS_pept        complement(515576..515872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0473"
FT                   /product="hypothetical protein"
FT                   /function="Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0473"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26570"
FT                   /db_xref="InterPro:IPR021969"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY99"
FT                   /protein_id="AAU26570.1"
FT                   /translation="MHRVMSNRKNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKNSR
FT                   IYYSPLLQPSVNSEGYKCVLLDPKLKESSPQVYQAIMDFAKANNLKICGEEDL"
FT   gene            516084..516827
FT                   /locus_tag="lpg0474"
FT   CDS_pept        516084..516827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0474"
FT                   /product="CDP-diacylglycerol-serine-O-phosphatidyltransferase"
FT                   /function="Amino Acid Metabolism, Metabolism of Complex
FT                   Lipids"
FT                   /EC_number="2.7.8.8"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0474"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26571"
FT                   /db_xref="GOA:Q5ZY98"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY98"
FT                   /protein_id="AAU26571.1"
FT                   /translation="MRMNKENHSGIYLLPNLLTTVSLFAAFYSIVASTKGQYEAAIVAM
FT                   FIGMIADSLDGRIARLTNTQTEFGAQYDSLSDMVTFGVAPSLLLYNLTLHQLGKFGWLV
FT                   AFIYTAAVALRLARFNTQIGKSDKRYFQGLPCPPAAAVMASFAWICFQNEWENLIVSLF
FT                   TAVLALIVSVLMVSNLRYYSFKEVDYKGKVPFLYVLVMILLFVAIAANPAIVLFASSGI
FT                   YALSGPMLTVISLHKMRKQRRNMSK"
FT   gene            complement(517068..517337)
FT                   /gene="ptsH"
FT                   /locus_tag="lpg0475"
FT   CDS_pept        complement(517068..517337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="lpg0475"
FT                   /product="sugar transport PTS system phosphocarrier HPr
FT                   protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0475"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26572"
FT                   /db_xref="GOA:Q5ZY97"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY97"
FT                   /protein_id="AAU26572.1"
FT                   /translation="MIKTKIKIINRLGLHARASAKFVSTAAKFQSHIDVTKDTQTVNGK
FT                   SIMGVMMLAANKGSELTLEIDGPDEERMNEALVELINNRFGESE"
FT   gene            complement(517528..517827)
FT                   /locus_tag="lpg0476"
FT   CDS_pept        complement(517528..517827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0476"
FT                   /product="sigma-54 modulation protein"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0476"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26573"
FT                   /db_xref="GOA:Q5ZY96"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY96"
FT                   /protein_id="AAU26573.1"
FT                   /translation="MQINITGHGMDVTPALRAFTEEKFDKLERHFDHIRAINVVFDVEK
FT                   VRQIAEATVLVTKGELHASSESEDMYAAIDTLVDKLNRQLIKHKEKLLAHRDRD"
FT   gene            complement(517854..519248)
FT                   /locus_tag="lpg0477"
FT   CDS_pept        complement(517854..519248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0477"
FT                   /product="RNA polymerase signma-54 factor RpoN"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0477"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26574"
FT                   /db_xref="GOA:Q5ZY95"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY95"
FT                   /protein_id="AAU26574.1"
FT                   /translation="MKPTLQIGIGQHLTLTPQLQQAIRLLQLSTFDLQQEIQLVVESNP
FT                   LLEATPVEEKEDAQINTNQNHDEYSDFQWSQLYNNLNKRNNFEENDYNFDNLHCTTTNL
FT                   QDHLNWQLDLTPMSDIDRVIATTIIDAINDDGFLTIPVAEIHASLNSDDFPLDIEEIEA
FT                   VRHRLQLFDPVGCASVNLAETLVLQLEQLPLEPKLLATAKKVILEDIELLGQHNYRQLM
FT                   KNHQISEKTIHEILQVIHKLNPKPGSLIHQDNIEYVIPDLTVKKIDNQWKVFLNQDILP
FT                   RLSINSQYAALIQRANNSLDNQFLKHNLQEARWFLKSIQSRQETLLKVATCIMEYQHGF
FT                   LEFGEEAMEPLILNDVASALDMHESTVSRVTTQKFINTPRGVFELKYFFSSHVNTDSGG
FT                   ECSSTAIRAVIKKLISAENRKKPLSDSKIAQLIGEQGIKVARRTVAKYREAMGIPPSNE
FT                   RKVISS"
FT   gene            complement(519458..519622)
FT                   /gene="rpL33"
FT                   /locus_tag="lpg0478"
FT   CDS_pept        complement(519458..519622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpL33"
FT                   /locus_tag="lpg0478"
FT                   /product="50S ribosomal protein L33"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0478"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26575"
FT                   /db_xref="GOA:Q5ZY94"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY94"
FT                   /protein_id="AAU26575.1"
FT                   /translation="MAAVTIKVKMESTAGTGYYKTTTKNPRNHPEKMELMMYDPKVRKH
FT                   VLFKEKKVK"
FT   gene            complement(519637..519873)
FT                   /gene="rpmB"
FT                   /locus_tag="lpg0479"
FT   CDS_pept        complement(519637..519873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="lpg0479"
FT                   /product="50S ribosomal protein L28"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0479"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26576"
FT                   /db_xref="GOA:Q5ZY93"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY93"
FT                   /protein_id="AAU26576.1"
FT                   /translation="MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENR
FT                   FVTLRLSTKGMRIIDKLGIKAVLDKIRAKGEKI"
FT   gene            519971..520132
FT                   /locus_tag="lpg0480"
FT   CDS_pept        519971..520132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0480"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26577"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY92"
FT                   /protein_id="AAU26577.1"
FT                   /translation="MKYKSGFITKKPKYCNIFTLFSLKTDFSGLLSKQVSGKSRIFNQN
FT                   QYNPEILY"
FT   gene            520139..520819
FT                   /locus_tag="lpg0481"
FT   CDS_pept        520139..520819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0481"
FT                   /product="S-adenosylmethionine-dependent methyltransferase"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /EC_number="2.1.1.33"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0481"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26578"
FT                   /db_xref="GOA:Q5ZY91"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY91"
FT                   /protein_id="AAU26578.1"
FT                   /translation="MMQRKIKSYVLRAGRISNRQQQGLDLWLEDYELKFDSPTPWNFAK
FT                   EFGRHDADTIVEIGFGMGTSLFAMAMNNPQCNYLGIEVHKAGVGSLVADLHEYQISNVR
FT                   VVVHDAVEVLQTKIPENSLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPSGFI
FT                   HCATDWEDYAEHILNVLSSESALFNQQKEGGYSPRPDSRPLTKFELRGERLGHGVWDLV
FT                   FIKK"
FT   gene            520792..521955
FT                   /locus_tag="lpg0482"
FT   CDS_pept        520792..521955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0482"
FT                   /product="endo-1,4 beta-glucanase"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0482"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26579"
FT                   /db_xref="GOA:Q5ZY90"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY90"
FT                   /protein_id="AAU26579.1"
FT                   /translation="MGSGFYKKIRKLSMIKHAILVSGLIVSFLASAAEMSFLAQLTEVP
FT                   GASGHEKNVRHLVQKQWQPYMEELKIDGMGNLIGQRRDNQKGPKLLFMAHLDETGFMVE
FT                   SITPDGFLKVIPLGGIANSVIYAQRWTVSTPKGSVLAYSGMDSPHLLGDKKMLGSPDIN
FT                   ALFLDIGAENKEQAQKEFAIQPGLEVTPVSEFSQLSKNRFLGKALDDRLGLAVISDALR
FT                   AVKQQPNQLYLAATVQEEVGMRGASTVYKATHPDIAINVEVGIADDYPMLLADRKGRIG
FT                   LGKGPSLFVYDKSMIPNQELINWIMELANKNNIPLQLEVEPGYGEDGSKVQASGMGVPV
FT                   VNIGIPIRYAHQHAGIFDKRDYDNTVKLLSLIAESLNQEVVDKIKKS"
FT   gene            522033..523520
FT                   /gene="legA12"
FT                   /locus_tag="lpg0483"
FT   CDS_pept        522033..523520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legA12"
FT                   /locus_tag="lpg0483"
FT                   /product="ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0483"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26580"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="PDB:5VRQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY89"
FT                   /protein_id="AAU26580.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKLEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVAGKISLALHL
FT                   LGVDENNFTPGESEKTDVLSILSKVRKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   AKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLASMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKADALRGIAMLICRGAEPPRNEKMRNLLSSNRVAFLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQSSPRVVLK"
FT   gene            523728..524870
FT                   /gene="hflK"
FT                   /locus_tag="lpg0484"
FT   CDS_pept        523728..524870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="lpg0484"
FT                   /product="HflK protein"
FT                   /function="Protein fate / hydrolases / secretion, Viral
FT                   functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0484"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26581"
FT                   /db_xref="GOA:Q5ZY88"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY88"
FT                   /protein_id="AAU26581.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYVETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VPQSENLKAIKNGTNVSNEEDNLILSGRDLTRPTYSQGRD"
FT   gene            524867..525787
FT                   /gene="hflC"
FT                   /locus_tag="lpg0485"
FT   CDS_pept        524867..525787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="lpg0485"
FT                   /product="HflC protein"
FT                   /function="Transcription factors / DNA binding proteins,
FT                   Viral functions / Phage / Transposases"
FT                   /EC_number="3.4.-.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0485"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26582"
FT                   /db_xref="GOA:Q5ZY87"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY87"
FT                   /protein_id="AAU26582.1"
FT                   /translation="MRMNAFKTTLGVLIFLVLVLLFTSMFTVTQGQQGIILRLGRLVKD
FT                   PQTDAVKVLNPGLHFKTPFIESVRIFDTRIQTMDIKSTRIVTKEKKDVMVDYYVKWRIS
FT                   DLAQYFKSTGGNEFKAETLLEQQLNTLLRAQFGKRTISDAVSGGRDDVMEILRNAAEKQ
FT                   AGELGIKVVDVRIKGIELPSNTSNAIYQRMRADMQKIANRHRADGQAAAEQIQAKADAD
FT                   VTVLLAKTKSNAQRIRAVGEAEAAAIYSKAYTQNPDFFALYKSLLAYEASFHSKKDILI
FT                   LDQSSSFFDYFKQAMPKNDGTAAKK"
FT   gene            525922..527217
FT                   /gene="purA"
FT                   /locus_tag="lpg0486"
FT   CDS_pept        525922..527217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="lpg0486"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="Nucleotide Metabolism, Amino Acid Metabolism"
FT                   /EC_number="6.3.4.4"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26583"
FT                   /db_xref="GOA:Q5ZY86"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY86"
FT                   /protein_id="AAU26583.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTLK
FT                   INGVKTVLRLIPSGMLRPNVTCYIANGVVLSPQALLSEIKELEGNGINVRERLRISLAC
FT                   PLILPYHIALDKARETHMGKSAIGTTGRGIGPAYEDKVARRALRVGDLFHRDRFANKLT
FT                   ELLDYHNFVLTQYFKQPAVDLESLLGESLQWAEELRPMVCDVSACLHEHRKQGENILFE
FT                   GAQGVYLDIDHGTYPYVTSSNTCVGSVINGAGFGPRYIDYVLGITKAYTTRVGGGPFPT
FT                   ELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIELNSISGLCVTKLDVLDGLE
FT                   VLRIAVAYKDRDGNILSRPPLAADDFNDLLPVYEELPGWQESTADVTVMSDLPANARAY
FT                   LKRIEEILGIPIDMLSTGPERDSTITLRGPFL"
FT   gene            527438..528013
FT                   /locus_tag="lpg0487"
FT   CDS_pept        527438..528013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0487"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0487"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26584"
FT                   /db_xref="GOA:Q5ZY85"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY85"
FT                   /protein_id="AAU26584.1"
FT                   /translation="MEYLTPKGLIPFITELKALNILQQDDNTNIALVSEILARWVVDKD
FT                   WLEKKFYYVNPEVGFNSWLIHEEKDHTLAVNIVAWQSGREITPHDHQTWGVVGSIIGVE
FT                   KNYFWKRMDDGSKPGYAEIIREKMAVIRPAGGVIGFLPNDIHSVMNESDDVAISLHVYG
FT                   KNLNYTGRHQYDPVNNLMQPFIVNYRAC"
FT   gene            528190..528624
FT                   /locus_tag="lpg0488"
FT   CDS_pept        528190..528624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0488"
FT                   /product="transposase (IS4 family, ISSod6)"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0488"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26585"
FT                   /db_xref="GOA:Q5ZY84"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY84"
FT                   /protein_id="AAU26585.1"
FT                   /translation="MKTIETIGKSIAGNTTKIHMAVDAFGFPISFQLICGEVHDAKAAP
FT                   DLISSLPIATYTIADKGYDSEEIREQIKQKSSIPIIPRKKNSKTGNAEVDRGLYKYRHL
FT                   VENIFARLKQFRAIATRYDKLKRNYASTLAMACSYIWLPM"
FT   gene            528685..528975
FT                   /locus_tag="lpg0489"
FT   CDS_pept        528685..528975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0489"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0489"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26586"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY83"
FT                   /protein_id="AAU26586.1"
FT                   /translation="MKSFYAYIMASKRNGTLYVGSTSDLIKRVWEHKNKVIPGFSARYN
FT                   VHILVYYEVHETYIEAARREKRFKNWCRQWKLNLIEELNPEWRDLYEEICS"
FT   gene            complement(529250..529564)
FT                   /locus_tag="lpg0490"
FT   CDS_pept        complement(529250..529564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0490"
FT                   /product="arginine repressor"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0490"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26587"
FT                   /db_xref="GOA:Q5ZY82"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY82"
FT                   /protein_id="AAU26587.1"
FT                   /translation="MKIAKVSGYYKIIDYNQPGLPLVLNVQVSDFGLIILQTHPGNANS
FT                   LAYYIDRKYVSFSIKDSANSGILGTIAGDDTVLLIIKSKSDQQKVLDILMKEFPYLFAS
FT                   "
FT   gene            529838..530572
FT                   /locus_tag="lpg0491"
FT   CDS_pept        529838..530572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0491"
FT                   /product="amino acid (glutamine) ABC transporter,
FT                   periplasmic amino acid binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0491"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26588"
FT                   /db_xref="GOA:Q5ZY81"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY81"
FT                   /protein_id="AAU26588.1"
FT                   /translation="MKKICLLLLISSFILISSCNEQKNQNTLRFSTSAEYPPFEYIENG
FT                   EIKGFDIDLAKLIAKELGKEAVFDNMQFSTVLPALNSGQDDVAIATITITEERKKNFDF
FT                   SIPYYFEGMAAVFDISQPVKEISQLTGKKIAVQLGTVMEIWLHQNFPNAEITALDNNNQ
FT                   AIEALIAGHVDVVLMDGAQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSA
FT                   LENLKAKGEIQKLESIWIKGSI"
FT   gene            530551..531216
FT                   /gene="yqiY"
FT                   /locus_tag="lpg0492"
FT   CDS_pept        530551..531216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiY"
FT                   /locus_tag="lpg0492"
FT                   /product="amino acid (glutamine) ABC transporter, permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0492"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26589"
FT                   /db_xref="GOA:Q5ZY80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY80"
FT                   /protein_id="AAU26589.1"
FT                   /translation="MDKGVNMMEVVQNLFFIGKGIVLTMQLLTGGMLIGVLLGSLLSIC
FT                   RHQGIACFVINRFISILRGTPLILQLSFIYFAVPVLLGMRPSILVAGIVAFGLNSSAYF
FT                   AEILRAGIESLPKGQFEAALTLQIPSFYLWKDIILPQVVRNIFPAMINEMIALLKETAL
FT                   ISTIGGMDLMRQAQTLAAQQFTYFMPLCITGFYYYSLVLLLEALGKKIEKRGHYAASH"
FT   gene            531200..531868
FT                   /locus_tag="lpg0493"
FT   CDS_pept        531200..531868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0493"
FT                   /product="amino acid (glutamine) ABC transporter, ATP
FT                   binding component"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0493"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26590"
FT                   /db_xref="GOA:Q5ZY79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY79"
FT                   /protein_id="AAU26590.1"
FT                   /translation="MLQVINASKKIGNAQVLNEINLSIQANSIVGLVGPSGSGKTTLLR
FT                   CIQQLESIDSGSIQCEGKSGFMFQDFQLFPHMTVLNNLIYAPSLHDKTADHIANAWALL
FT                   AMLGLSDKAHSYPQGLSGGQKQRVALARSLMMKPDLLLCDEPTSGLDMATTNDVIALLN
FT                   TVKTLKITMLIASHDLFFLSNIAERLLVVKQGQLIADFKTQEVPDPILYLQQFYQGEIL
FT                   "
FT   gene            531865..533082
FT                   /gene="argG"
FT                   /locus_tag="lpg0494"
FT   CDS_pept        531865..533082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="lpg0494"
FT                   /product="argininosuccinate synthase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="6.3.4.5"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0494"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26591"
FT                   /db_xref="GOA:Q5ZY78"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY78"
FT                   /protein_id="AAU26591.1"
FT                   /translation="MKKVIKKIALAYSGGLDTSIMIPWLKEHYEHAEVIAVICDLGQQE
FT                   DLDAIKNKALKSGASKAYVVDVKNEFATQYLWPLVKSGALYEDQYILGTISRPLIAQKL
FT                   VEIALTEQVNAVAHGATGKGNDQVRFEYSIKALAPQLEIIAPWRTWDIKSRQEAIVYAK
FT                   AHGIEVPVTPKAPYSRDHNIWYISHEGGVLEDPSQEMPNDVLLMTAPVSQTPDEEEVVV
FT                   LDFKKGVPVALNGQELSPVDLLNSLNQKAGQHGIGVADIVENRLVGMKIRGIYEAPAAA
FT                   VLYKAHKLLESLCLTRSTLHLKQSLQQTYANLVYEGRWFSQTKQALDAFIDVTQQHVTG
FT                   CVKLKLFKGNIIPAGMHSPYSLHHPELATFEEDNVYNQKDAEGFINLFSLSAKIYSQVH
FT                   QGGNYD"
FT   gene            532985..534310
FT                   /gene="argH"
FT                   /locus_tag="lpg0495"
FT   CDS_pept        532985..534310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="lpg0495"
FT                   /product="argininosuccinate lyase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="4.3.2.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0495"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26592"
FT                   /db_xref="GOA:Q5ZY77"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY77"
FT                   /protein_id="AAU26592.1"
FT                   /translation="MYTTKKMRKDSLTSFLYPLKFIARYIRGGIMTNKTWGGRFKKSLD
FT                   SSVNQFNASLSFDHVLFDQDINGSQVHVKQLAKQKILTEAECQEIYSALEEIRTEIKQG
FT                   QYSFNERDEEDIHMFIEQLLIQKIGDLGKKLHTGRSRNDQVALDLRLYTRDKGCLINEL
FT                   LTRLIDCLDDLTSKHQQDLMPGYTHLQQAQPVTLGAYFNAYQCMFSRDKSRLEDWFKRM
FT                   NYSPLGAGALAGSTLPLDREWVAESLGFAGIIPNTLDAVSDRDFVIELCSVAAMIMMHL
FT                   SRLCEDLILWSTQEFNFVTLDDAFATGSSLMPNKKNPDVPELIRGKSGRVYGHLMAILT
FT                   VMKGLPLAYNKDMQEDKEGLFDTINTIIVCLQMITPFLQSLTFNTPLMRTKAQSGYLDA
FT                   TAILESLVMKGMPFRDAHHQVGAWIAEAIEKQCSLNELLKGG"
FT   gene            534313..535428
FT                   /gene="argF"
FT                   /locus_tag="lpg0496"
FT   CDS_pept        534313..535428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="lpg0496"
FT                   /product="ornithine carbamoyltransferase"
FT                   /function="Amino Acid Metabolism"
FT                   /EC_number="2.1.3.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0496"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26593"
FT                   /db_xref="GOA:Q5ZY76"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY76"
FT                   /protein_id="AAU26593.1"
FT                   /translation="MSFSTSTNLTPIEMQDDGLEKIQSQNNPCAINEVKTNTFVINLQQ
FT                   AIFGLETGSEAVDFVSHKDTGFPFPAGEYKPRHFLTGTELAREEIQFILSQARSLKQNP
FT                   GLYNQALANKSLVMIFEKPSFRTRLSFALAIQSMGGIVVESIANSRKQETPADMARVLN
FT                   GYADFVMVRTHEDSFLQEMAEYSKIPIINGLSALHHPCQILADLLSLEEQFGALKGLTL
FT                   TYIGDGNNILHSLMLLAPQLGVTVHYCCPKSNQPNEAIVKEAQSKAGKQMIYYFDKPEE
FT                   AVKQADAVYTDVWTSMGFDNPEAGKIFKGFQVNETLMSHAKPDSVFMHCMPMERGKEVS
FT                   ATLPDSASSIIFTQSENRMHVQKALMLFLDQ"
FT   gene            complement(535517..536992)
FT                   /locus_tag="lpg0497"
FT   CDS_pept        complement(535517..536992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0497"
FT                   /product="adenosine deaminase"
FT                   /function="Nucleotide Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0497"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26594"
FT                   /db_xref="GOA:Q5ZY75"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY75"
FT                   /protein_id="AAU26594.1"
FT                   /translation="MNITRLLAFFTSSFFLCPTYASVDSYFSHIKKDSSALYAFFKTMP
FT                   KGGELHYHLAGGAYPETMLALAANGNYCLDKHTFAVSKDSSHCEGVNVKEVFNNPELYS
FT                   NIIKDWSMKDFIPGKESGHDHFFNGFIKYMPIVFDYQPQLLADIVQRAAQQKAQYLEIM
FT                   TIPDNAQSLTYGDLIKDIPSYDQKRRLLLANKDFQSNIQNTVLESDRILTKASQELRCN
FT                   ENPASDSCHVKIKFLYYVLREQPVDNVFAQALNAFEAVSKSKGNLIGVNLVQPEDGIIS
FT                   LRDYQKHMSIFEYLHRIYPNVPITLHAGELSPQAVTPENLSHHIRDALLIGHAQRIGHG
FT                   VDIGYENNAEDTLKYMANHHIPVEINLISNLKILDISGSNHPLNYYLSHNVPVVLSTDD
FT                   EGVLRTDLTQQYVEAAKEHGLSYQQLKQINRNTLTYSFLPGKSIWANADKAELVPDCHD
FT                   LGSKSCQKFIAHNEKAKLQWNLEQQLIAFEKSY"
FT   gene            537107..538285
FT                   /locus_tag="lpg0498"
FT   CDS_pept        537107..538285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0498"
FT                   /product="leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26595"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY74"
FT                   /protein_id="AAU26595.1"
FT                   /translation="MYFFIIHCRMFLRFNTWKKKMPYFYTRLAPLFFVFVIALIFINFS
FT                   YAHEFQTDSKNKHKVDVHIGIYAPFSSHSAFIGRNILAAMEMGSERLQSSDIHYSFYTL
FT                   DQLPKNKNAGLVLQKFIDTHHINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTEVADG
FT                   RNNFIVWSPAYDQAKVLVNELKRQQVHHLGIITANQPSSTALTHSVIKQLQSDSHIDVA
FT                   ASEYFEPGNKDFSRLTNRIKRKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERA
FT                   TPEVVKVFEGQWYVDSHEMQPDFINEFKQNYLNYPVTEAGYAFDLFQLLNKSIVMAIRT
FT                   QGSPTTSQEVVHQLHDIANGTGVMGTMVLDSKGSLFTKSEVKTVKNGEIHTV"
FT   gene            complement(538358..539695)
FT                   /locus_tag="lpg0499"
FT   CDS_pept        complement(538358..539695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0499"
FT                   /product="carboxy-terminal protease"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.21.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0499"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26596"
FT                   /db_xref="GOA:Q5ZY73"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY73"
FT                   /protein_id="AAU26596.1"
FT                   /translation="MVIKKLFSSTLALVYALTLMLPLTAFSAEETNSNYSNTKRIPLED
FT                   VQRFSNAIGEIKKYYVKPVDDKELFDNAIRGMLTGLDPHSSYLNEEEFKELQTSTSGEF
FT                   GGLGIEVTMEEGVVKVITPLVDTPAFKAGIKSGDYIIKLGKESVQGLSLKDAVNLMRGK
FT                   PGTTIELTILRKGVNKPLTFDLIREVIQIKSVKSKMLSEGYGYIRLTQFQALTGKDMIK
FT                   AIEQLKQQAGGKLKGLVLDLRNNPGGLLDSAIQVSDAFLGNDKAGKQEMIVYTEGRLPG
FT                   SKFTALANPGDVLDNAPIVVLINNGSASASEIVAGALKDNKRAIILGTKSFGKGSVQTV
FT                   LPLDGKTGIKLTTALYYTPSGVSIQAKGIIPDIIVEEVDVPKNAVKKDTLAGFTEADLN
FT                   GHLINKDNSENTESKNNQIQTGDLIHEDYQLYAALTVLEGMALANR"
FT   gene            complement(539776..540945)
FT                   /locus_tag="lpg0500"
FT   CDS_pept        complement(539776..540945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0500"
FT                   /product="peptidase, M23/M37 family"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0500"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26597"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY72"
FT                   /protein_id="AAU26597.1"
FT                   /translation="MVVSFWKKTMRIPSLSKSLSGASLGLALMVILFFCNGLEAKAAPN
FT                   SITQAQTKLKQLDAKINKLKQVLANAQDKRTVLNQELGSTEKQIGEGIRKLRIIQANMS
FT                   AKEKSIAELQGKINHLNKRLQAQQEMLANHVRARYQMGEYQPLKWLINQDEPFKINRIL
FT                   TYYQYIIRSRQQLIDEIARTRQNLNDSKTKLGNELAENKQLQFKLSQNQKQLEQNKRYH
FT                   STLIQSIDNDIQNNQQSLKDFQKDRDNLSHLMKSLSQQSVIQSGKPFTGMRKKLPLPVQ
FT                   TTHRSLRRMNQGVTFFADEGSIVTAVYPGKVVFSDWLKGYGLLLIIDHGQGFMTLYAHN
FT                   QSLFKRKGQIVQQNEQIASVGHTGGIKQNGLYFEIRQRGKAVNPLDWLS"
FT   gene            complement(540905..542449)
FT                   /gene="pgm"
FT                   /locus_tag="lpg0501"
FT   CDS_pept        complement(540905..542449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="lpg0501"
FT                   /product="phosphoglycerate mutase, 2,3-bisphosphoglycerate
FT                   independent"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="5.4.2.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0501"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26598"
FT                   /db_xref="GOA:Q5ZY71"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY71"
FT                   /protein_id="AAU26598.1"
FT                   /translation="MSHNAPLVLMILDGWGYNENDRYNAIAKANTPQWDEWWQTCPHIL
FT                   LKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNGKFAKNAVFHEVIDQ
FT                   LKKTEKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALD
FT                   SLKCLNEELAKHPVATINSICGRYYAMDRDKRWERVEPVYNLLTQGKSERQFPDAETAI
FT                   HFYYKNKISDEFVPPTLIGKEHSIQDGDAVLFFNFRADRARQLTSTFLDPSFKGFERKT
FT                   LPKLSYFVSMTQYDKNLLTTTAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFF
FT                   NGGCESVFTNEERIMVPSPQVATYDLQPEMSAHELTKTLIAAINSQDYHVIICNYANAD
FT                   MVGHTGNFEATVQAIECLDQCMQQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTA
FT                   HTSEPVPFLYVGGGWHFTHSEGSLIDIAPSLLALLGITPPPEMTGRILLEKNHAHP"
FT   gene            complement(542925..544196)
FT                   /locus_tag="lpg0502"
FT   CDS_pept        complement(542925..544196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0502"
FT                   /product="phosphatidylcholine hydrolyzing phospholipase"
FT                   /function="Metabolism of Complex Lipids"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0502"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26599"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY70"
FT                   /protein_id="AAU26599.1"
FT                   /translation="MKKSIHRLVKPRLFAMSISLLAFSSITYGESNGSFALSEHWSMGQ
FT                   QIKLRFDINEVPQSGVVLHLKNGLALTAGDIISLGDLYGIVGKPISHGLTKLEKQTRFK
FT                   EVFNSFARNAIAVSEVEDLNSVIRAEMREVESGIAKGETAEAIYKRIGNEVGRQINCIT
FT                   GGGCNSLTWWLNPGRYLKLAMENYDHFTPNNLIAYKSGHHVALQQALKAKRTGKRSDLE
FT                   VAYAMDAFACHYLSDHFAAGHLRTPREELSAIITPTVLGALLSNYMHNEENKYGIHVTN
FT                   NLGEQWMVYGDYSYFNPFNQTNQQMLLKALQASADEIFEAYYSGVLPEKNQIEDMIPHI
FT                   TKLNDENNMDIAPMFYWDKENKQLLRRTNLANPYDRHWTNSWWGWSTLLLLKTQYGITS
FT                   TVQLSLSKYLSQYVPEELQDNPLV"
FT   gene            544546..545262
FT                   /gene="uppS"
FT                   /locus_tag="lpg0503"
FT   CDS_pept        544546..545262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="lpg0503"
FT                   /product="undecaprenyl diphosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26600"
FT                   /db_xref="GOA:Q5ZY69"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY69"
FT                   /protein_id="AAU26600.1"
FT                   /translation="MNHKLPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCC
FT                   LEKKISCLSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPL
FT                   SQILQKQMCDAEALTKNNQQLILNVVVNYGGKWDIVTAARKLIRTVLDGKLAYDEINEA
FT                   VFAQFLDTNGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTDVHWPDFNEHEFELALI
FT                   SFAKRARRFGQISQSE"
FT   gene            545216..546070
FT                   /gene="cdsA"
FT                   /locus_tag="lpg0504"
FT   CDS_pept        545216..546070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="lpg0504"
FT                   /product="phosphatidate cytidyltransferase"
FT                   /function="Metabolism of Complex Lipids"
FT                   /EC_number="2.7.7.41"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26601"
FT                   /db_xref="GOA:Q5ZY68"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY68"
FT                   /protein_id="AAU26601.1"
FT                   /translation="MPSGQEGLDKFHNLNKGKTMFMQRLITTLILVPLVLLAIFYAPSW
FT                   ILWGVVLVILLLAGMECFKLIPVDNLTVQACFLIFLLMCFWACGYFYSYWLSVGLLVWL
FT                   LNGLAILTYPRSQNYWGYPIVVAIASLILLPLFTQSLMQISFLQQGKELLVYLLFLIWA
FT                   SDIGAYLTGKQWGKHKLIPKVSPGKSWEGVTGGVILAMIVATLGYYYFIPYSIYIWFGL
FT                   ALSTVVISIFGDLFISILKRRCQLKDTGNIIPGHGGILDRLDSLIAALPWFYFGLTYIP
FT                   LGI"
FT   gene            546028..547455
FT                   /gene="yaeL"
FT                   /locus_tag="lpg0505"
FT   CDS_pept        546028..547455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeL"
FT                   /locus_tag="lpg0505"
FT                   /product="membrane associated zinc metalloprotease"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /EC_number="3.4.24.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0505"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26602"
FT                   /db_xref="GOA:Q5ZY67"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY67"
FT                   /protein_id="AAU26602.1"
FT                   /translation="MVLLWINLHTTGNLIFWSYQSLDNDMLSTLLYFLLALVLLVTIHE
FT                   YGHFQVARWCGVKVLRFSFGFGKILARFYDKKGTEYAWSLFPLGGYVKMLDETEGEVSE
FT                   KEKPFAFNNQSVLVRIAIVVAGPLFNFIFAFVALWLVLVIGMHSLAPMIESVKPNSIAA
FT                   RAGLVPKQEILALNGVKINSWRDFQYEIMPLIGSQETVSLTVKSMINGEESTLYLPLDK
FT                   WQLDDKKPDPIKSLGIVPFIPTIPPIVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWL
FT                   YLVSYVRERPNSQINLDIKRQGKLMDITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLR
FT                   LEQQPPISALGTAFKQTVQLTGTTFILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGL
FT                   VSYLFFLALVSISLGALNLLPIPMLDGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLL
FT                   VALMFVALSNDISRLTS"
FT   gene            547578..549938
FT                   /locus_tag="lpg0506"
FT   CDS_pept        547578..549938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0506"
FT                   /product="outer membrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0506"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26603"
FT                   /db_xref="GOA:Q5ZY66"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY66"
FT                   /protein_id="AAU26603.1"
FT                   /translation="MVFNFISARSAGRKIIMKKVSNKLILGVCCSTLLAWSSQSFSSDT
FT                   FIVKGIRVNGLQRVSTGTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGN
FT                   VLVVNVVERATIGSITVVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAY
FT                   TARGKYNSRIETKVTPLTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLS
FT                   TSNLFTYFTKKDQYSKAGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIH
FT                   IEEGPQYHFSGYDVVGKTILPKEKIDSLIQVKKGDIFSRKKVTESISAIGLALGDVGYG
FT                   FPAINAEPRIDENNKTVFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLL
FT                   SLHNIKESERQLRMLGYLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNG
FT                   YQFNASVNQRNFMGSGRSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDP
FT                   KNLNVSTYSSNRYGGDISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNH
FT                   FQEIRLTSGWSRNSYDQMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTR
FT                   GWIFSVLGNVGYGNTFDNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGAN
FT                   FLVNGSVGLILPYPLSRDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWR
FT                   SPFGPLSFSLAKALNPQPLDQTQLFQFALSSGF"
FT   gene            550052..550552
FT                   /locus_tag="lpg0507"
FT   CDS_pept        550052..550552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0507"
FT                   /product="outer membrane protein OmpH"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26604"
FT                   /db_xref="GOA:Q5ZY65"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY65"
FT                   /protein_id="AAU26604.1"
FT                   /translation="MKRLGAVLVALFLGLFGTTVFADWAKIGVVDLQKIMQTSNQMKEI
FT                   QQKLEKEFKPRRDKLVAMEASLKSDMEKFKRDSAIMSASQKKELEKKIVASQQQFERDG
FT                   QQYQQELSTAHNEAMEGLYNKVRTAITKIAKDEKYDIIVQKDAAPFSSESLDVTDKVIK
FT                   AIN"
FT   gene            550566..551585
FT                   /gene="lpxD"
FT                   /locus_tag="lpg0508"
FT   CDS_pept        550566..551585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="lpg0508"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="2.3.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0508"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26605"
FT                   /db_xref="GOA:Q5ZY64"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY64"
FT                   /protein_id="AAU26605.1"
FT                   /translation="MLTIEELAKHLNGVWHGHANHAIFSVSSLARASSKDLVYFDNPLL
FT                   RPVLNSTRAGAVLLKSEHKDWCPVNCVVVSNPSEAMFKAAKILPQPGVIVSGIHPTAQI
FT                   HKSAQLGQNVSVGANSMIGEGVQIDDNVTVGPNTTIESSVLIGRGSQLGAGAIIHSGTV
FT                   LGQSVIIGSGGIVGAAPFNCYKEHGVWQQGPIFGGVVIGQRTQIGANTVIHRGSIGDTY
FT                   LGEGVCIDSLVLIAHDVYVGNNTAIAGSAAIGALVQIGMDCIIGGASCLAANIRLTNDV
FT                   VITGMSTVTKSIMRSGIYSSGTTVHDHRKWRRNTARFRHLDDYITKLITIEKKLNNNN"
FT   gene            complement(551331..551666)
FT                   /locus_tag="lpg0509"
FT   CDS_pept        complement(551331..551666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0509"
FT                   /product="hypothetical sugar transporter family"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0509"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26606"
FT                   /db_xref="GOA:Q5ZY63"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY63"
FT                   /protein_id="AAU26606.1"
FT                   /translation="MAHYLGLAHSNQLKISKIMLLQIVKTYLVVIIQFFFYCYQLGNIV
FT                   IQMPEPCRVTTPLAMIVNRRSRRINSRTHDGFCHSRHPGYHYIIGQTNIRCKATCSTYN
FT                   TIHSYLH"
FT   gene            551703..552155
FT                   /gene="fabZ"
FT                   /locus_tag="lpg0510"
FT   CDS_pept        551703..552155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="lpg0510"
FT                   /product="(3R)-hydroxymyristoyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="4.2.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0510"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26607"
FT                   /db_xref="GOA:Q5ZY62"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY62"
FT                   /protein_id="AAU26607.1"
FT                   /translation="MNESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINE
FT                   NFFTGHFPGNPIMPGVLMLEALAQACAILASLSRQPKEGHEFLHYFAGIDNARFKQVVT
FT                   PGDQLRLEVRLAGQKRDFWRMHGEAYIGDKLACSADLLSAAKEIKK"
FT   gene            552152..552922
FT                   /gene="lpxA"
FT                   /locus_tag="lpg0511"
FT   CDS_pept        552152..552922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="lpg0511"
FT                   /product="acyl-(acyl carrier
FT                   protein)-UDP-N-acetylglucosamine acyltransferase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /EC_number="2.3.1.129"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0511"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26608"
FT                   /db_xref="GOA:Q5ZY61"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY61"
FT                   /protein_id="AAU26608.1"
FT                   /translation="MIDERAMIHPSAKLASGVSIGPGTVIGADVEIGENTWIGPHVVIE
FT                   GPTVIGKNNKIFQFASVGDEPQDITYKGEPTRLEIGDNNVIREYCMISRGTVKGGGVTR
FT                   IGDSNYLMAYSHIGHDCMVGNHIIMVNYAALSGHVTINDYAIIGPYAAVHQFCQVGAYA
FT                   FIARATYVTKDVLPYVMIAGHTTSACGINTVGLRRRGFSSAAIDCLRRAYKIIFRKGLT
FT                   VQQAVSELELIQNECPEIIPMIDALNQSTRGIVR"
FT   gene            552926..553330
FT                   /locus_tag="lpg0512"
FT   CDS_pept        552926..553330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0512"
FT                   /product="CrcB protein, camphor resistance"
FT                   /function="Detoxification / adaptation, Chemotaxis /
FT                   motility / cell division"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0512"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26609"
FT                   /db_xref="GOA:Q5ZY60"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY60"
FT                   /protein_id="AAU26609.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLMTN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
FT   gene            553352..554632
FT                   /gene="serS"
FT                   /locus_tag="lpg0513"
FT   CDS_pept        553352..554632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="lpg0513"
FT                   /product="seryl tRNA synthetase"
FT                   /function="Amino Acid Metabolism, Translation"
FT                   /EC_number="6.1.1.11"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0513"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26610"
FT                   /db_xref="GOA:Q5ZY59"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY59"
FT                   /protein_id="AAU26610.1"
FT                   /translation="MLDNQLLRENPQYVATQLLKRGFQFDAVTFSQLEEKRKALQVSTQ
FT                   SLQNERNLRSKAIGEAKSRGENIGPMREEVNKLGAILEQQKTELDEVLKQIEVISLSLP
FT                   NIPHESVPVGKDELDNQEIRKWGDVPAFSFPVKSHDELGEALGQMDFALAAKITGSRFV
FT                   VMKGHLARLHRALIQFMLDIHIQQHGYQEIYVPYIVNADSLLGTGQLPKFEADLFKLTG
FT                   DNGYYLTSTSEIPVTNTVREMILSAEQLPIRYVCHSPCFRSEAGSYGKDTKGMIRQHQF
FT                   EKVELVWITKPEDSYNALEQLTQHAEIILQRLNLPYRVVALCTGDIGAGSAKTYDLEVW
FT                   LPSQNTYREISSCSNMEAFQARRMKARFRNPDTNEIQLVHTLNGSGLAVGRTLVAIMEN
FT                   YQDEHGNIHIPDALKPYLGGIDIISVK"
FT   gene            554771..555892
FT                   /locus_tag="lpg0514"
FT   CDS_pept        554771..555892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0514"
FT                   /product="hypothetical protein"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0514"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26611"
FT                   /db_xref="GOA:Q5ZY58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY58"
FT                   /protein_id="AAU26611.1"
FT                   /translation="MKHFDFSLRIWPISLWFVKHSGVKNPMNEVIIREITSEDKEMFLC
FT                   AMQSSQALHHPWVKAPIIPEEFDEYFSRYQKPNQKSYLLLSDNNLAGVFNISEIVRGYF
FT                   QNAYLGFYVVAAYAGKGYMSTGLKLILTKVFKDMGLHRLEANIQPENTRSIWLVKKNGF
FT                   RYEGFSPRYLRVNDVWQGHEHWAMTYEDFIKDNNEVLEKDHIDIVAYNTEWPLLAKAEM
FT                   VKLRASFPANSVIDIQHVGSTAIPGMASKPIIDIQIAVRSLEEMKIIAVPILQKLDYEY
FT                   WEDNPDPERMFFVKGMPPYGNGRTHHVHIVEASSRHWKGKTFFRDYLLSHPEAAEKYQQ
FT                   LKIKLAQEHKYDREQYTDAKSEFINQILKLAQN"
FT   gene            556665..557597
FT                   /gene="legD2"
FT                   /locus_tag="lpg0515"
FT   CDS_pept        556665..557597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="legD2"
FT                   /locus_tag="lpg0515"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0515"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26612"
FT                   /db_xref="GOA:Q5ZY57"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY57"
FT                   /protein_id="AAU26612.1"
FT                   /translation="MDNLLNEKKLTIFTSNEIQDNLNRVLKDYEQNGIIGLNGYLNQAN
FT                   RISLLNELEIMQKDAEQDIARYWNNKIIHFYSKDPLKPESVDREYVTEPYFQASSNKAH
FT                   VFYEVIDNMRVVNRIGHGMHLINRYPMMQRAVYDSPVLLDLLKGIGFKKPICHLSVYIP
FT                   KYPNGIGSEVRPHQESTFAFTEPQSVVVLWVALEDALIENACMYGVLGSNHWPLKWVSK
FT                   VDRETKTRHFEQVHQLHIPDFMTEREFYTALEVKAGDALLFHGNFVHCSPMNTSKNSRK
FT                   ALSFQFIETYEVDYPETNWLYPPNKVYLY"
FT   gene            557618..558406
FT                   /locus_tag="lpg0516"
FT   CDS_pept        557618..558406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0516"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0516"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26613"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY56"
FT                   /protein_id="AAU26613.1"
FT                   /translation="MRNHYMSMYDMRQFFKTYFSSASEKSILVKLLDKRFHPPSHTANI
FT                   LDLGCHDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTA
FT                   EDYFDVCTDHFDWIFASQCLYWSPDLPKIIKQIHETGDSALIVIRGCHGIYEIQSQFRH
FT                   YIGNHLEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEES
FT                   LGDKIFCEVRDWITSRTSGSIHHEVHFFWLGNAILQGITI"
FT   gene            complement(558434..559264)
FT                   /gene="ytbE"
FT                   /locus_tag="lpg0517"
FT   CDS_pept        complement(558434..559264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbE"
FT                   /locus_tag="lpg0517"
FT                   /product="aldo/keto reductases"
FT                   /note="related to diketogulonate reductase; conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0517"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26614"
FT                   /db_xref="GOA:Q5ZY55"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY55"
FT                   /protein_id="AAU26614.1"
FT                   /translation="MDLGFPTFIYGTAWKEKRTSELVELALTTGFQGIDTANQRKHYYE
FT                   EGVGYALQQYYKKSGILRDDIFLQSKFTYTHGQDHRKPYDDTASLTIQVQQSFASSLEH
FT                   LNTDYLNSYILHGPYYQYHFSDEDKEVWNKMESLHKDGKVKHLGISNVSYEQLVELISF
FT                   ASVKPKFVQNRCFARLLWDKQIRNYCQAHGIIYQGFSLLTANQYELRHPKLENLSKKHE
FT                   KSIEQIIFRFSQQIGMLPLTGTTNLDHMKEDLAIHQFRLTDDEINFIENIAFIP"
FT   gene            complement(559574..560422)
FT                   /locus_tag="lpg0518"
FT   CDS_pept        complement(559574..560422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0518"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26615"
FT                   /db_xref="GOA:Q5ZY54"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY54"
FT                   /protein_id="AAU26615.1"
FT                   /translation="MTDLRTEIESLIHNGLLPDREYVSAKRFINHYANTNEFWAGLALV
FT                   GITPIINGLYACYYASRTVWATLRTVGNLLILKPGLALDALKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVEILTRVISSWFVGQEPRHDLLETGLMAKWANRVSGYQMVNELPSSNYLNKA
FT                   RFFSSYNNAWDCLEQMASPMTSLAKGGFHSLVEALYGVESAIECIVNLAICKPLHAKEN
FT                   FHNLQVHFGLAVSLAVMTPINALVEGIAFMTRLGTTWVSACLKPEVTETEHENTTAYQF
FT                   N"
FT   gene            complement(560931..563144)
FT                   /locus_tag="lpg0519"
FT   CDS_pept        complement(560931..563144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0519"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26616"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY53"
FT                   /protein_id="AAU26616.1"
FT                   /translation="MIIYSSSIKNAFGAGTIMQTQKTIYEQIQKDKGSYKGVTLSYSGA
FT                   QYLPSSFQNNKYSADNPELSPLQAFTERFKNIGALVIRFHLGQGQRAGLLQQVSKFNYS
FT                   ENPVERPAQGGDEETLFFKEESTNSGRINGDVLEFASHLTLGRSKVLNERAQPLVHVNQ
FT                   KSTYGEQGIWDIIHAPVWNVGRAMKYELNKQGFIYINCPAQLNPKEKEILDRQLRTSGK
FT                   PPALVCEEMGVEAIESDISKLDIYLDDKQEFTKEPNGLAIANNKEDKKYAPMGWIIHKK
FT                   TGEVLPQEVTEDIIRVSAIAEGGFYEKRPTQQKILQSGNLMNSSGLGLFTQNQAFNAMY
FT                   VIFDYLQRYNFDPRPLLDNSLQIAYNRLQSTLEKDPSLIDDFLVGALQDEMVQHLRVSQ
FT                   PKSIRSVLPIRFTNSFPVTINNLKTIAYAFGIKDKSEQPIFRGFDDNAGLFKSENMIDS
FT                   QISGTLVTPSFNTAAHVAAIVSTAELIAEQMILEQLIPDAFAKKNPEDSALFILLVDIL
FT                   GKEEADKLFTELMDETAKLPTIDNKLIVGAQFAYCKKLVQKLQNGLGLDSMNILLCKLS
FT                   KPGLSTQEVLENLDSRELEQLTKVLERLFKIGDILQELPLTTAAPEYSRGINAGLAPLI
FT                   AHVNPHLAVKLNIQTQSIIKADIPAIDKEKVRDRMSTRVYNRCPFLAKQSKEQKPQQVS
FT                   ETNDVLVSKNTGPSFFQTIRENQGKITAVLLGAAYIGLSSLLG"
FT   gene            complement(563556..564326)
FT                   /locus_tag="lpg0520"
FT   CDS_pept        complement(563556..564326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0520"
FT                   /product="methyltransferase, ubiE/COQ5 family"
FT                   /function="Metabolism of Cofactors and Vitamins, Lipid
FT                   Metabolism, Amino Acid Metabolism, Metabolism of Other
FT                   Amino Acids, Biodegradation of Xenobiotics"
FT                   /EC_number="2.1.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0520"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26617"
FT                   /db_xref="GOA:Q5ZY52"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY52"
FT                   /protein_id="AAU26617.1"
FT                   /translation="MVNKMTKLRNLDTYLSLCTEVYDLSKPNPPEEAYAFYRSYVMNVK
FT                   DPILEPMCGTGRFLLPLLEEGFEIHGFDASEYMLEALNIKAKAKNLKPTVWRGFVENLT
FT                   RPEKYNLIFIPSGSFCLLIDPATIRLALQTFYNHLSDEGILLFEGETLKAVPQLDVWRG
FT                   SVWHKPNGQMIMLSQLATLKDQVCHSIGKYELVHNNSIIHTEVEELRVRIYDPQELTGI
FT                   LKSCGFKNVRLIKAFDSAATPDDQDETIVYECRK"
FT   gene            complement(564280..564888)
FT                   /locus_tag="lpg0521"
FT   CDS_pept        complement(564280..564888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0521"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY51"
FT                   /protein_id="AAU26618.1"
FT                   /translation="MTPHIIGISGITGAGKSTLAKALSLDLKATLISWDDFDDISLEPE
FT                   DYIEWYHKGCNYSEFQREDLAKVLAELKAKREIIHPVLRTLLNPAEYIIFDAPLGKLHV
FT                   QTGEYIDTCVHIEVPLDISFCRRILRDFKDKLQTKENLLEEISFYLNHSRPLFFDDELK
FT                   QNATIAIDGLLSTEVQIQIIKNFLIGEQDDKIKKPGYLS"
FT   gene            complement(564885..565352)
FT                   /locus_tag="lpg0522"
FT   CDS_pept        complement(564885..565352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0522"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0522"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26619"
FT                   /db_xref="GOA:Q5ZY50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY50"
FT                   /protein_id="AAU26619.1"
FT                   /translation="MITIDLLKNHPQSIARCATIWHEVLGKIWVPEIPVEQVIQRFSEH
FT                   LNADKLPITFIALDTGKPVGMCSLRENDGIRPEISPWLGSLVVDPAYQRQGIGNRLIEA
FT                   TKNKARDLGFNKLHLFAFDPTIPNYYSRLGWAIISMDKFKGHPVTVMEILL"
FT   gene            complement(565504..566067)
FT                   /gene="aacA4"
FT                   /locus_tag="lpg0523"
FT   CDS_pept        complement(565504..566067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aacA4"
FT                   /locus_tag="lpg0523"
FT                   /product="aminoglycoside N (6')-acetyltransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0523"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26620"
FT                   /db_xref="GOA:Q5ZY49"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY49"
FT                   /protein_id="AAU26620.1"
FT                   /translation="MRINFEKANSNHINIIFSWLKEPFIQEFWDNTQAHKDDILNFING
FT                   RTEPSSYADGKYVYWIASGNGHPFAMLMTIQETSEDEIDDIKLINLSKTGHSYGIDYMI
FT                   GDKNYFGIGYGARTLIEFIDFFIKEVDPKADTFLIDPASDNPRAKHVYIKAGFEYVADF
FT                   LMSGDVSGAGKLHHLLIKRIGLIK"
FT   gene            complement(566133..566209)
FT                   /locus_tag="lpg0524"
FT   tRNA            complement(566133..566209)
FT                   /locus_tag="lpg0524"
FT                   /product="tRNA-Pro"
FT   gene            566512..567138
FT                   /locus_tag="lpg0525"
FT   CDS_pept        566512..567138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0525"
FT                   /product="hypothetical virulence protein"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0525"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26621"
FT                   /db_xref="PDB:5X90"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY48"
FT                   /protein_id="AAU26621.1"
FT                   /translation="MADGDIEIKAGFVDTDLDDRKLTMIDDLNNPLAIVERVYLIWWHW
FT                   ADFHLHVISPHIDTITPAIVIEPELIPGSNDHEFVYSIHDSGSKLSTSKSQDMFSAGMS
FT                   MCKLFYTIEKMVYILVERLKSGGVSMEAEVQIAFAGHEIAQRKAFESIINLPYNVVVTN
FT                   FDPGIWGEKYLQNVKRLADKGYGYPPESPRKIYMHPVSSGTTARK"
FT   gene            complement(567168..567602)
FT                   /locus_tag="lpg0526"
FT   CDS_pept        complement(567168..567602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0526"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0526"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26622"
FT                   /db_xref="GOA:Q5ZY47"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY47"
FT                   /protein_id="AAU26622.1"
FT                   /translation="MIIIFQKLIIEINAGYVFIMFFIKYTGAMIYDLIILSILFFAYTS
FT                   ALLLFTHGQAIPPATRWYQFSLFSIIFVYYYGSIRFGGQTIGMKAWRFKLTTDSGKKLS
FT                   RQQIIARFFYFIPATLIAPFCLKGNYKLLHQWTQTGFKKV"
FT   gene            complement(567697..568848)
FT                   /locus_tag="lpg0527"
FT   CDS_pept        complement(567697..568848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0527"
FT                   /product="signal transduction protein"
FT                   /function="Transport and binding, Signal transduction /
FT                   other regulatory functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0527"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26623"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY46"
FT                   /protein_id="AAU26623.1"
FT                   /translation="MEVFMITKRPIYNQQLKCVAFEILSCRNVMLNEELTRQLYDLIYH
FT                   TDTQLPLFVPFSLKKLLEQFETPINNPIILKLSADEIESVYSLTELQDSLFSIALLINT
FT                   PQQLAWLNFAEYIGLTEQLMSKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCKAMTMD
FT                   YYCGDFLLNSIAEEGTEIAANKLNVLQLIQELQKEDCDLNEITHIIQADPLLSYQLLKL
FT                   VNSVGFSSGPSIESIDQAVARLGIINLKKWVMLFSMKNISDKPIEVLESGLIRAHMAEE
FT                   LAKKSSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKDALTNKSGPLGDLLS
FT                   LVIAYEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
FT   gene            569140..569532
FT                   /gene="sdhC"
FT                   /locus_tag="lpg0528"
FT   CDS_pept        569140..569532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="lpg0528"
FT                   /product="succinate dehydrogenase cytochrome b556 subunit
FT                   C"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism,
FT                   Biodegradation of Xenobiotics"
FT                   /EC_number="1.3.99.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0528"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26624"
FT                   /db_xref="GOA:Q5ZY45"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY45"
FT                   /protein_id="AAU26624.1"
FT                   /translation="MRKKLIVNKKRPINLDLSSLKFPPMAIASILHRISGVLIFLLFPF
FT                   VLFILGCSLQSEESFVQAKTMLANPFYKLMLWAFGASMIYHVIAGIRHLIMDMGFGESL
FT                   RAGRMSAVSIIVLAVILAIFLGIWIW"
FT   gene            569526..569873
FT                   /gene="sdhD"
FT                   /locus_tag="lpg0529"
FT   CDS_pept        569526..569873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="lpg0529"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein subunit D"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism,
FT                   Biodegradation of Xenobiotics"
FT                   /EC_number="1.3.99.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0529"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26625"
FT                   /db_xref="GOA:Q5ZY44"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY44"
FT                   /protein_id="AAU26625.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSF
FT                   SQWHLLFTNKAFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLTQ
FT                   FIWGLMIIWGQ"
FT   gene            569875..571644
FT                   /gene="sdhA"
FT                   /locus_tag="lpg0530"
FT   CDS_pept        569875..571644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="lpg0530"
FT                   /product="succinate dehydrogenase flavoprotein subunit A"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism,
FT                   Biodegradation of Xenobiotics"
FT                   /EC_number="1.3.99.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0530"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26626"
FT                   /db_xref="GOA:Q5ZY43"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY43"
FT                   /protein_id="AAU26626.1"
FT                   /translation="MTVARNRFDAVIIGAGGAGMRAALQMTNSGLKVALLSKVFPTRSH
FT                   TVSAQGGITAALGNADEDDWRWHMYDTVKGADYIGDQDCIEYLCKTGPEAVYELEHMGL
FT                   PFSRMDNGKIYQRQFGGQSKHFGGEQAARTCAAADRTGHALLHTLYQQNLKAKTHVFSE
FT                   WYALDLVKNSQGRIAGVTAMCMETGEIVFFQTRVCILATGGAGRIFQSTTNAFINTGDG
FT                   FGMALRAGIPLQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLINKDGERFMERYAPRVK
FT                   DLASRDVVARAMALEIRAGKGFDPKGVDHVKLKLDHLGADLIMSRLPGIRELSMKFAGV
FT                   DPIVEPIPVVPTCHYSMGGIPTNMHGQVITKTDGKEHVVEGLYAVGECACVSVHGANRL
FT                   GGNSLLDLVVFGRAAGIHVEELWQSNQLPDMSYVSEDDVAASLVRYERWENSKDGESHA
FT                   VIRDEMQRVMQEDFGVFRTGEVMASGLKRLQALRDRLAHAKLDDKSQIFNTERVEAMEL
FT                   DNLMATAYATALSAIARTESRGAHSREDYPKRDDANWIKHTLYFEEGEVIDYRPVNTSP
FT                   KYVEPFEPKERVY"
FT   gene            571657..572379
FT                   /gene="sdhB"
FT                   /locus_tag="lpg0531"
FT   CDS_pept        571657..572379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="lpg0531"
FT                   /product="succinate dehydrogenase iron-sulfur protein
FT                   subunit B"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism,
FT                   Biodegradation of Xenobiotics"
FT                   /EC_number="1.3.99.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0531"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26627"
FT                   /db_xref="GOA:Q5ZY42"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY42"
FT                   /protein_id="AAU26627.1"
FT                   /translation="MADSRNLILSIYRYNPEVDAKPYMKDYEIEIPAKSDPMLLTLLER
FT                   LKAEQDPSITYRRSCREGVCGSDGMNINGTNGLACITHISQLKTDKIVIRPLPGFPVIR
FT                   DLAVDMTQFYQQYERIEPYLQNDEVAPARERLQSPEERAQLDGLYECILCACCTSSCPS
FT                   YWWNPDKFVGPAGLLQARRFLADSRDKATQHRLDLLQDPFSVFRCRTIMNCTNVCPKGL
FT                   NPTQAIAKIRTQMLTQET"
FT   gene            572413..575247
FT                   /gene="sucA"
FT                   /locus_tag="lpg0532"
FT   CDS_pept        572413..575247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="lpg0532"
FT                   /product="2-oxoglutarate dehydrogenase E1 component)"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /EC_number="1.2.4.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0532"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26628"
FT                   /db_xref="GOA:Q5ZY41"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY41"
FT                   /protein_id="AAU26628.1"
FT                   /translation="MNPLERMIMSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSV
FT                   SEDWRAVFSALPKVNGATKEVSHRDIREYFLQHADKKLNKIIQIADSQQYQVASLINDF
FT                   RSLGHLAAKLDPLEMTERMPVPRLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNA
FT                   LRETYCRSIGIEYMHISDTEVTEWLQNKMESVRGCPEFSPQEKLNILKDLIAADGLERY
FT                   LGTRYVGQKRFSLEGGDSLIPMMKELIRRSGINNVKELVIGMAHRGRLNVLVNVLGKEP
FT                   GLLFQEFEGKIKYERTGDVKYHLGFSSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSV
FT                   RSRLGRRNDLAKKDKVVPIVIHGDAAFAGQGVVMETFNFSQARGYCTGGTIHIVINNQI
FT                   GFTTSNPLDARSTLYCTDVAKMVQAPVIHVNGDDPEAVVFATQVAFDFRMKFKRDIVID
FT                   LVCYRRHGHNEADEPSVTQPKMYKKIKSMPTLREKYGEQLVSANLLTKSEVDKLVDSYR
FT                   ETLDKGKAVVDLVHEDYEGKQSLDWTPYINAKWTDKVDTTISKEELEKISSQLNKLPDG
FT                   MKLHPVVERLLAERNKMTAGEIPMNWGYAEIMAYASLLHEGYGVRISGQDSGRGTFAHR
FT                   HAVLHDIETGDTFIPLEHISTSPKRYFTVIDSVLSEEAVLAFEYGFASSEPSFLVIWEA
FT                   QFGDFANGAQVVIDQFISSGEQKWGRLCGLVMLLPHGYEGQGPEHSSARLERYMQLCAQ
FT                   HNIQVCTPTTPAQIFHLLRRQVIRNFRKPLIVMTPKSLLRHKLAVSPLEALFKGKFHTV
FT                   IPEIDALDAQKVTKVVLCCGKVYYDLLQMRRDKNLNHVAIVRIEQLYPFPKKALMAELE
FT                   KYQKANEVVWCQEEPQNQGVWFSSQHNMRDCLRSDQTLQYAGREFAAAPAVGSPGLHAE
FT                   QQVALVEQALLGKK"
FT   gene            575283..576512
FT                   /gene="sucB"
FT                   /locus_tag="lpg0533"
FT   CDS_pept        575283..576512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="lpg0533"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /function="Carbohydrate Metabolism, Amino Acid Metabolism"
FT                   /EC_number="2.3.1.61"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0533"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26629"
FT                   /db_xref="GOA:Q5ZY40"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY40"
FT                   /protein_id="AAU26629.1"
FT                   /translation="MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVV
FT                   LEVPSPVDGVLSDILFNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISES
FT                   ESVSTKEDKSTSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKANQTAE
FT                   VQKEPSMRALSFGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRS
FT                   QYKDSFEKKHGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTER
FT                   GLVVPVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATP
FT                   IINPPQTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELL
FT                   EDPSRLLLNV"
FT   gene            576519..577739
FT                   /gene="sucC"
FT                   /locus_tag="lpg0534"
FT   CDS_pept        576519..577739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="lpg0534"
FT                   /product="succinyl CoA synthetase beta chain"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="6.2.1.5"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0534"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26630"
FT                   /db_xref="GOA:Q5ZY39"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY39"
FT                   /protein_id="AAU26630.1"
FT                   /translation="MFNCKARLDGSCFFKKVIRMNLHEYQAKQLFASYDLPVPRGEVAY
FT                   NVEDALLVASQLSTSRWVVKAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQ
FT                   TDARGQPVNAILVEETCEIDKELYLGAVVDRSTRRVVIMASTEGGVEIEKVAHETPEKI
FT                   FKVVVDPLVGVMPFQCRETAFKLGLKDDQIKQFTHLMMGLGKMFVECDLSLLEINPLVI
FT                   TKSGQLICLDGKINIDGNALFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCM
FT                   VNGAGLAMATMDVIKLHGGEPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGG
FT                   IVRCDLIADGILAAVKEVDVKIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKK
FT                   IVAAVSE"
FT   gene            577814..578689
FT                   /gene="sucD"
FT                   /locus_tag="lpg0535"
FT   CDS_pept        577814..578689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="lpg0535"
FT                   /product="succinyl CoA synthetase alpha chain"
FT                   /function="Carbohydrate Metabolism, Energy Metabolism"
FT                   /EC_number="6.2.1.5"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0535"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26631"
FT                   /db_xref="GOA:Q5ZY38"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY38"
FT                   /protein_id="AAU26631.1"
FT                   /translation="MSVLVDKHTKVLCQGFTGKQGTYHTEQALAYGTKMVGGVTPGKGG
FT                   QMHLGLPVFNTMREAVEETKADASVIYVPAPFCKDSIIEAAEAGIKLIVCITEGVPVLD
FT                   MLQVKVYIENNTQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAV
FT                   KQTTDKGFGQSTCIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEF
FT                   IKSHVKKPVVSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADL
FT                   GDAIAEVTGW"
FT   gene            579103..579750
FT                   /gene="pdxH"
FT                   /locus_tag="lpg0536"
FT   CDS_pept        579103..579750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="lpg0536"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="1.4.3.5"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0536"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26632"
FT                   /db_xref="GOA:Q5ZY37"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY37"
FT                   /protein_id="AAU26632.1"
FT                   /translation="MSKFRSLADIRRDYGELQLSEESAENDPISQFKLWFDDVLLNEKN
FT                   DPTAMVLSTVDEKGYPDSRVVLLKGLENGNFIFYTNYQSAKAMQIQKNPYAALNFYWPQ
FT                   MARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQEILDRISLEDALNQLIEE
FT                   YGQKPVVRPENWGGYMIIPDEIEFWQGRDNRLHDRIHYYRHGHEWTHRRLAP"
FT   gene            580363..580734
FT                   /locus_tag="lpg0537"
FT   CDS_pept        580363..580734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0537"
FT                   /product="transmission trait enhancer LetE"
FT                   /function="Toxin production / other pathogen functions,
FT                   Signal transduction / other regulatory functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0537"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26633"
FT                   /db_xref="GOA:Q5ZY36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY36"
FT                   /protein_id="AAU26633.1"
FT                   /translation="MNDTTSLLSHLRLRFNIEHPSYEECYIFGYECALAEVPEEDNPFR
FT                   EGSQEAEQWLEGWWAGIYGEKPLFDLNNIEEDILLDKTTAANDQQYHHKNSFLSLVFEI
FT                   GGAIAASAIVGYQLLELVA"
FT   gene            complement(580406..580738)
FT                   /locus_tag="lpg0538"
FT   CDS_pept        complement(580406..580738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0538"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26634"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY35"
FT                   /protein_id="AAU26634.1"
FT                   /translation="MIMLRAQVIGSLLLRKRLSHHQFQRLKIGSCFYDDIADHLQLWFY
FT                   LKEYLPRYCSNQIMVFLHIYQPTILRAIVLLLENLRGKDYLLLELLPMHIHTQKYNILH
FT                   SLGVQC"
FT   gene            complement(580805..581194)
FT                   /locus_tag="lpg0539"
FT   CDS_pept        complement(580805..581194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0539"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26635"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY34"
FT                   /protein_id="AAU26635.1"
FT                   /translation="MNKLNIAIKEAFESSGSSKEANKVYLEFIKANFIIPIESNSDDSE
FT                   PRVLFLEENNHVFLPVFTDMKYLDAWASEISQHIKLLKLSGVDLLKGLGEKVTVCLDIG
FT                   SELYKEFNPSEIERMRSMVLKLFKN"
FT   gene            581844..583127
FT                   /locus_tag="lpg0540"
FT   CDS_pept        581844..583127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0540"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0540"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26636"
FT                   /db_xref="GOA:Q5ZY33"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY33"
FT                   /protein_id="AAU26636.1"
FT                   /translation="MGISKVEIYKRKNYLGFAWLVWGLAAAFYFSDYLARVAPGVMHRY
FT                   LQMDFGINEAGFGILTASFYVPYILMQIPVGLTVDRLSIRWLLTIMSLVTAFGCCVFGL
FT                   ADGLLTASIGRMLIGFSAAFAFICSLRLATSWFPPTMLGLLSGLTQALGMLGAAAGEAP
FT                   VSFLVSNVGWRHSMLIIAFLFIALSGLLYQFVQDKPGEHRNEIRSVNRISILDSLKIIL
FT                   SNKQTWLNAMYAGFLFGPTAVIGEAIGPAYLQFGRGLGAHAAAFATGLIFIGWGISGPL
FT                   SGWISDKMGRRKPLMIISAVCGVILSSLFVFIPEMSQTTAYILFFVFGLTNTGVAISYA
FT                   VSTEIHDRSVVGTSIAFTNMTSIFVGALFQPLVGRIIDMVSGPRAYNVETLLLSDFQAG
FT                   LKLLPLCSLVALILAFTVKETYCKPIRH"
FT   gene            583330..584814
FT                   /locus_tag="lpg0541"
FT   CDS_pept        583330..584814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0541"
FT                   /product="probable membrane protein YdgA-like"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0541"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26637"
FT                   /db_xref="GOA:Q5ZY32"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY32"
FT                   /protein_id="AAU26637.1"
FT                   /translation="MQINNMEIIMKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEV
FT                   INQSNGLFADIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKI
FT                   YHGPIIYANKQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKST
FT                   VELSIPSFKLTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGK
FT                   VNSEYDLHKTTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFS
FT                   AALKSLFANGQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPEL
FT                   PKLFSKGAEFEISKLSLKLPQGMIDGNLLITLPKGDSSNPFELIQKTQGNAKLKMPIEV
FT                   VKQLMQQSIMQQMAKQPEMQQALIQQLQNSQGQSNQAEPTPEQIAAMQVDKQINELEQS
FT                   GLITVDGKDYVIEMSLSEGKFTVNGKPFDPSMMKFQ"
FT   gene            585004..585285
FT                   /gene="fis"
FT                   /locus_tag="lpg0542"
FT   CDS_pept        585004..585285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="lpg0542"
FT                   /product="DNA binding protein Fis"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0542"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26638"
FT                   /db_xref="GOA:Q5ZY31"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY31"
FT                   /protein_id="AAU26638.1"
FT                   /translation="MTTISNDAGDTTASLAESVTQSVQKYFSELKGTDPVDLYQFVLEE
FT                   IETPLFRAVMEHCKYNQSRAAIMLGISRGTLRTKLRRYFDDKYVGTRD"
FT   gene            complement(585347..586294)
FT                   /gene="prsA"
FT                   /locus_tag="lpg0543"
FT   CDS_pept        complement(585347..586294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="lpg0543"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /function="Carbohydrate Metabolism, Nucleotide Metabolism"
FT                   /EC_number="2.7.6.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0543"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26639"
FT                   /db_xref="GOA:Q5ZY30"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="PDB:6NFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY30"
FT                   /protein_id="AAU26639.1"
FT                   /translation="MSTMMIFTGNANPELALKISSHLQIPIGKATVGTFSDGETMVEIL
FT                   ENVRGKDVFVLQSTCAPANNNLMELLIMADALRRSSAGRITAVVPYFGYARQDRRVRSA
FT                   RVPITAKVVADMMASVGICRVLTVDLHADQIQGFFYMPVDNVYSTPVLLEDITKQKLNN
FT                   IMIVSPDVGGVVRARAVAKRLNDAELSIIDKRRSGPNKSEVMHIIGEPANKNCIIVDDI
FT                   VDTAGTLCTAAHELKKNGAKSVRAYITHPVLSGPAVNNIKHSGLDEVVVTDTIPLSAEA
FT                   QNCEKIRVVSLADMLAQAIKRVNVEESVSSMFAE"
FT   gene            complement(586260..586448)
FT                   /locus_tag="lpg0544"
FT   CDS_pept        complement(586260..586448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0544"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26640"
FT                   /db_xref="GOA:Q5ZY29"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY29"
FT                   /protein_id="AAU26640.1"
FT                   /translation="MKLNLGTSKQTAEDNLEGCVLRIAQIIIISFWLSSAMCLSYVINL
FT                   NLRLLTHVHDDDFYREC"
FT   gene            complement(586474..586548)
FT                   /locus_tag="lpg0545"
FT   tRNA            complement(586474..586548)
FT                   /locus_tag="lpg0545"
FT                   /product="tRNA-Gln"
FT   gene            586504..586674
FT                   /locus_tag="lpg0546"
FT   CDS_pept        586504..586674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0546"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26641"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY28"
FT                   /protein_id="AAU26641.1"
FT                   /translation="MQGSKPCALPLGDTPIIVDSSIIHEFINSIHPCNVLRILQCFFID
FT                   VNFRKQINYKN"
FT   gene            complement(586676..587275)
FT                   /locus_tag="lpg0547"
FT   CDS_pept        complement(586676..587275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0547"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0547"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26642"
FT                   /db_xref="GOA:Q5ZY27"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY27"
FT                   /protein_id="AAU26642.1"
FT                   /translation="MNAIKRLTIILICFLTACAPPRPSEEPPANREIPLEERKAETATV
FT                   SSWEIKGALAAKTKAKGWSATMNWVQQGANSYQIRLMGPLGGGAVLISKKGNTITFQDG
FT                   AKITTSTNADELLLKQTGIRLPVNNLYYWVRGLPAPGGIQSEKHDQFNHLIQLKQNGYT
FT                   IDFTKYTSVKGIDLPSMIRLEGNGVMVKVVIKNWVV"
FT   gene            587251..587850
FT                   /gene="kdtB"
FT                   /locus_tag="lpg0548"
FT   CDS_pept        587251..587850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="lpg0548"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /EC_number="2.7.7.3"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0548"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26643"
FT                   /db_xref="GOA:Q5ZY26"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY26"
FT                   /protein_id="AAU26643.1"
FT                   /translation="MSNVLSHSLLTSIPFFYSFSIYNTLDCFYMQMVINEMKQKAIYPG
FT                   TFDPVTNGHIDIITRASTIFPELIVAVASNKNKRPYLSWESRISLLEESVGHLTGVRVV
FT                   GFDNLLIDFVLEQNAGIILRGLRAVSDFEYEFQLAGMNRKLSKKVETLFLTPAEHLMYI
FT                   SSTLVREIAALNGDISQFVPPNVVRELKKRQNERSL"
FT   gene            587834..589558
FT                   /locus_tag="lpg0549"
FT   CDS_pept        587834..589558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0549"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /function="Metabolism of Other Amino Acids, Metabolism of
FT                   Complex Lipids"
FT                   /EC_number="2.3.2.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26644"
FT                   /db_xref="GOA:Q5ZY25"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY25"
FT                   /protein_id="AAU26644.1"
FT                   /translation="MKDHYKWLSCLFFFICNIYQVNAKTFPQHPPGYAVASAHPLATHA
FT                   GLEILAAGGNAFDAAVAVAAALAVVEPYHSGLGGGGFWLLHQEKEHLNLFIDGREVAPL
FT                   AASKDMYLAPDGQVIPGLSLNGGLSAAIPGQPAALVYIAKNYGRLPLSKTLAPAIKLAE
FT                   EGFPVDPQFRYFSTLDDRLENLKKYPDTAAIFLKNGQPFEIGEKLVQKDLAKTLRLIAK
FT                   YGNAGFYSGETASLLVQGVNAAGGTWSLDDLAQYKIKVRPPLISAYHNMLIITAPLPSA
FT                   GGVALVTMLNILSKFPLSSFPKLKWVHYVVESMRLAYWQRDQFLGDPDFIKVPLDKLIS
FT                   SDNAKQLSRLISPNKAIDSKVLQGSVPTGKHSNTSHISIIDTEGNRVAATMTINYIFGS
FT                   SVVAKGTGVLLNDEMDDFSTKVGEQNVFGLVGSERNAIEPRKRPLSSMAPTFLEMPGRV
FT                   AILGTPGGSRIPTMVLLASLLFYDGYGAISMVSAMRFHHQYLPDVLQFEPDTFPSSIQQ
FT                   GLQAMGYHLMPLKQYYGDMQAITWDKESNVLTAASDPRHIGLAAAISNMAYGYGVNY"
FT   gene            complement(589656..591872)
FT                   /locus_tag="lpg0550"
FT   CDS_pept        complement(589656..591872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0550"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0550"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26645"
FT                   /db_xref="GOA:Q5ZY24"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY24"
FT                   /protein_id="AAU26645.1"
FT                   /translation="MSINKIEEDRDISSDLEMKAKMYLVHRMDKAGPLTVKDVRILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRYLQFFLNKLDGKSINPILIPLSNKP
FT                   FWQNEPHPFDHYRSTDQLPEKVDIVIIGAGLTGASTAYHLIDAVKKRHLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPHVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIARKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKSGIKLYTFVKVQQIKSIDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELRAIKPHQSQIAITDSTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPNLKG
FT                   RPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGLAAAEIALTGKNP
FT                   PWLPADVFSPKRLLSDKPLFWEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYS
FT                   TISLLPHGHQEKNCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLSKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
FT   gene            complement(592083..592856)
FT                   /gene="plsC"
FT                   /locus_tag="lpg0551"
FT   CDS_pept        complement(592083..592856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="lpg0551"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acetyltransferase"
FT                   /function="Metabolism of Complex Lipids"
FT                   /EC_number="2.3.1.51"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0551"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26646"
FT                   /db_xref="GOA:Q5ZY23"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY23"
FT                   /protein_id="AAU26646.1"
FT                   /translation="MLYDGPLIIPCALTMKISRLKTFWIITRLFYYTGVACTRSIFKYL
FT                   FSTPTRPWVDKVIHHWVDQLLNAVKVEYKVINPHNVQPQPGKATILMCNHSSAYDIPLG
FT                   FKAFPNNSIRMLAKRELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESGII
FT                   LWIAPEGTRSKDGKLAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAE
FT                   IHIGEPIDAAQYSIENKEELIEKTHQSIKKLVGEN"
FT   gene            complement(592883..593203)
FT                   /gene="sugE"
FT                   /locus_tag="lpg0552"
FT   CDS_pept        complement(592883..593203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="lpg0552"
FT                   /product="suppressor of GroEL (SugE)"
FT                   /function="Transport and binding, Protein fate / hydrolases
FT                   / secretion, Signal transduction / other regulatory
FT                   functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0552"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26647"
FT                   /db_xref="GOA:Q5ZY22"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY22"
FT                   /protein_id="AAU26647.1"
FT                   /translation="MLLPWLYLIIAGLLEICWAVGLKYTDGFSKWQPSLFTATTLIISM
FT                   FLLAKAAQTLPIGTAYAVWVGIGSLGTAIMGILLFQEHLSVFRLLYLVLMLISIFGLKY
FT                   TA"
FT   gene            complement(593345..594229)
FT                   /locus_tag="lpg0553"
FT   CDS_pept        complement(593345..594229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0553"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0553"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26648"
FT                   /db_xref="GOA:Q5ZY21"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY21"
FT                   /protein_id="AAU26648.1"
FT                   /translation="MMQPFIIDEKLVCRLIASQFPHYSNLPVKPVAVGGWDNRTFHLGK
FT                   DMLVRLPSAEQYELQVEKEQQWLPQLASLLPVPIPTPLAKGMPGEGYPWKWSIYRWLEG
FT                   ETIVSANLSNLNEIAKDLATFLTAFHQIDSSGGPKPGMHSFYRGGDLKIYDPETRQAID
FT                   YLKGKIDTDHATEIWETALNTSWQGTPVWVHGDISAGNLLVKNGKLCAVIDFGQLSVGD
FT                   PACDLAITWTLFAGDSRKIFREMLALDKGTWFRGQAWALWKALIVAAGIVNTNAMEVQK
FT                   SCHIINELFLTEL"
FT   gene            complement(594470..595537)
FT                   /gene="dinP"
FT                   /locus_tag="lpg0554"
FT   CDS_pept        complement(594470..595537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="lpg0554"
FT                   /product="DNA-damage inducible protein P"
FT                   /function="Nucleotide Metabolism, Replication and Repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0554"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26649"
FT                   /db_xref="GOA:Q5ZY20"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY20"
FT                   /protein_id="AAU26649.1"
FT                   /translation="MNPIRKIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIA
FT                   TCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLS
FT                   LDEAYLDVTESTQCQGSATWIAEEIRARIYQARQLTASAGIAPNKSLAKIASDWHKPNG
FT                   QMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLRALNIKTCADLQRYSIEYLLQKFGTMG
FT                   QRLYELARGIDNRPVNPERIRKSISVEETYPKDLPNSEACLAVLPDLMARLEARIQRAG
FT                   KISGIHNLFVKLKFNDFQQTTIERVMDKLDLIVLRQLIQEGFARRGMPVRLLGIGIKLK
FT                   QENTYQSVQLPLLDL"
FT   gene            595849..595922
FT                   /locus_tag="lpg0555"
FT   tRNA            595849..595922
FT                   /locus_tag="lpg0555"
FT                   /product="tRNA-Gly"
FT   gene            complement(595977..596597)
FT                   /locus_tag="lpg0556"
FT   CDS_pept        complement(595977..596597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0556"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0556"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26650"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY19"
FT                   /protein_id="AAU26650.1"
FT                   /translation="MDIKKLKKAASNFLERYPGGFYHPEMIEMGKKHKMDKMVALAQGS
FT                   FAKQNFKNPDEITNSMLKIVTQSSLISIFEKPKFRDFIKRTPPNDKVLIAKGLKELLYG
FT                   NEQEGFEELLFQFQREKLAKWTLMTIFQAYFNPEVDVFIKPTTTKNIIKELNLDIVYNP
FT                   TPSWEFYESYRNIINQMKTKIEKSLAPSNAAFCGFLMMSLDDR"
FT   gene            complement(596672..597496)
FT                   /gene="mutM"
FT                   /locus_tag="lpg0557"
FT   CDS_pept        complement(596672..597496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="lpg0557"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="3.2.2.23"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0557"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26651"
FT                   /db_xref="GOA:Q5ZY18"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY18"
FT                   /protein_id="AAU26651.1"
FT                   /translation="MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELC
FT                   QGKHITAITRRGKYILLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHVDLHINNGLAL
FT                   RFCDPRRFGLFIYIDENPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDS
FT                   QIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNSLTGHIKKILESAIEAGGTTLRDF
FT                   YSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT"
FT   gene            597907..599094
FT                   /locus_tag="lpg0558"
FT   CDS_pept        597907..599094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0558"
FT                   /product="stearoyl-CoA-9-desaturase"
FT                   /function="Lipid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0558"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26652"
FT                   /db_xref="GOA:Q5ZY17"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY17"
FT                   /protein_id="AAU26652.1"
FT                   /translation="MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHP
FT                   VVSHFFRFWLWLTTGMVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYRE
FT                   ARKDRDMVAKYSHGTPTDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWI
FT                   PLFAAGVINGIGHYWGYRNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWW
FT                   EFDIGWMYIRILSLFGLAKVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNV
FT                   IRPILKYEKNTGIETKEDKKLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYS
FT                   YKQSLQNVWLKTATTQKELVEALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE"
FT   gene            complement(599136..599534)
FT                   /locus_tag="lpg0559"
FT   CDS_pept        complement(599136..599534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26653"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY16"
FT                   /protein_id="AAU26653.1"
FT                   /translation="MFNKFLVTTLSVVTLTLSPYGFAKDDSCEVQVAVSTPPVQFDQSV
FT                   AFNVTNDDGISKSIILQGGSSPKTIGKLICSPLPYTISATQYFTPTGLTNKHAQPVGQC
FT                   VLKAGNVILNGSNNSVAVVFPNDFICHH"
FT   gene            599794..600540
FT                   /gene="phaB"
FT                   /locus_tag="lpg0560"
FT   CDS_pept        599794..600540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="lpg0560"
FT                   /product="acetyoacetyl CoA reductase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="1.1.1.36"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0560"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26654"
FT                   /db_xref="GOA:Q5ZY15"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY15"
FT                   /protein_id="AAU26654.1"
FT                   /translation="MSMDKMIAIVTGGTGGIGSAISQRLADSYQVVACYYKDGRHEEAK
FT                   KWQDEQRQLGYDIDIVYGDIAQYSDCEKITSLVMERYGRIDVLVNNAGITKDCSLRKMT
FT                   PQQWQQVLDANLTSVFNMTRNVVPVMLERGYGRIVSISSINGRKGQFGQCNYASTKAAL
FT                   FGFTKSLALEVASKGITVNTVSPGYIETPMLAALKEDVLNSIISSIPVGRLGYPKEIAD
FT                   AVAFLASPDSGFITGANLDVNGGQYM"
FT   gene            600719..601465
FT                   /gene="phaB"
FT                   /locus_tag="lpg0561"
FT   CDS_pept        600719..601465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="lpg0561"
FT                   /product="acetyoacetyl CoA reductase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="1.1.1.36"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0561"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26655"
FT                   /db_xref="GOA:Q5ZY14"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY14"
FT                   /protein_id="AAU26655.1"
FT                   /translation="MLNNNVVLITGGTGDIGTAVAKQLDSTFKHVIALDLVSYDEGEAW
FT                   LHDLKTQGYKNINFRHMDVTDYEQCAEVIGLIIEEFGGIDVLINNAGITRDAVFTKMTK
FT                   RQWDEVLRVNLDGMFNVTKQVVESMKAQESGRIVNVSSVNAQKGQFSQANYAASKAGVY
FT                   GFTKSLAQELMIKNITVNSISPGYVNTRLMKGIRPDILEGIINLIPAKRLAEPQEIAWA
FT                   IEFLISEKSRYITGANLSVNGGLHMY"
FT   gene            601595..601993
FT                   /locus_tag="lpg0562"
FT   CDS_pept        601595..601993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0562"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0562"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26656"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY13"
FT                   /protein_id="AAU26656.1"
FT                   /translation="MTRLIKKYKNRRLYDTEISQYITVEQLQKYVVDGIDFKIEDSETG
FT                   KDLTNSVLLQIIVEMEAGPTQFLSSEILRQIISLANHPMHVSFKEMMEQMFHAMDKPLQ
FT                   NNPYQQATEAWNKQMQQMVHQWQKMFKV"
FT   gene            602138..602494
FT                   /locus_tag="lpg0563"
FT   CDS_pept        602138..602494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26657"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY12"
FT                   /protein_id="AAU26657.1"
FT                   /translation="MTNNKDKVYYYIVQCNNMENIMTQYNFERWSEMAKKIQEPFQAIA
FT                   ELNVKTLQGLSYLKPDELAQVKKPEEMLEKQINLAVENGHKALDYMQKSFQIIEKAMLS
FT                   FVQEAKKTTAEVKK"
FT   gene            complement(602739..603809)
FT                   /locus_tag="lpg0564"
FT   CDS_pept        complement(602739..603809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0564"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0564"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26658"
FT                   /db_xref="InterPro:IPR010846"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="PDB:2IM9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY11"
FT                   /protein_id="AAU26658.1"
FT                   /translation="MKHTYNPFRYLIYFAFFITSLSSYSSQTTNIKEQTDTGLAPPAPA
FT                   ITTNSAAIEEQANSSIRKLYHTLNTMPNTSMADRISQISAYFKGTKYILGSLGEGPNAR
FT                   YDQFPRYRVDGFDCDTYVNTVLSLALANSLESFQECLKHTRYKNGKRSYINRNHFTSID
FT                   WNNYNQKRGLLKDITFSIRNEKKQPVALYANALINKPQWYNHKTIDTIRLQKQDKNEQE
FT                   KRLVELKAKGKTLETSLSNVPYIPFTALFSENKPNLHLFSQIPNGAVIEIIRPNWDLRQ
FT                   QIGTELDISHLGFAIWINNELFFRQASSQYGKVVDVSLIDYLDKARSSPTIKGINIQVV
FT                   LPEKPVSNGCQLFDIR"
FT   gene            603867..604484
FT                   /locus_tag="lpg0565"
FT   CDS_pept        603867..604484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0565"
FT                   /product="spore maturation protein A"
FT                   /function="Chemotaxis / motility / cell division"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0565"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26659"
FT                   /db_xref="GOA:Q5ZY10"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY10"
FT                   /protein_id="AAU26659.1"
FT                   /translation="MEAIMLNLIWLGMILISVVVGVIEGRIDEVVRAVTDSAKLGFELA
FT                   LGLAGIMTFWLGIMSVATESGLVSILGKVLKPVLKRLFPDIPVEHPAMGAMVMNIAANM
FT                   LGLANAATPFGLQAMKELQSLNQNLKVATNSMCTFLAINTSSVQLIPVTAIAFLAANGS
FT                   TNPSSVVFTSLIATTVSTLVAIVAVKQLAKLPRFKIERTDSL"
FT   gene            604481..605014
FT                   /gene="spmB"
FT                   /locus_tag="lpg0566"
FT   CDS_pept        604481..605014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="lpg0566"
FT                   /product="spore maturation protein B"
FT                   /function="Chemotaxis / motility / cell division"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0566"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26660"
FT                   /db_xref="GOA:Q5ZY09"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY09"
FT                   /protein_id="AAU26660.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALTMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
FT   gene            complement(605145..606578)
FT                   /locus_tag="lpg0567"
FT   CDS_pept        complement(605145..606578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0567"
FT                   /product="peptidase, M23/M37 family"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0567"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26661"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY08"
FT                   /protein_id="AAU26661.1"
FT                   /translation="MDKRPNIPKRKSGNSSKLLAFFALVFAFSLPYLLVKNFSHPKRSS
FT                   YADQTDLYPELSDELSRDIPAEASTEIPHEKPDIKSATKPMQTKQDQQDKPINTSHVKK
FT                   DNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKNK
FT                   LEKLIVPVNTIQTLTVYRAGKIYKTKIDSKKTTTQNRYVTATVQGSLYTTAQRFNIPSK
FT                   LVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTYTNRGKTYQAI
FT                   RHTNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYRRAHKGIDLAA
FT                   PIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTIYGHLLKFQKGLSKGSRVKRGQ
FT                   VIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKAKASTLLARL
FT                   KLFEQAQLASKGKKKVNVG"
FT   gene            606769..608040
FT                   /gene="tyrS"
FT                   /locus_tag="lpg0568"
FT   CDS_pept        606769..608040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="lpg0568"
FT                   /product="tyrosyl tRNA synthetase"
FT                   /function="Amino Acid Metabolism, Translation"
FT                   /EC_number="6.1.1.1"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0568"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26662"
FT                   /db_xref="GOA:Q5ZY07"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZY07"
FT                   /protein_id="AAU26662.1"
FT                   /translation="MLTGLRYSLREDRSIIYTGFNDMIVQDSVCSELMRGCEEILPVPE
FT                   LEKKLQKGIPLKIKAGFDPTAPDLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDP
FT                   TGKNVTRMPLSQETVLENAKTYQHQVFKILDPDKTTVAFNSQWLNKFNAVDLIRLAATH
FT                   TVARMLERDDFNKRYTTGQPIAIHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRE
FT                   LQKHYGFEPQVVMMTPLIEGLDGVKKMSKSLDNYIGINETPEQMFGKIMSVSDELMWRY
FT                   IDLLSFKTGKEIQQLKQSVLEGKNPRDVKIDFAKEIVARFHDQTQAEFAHNKFIERFQK
FT                   GNIPEDLEELSLVIAEPIALAQLLKQIDLTASTSESIRMVKQGAVKVDGDKISDPSLKL
FT                   PIGKSYIIQVGKRRIAKLSIQQAD"
FT   gene            608222..609696
FT                   /locus_tag="lpg0569"
FT   rRNA            608222..609696
FT                   /locus_tag="lpg0569"
FT                   /product="16S ribosomal RNA"
FT   gene            609838..609913
FT                   /locus_tag="lpg0570"
FT   tRNA            609838..609913
FT                   /locus_tag="lpg0570"
FT                   /product="tRNA-Ala"
FT   gene            610080..612981
FT                   /locus_tag="lpg0571"
FT   rRNA            610080..612981
FT                   /locus_tag="lpg0571"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(611310..611660)
FT                   /locus_tag="lpg0572"
FT   CDS_pept        complement(611310..611660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0572"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0572"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26663"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY06"
FT                   /protein_id="AAU26663.1"
FT                   /translation="MASSFSWKPGINDFSVPKGQNHFAPQSYGKPDLPSLPPYMQVPGQ
FT                   PTPGSPSLLRPHFTTYKKSRNINLVPIDYALQPRLRGRLTLLRLTSCRKPGTSGVWAFH
FT                   PHYRYSCQHSHF"
FT   gene            complement(612151..612492)
FT                   /locus_tag="lpg0573"
FT   CDS_pept        complement(612151..612492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0573"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26664"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY05"
FT                   /protein_id="AAU26664.1"
FT                   /translation="MALPFRTTGSLRPTFVPARAVTLAVKHPFAFTLLVRCPTVPRVPL
FT                   CSSVTLWEETAPVKLPIIHCPHPGLLDQVRTSITTGWYFKGGSMRTSVLTSQPPTYPTQ
FT                   SSSKSSAKL"
FT   gene            complement(612269..612550)
FT                   /locus_tag="lpg0574"
FT   CDS_pept        complement(612269..612550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0574"
FT                   /product="hypothetical protein CTC00065"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0574"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26665"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY04"
FT                   /protein_id="AAU26665.1"
FT                   /translation="MNSWAVSACYPRSTFYPLSDGPSIQNHRITKTNFRSCSSRHSRSQ
FT                   APFCLYTLGTMSDRTEGTFVLLRYSLGGDRPSQTTHHTLSSSRITGPS"
FT   gene            613083..613200
FT                   /locus_tag="lpg0576"
FT   rRNA            613083..613200
FT                   /locus_tag="lpg0576"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(613387..613923)
FT                   /gene="yrdA"
FT                   /locus_tag="lpg0577"
FT   CDS_pept        complement(613387..613923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="lpg0577"
FT                   /product="transferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0577"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26666"
FT                   /db_xref="GOA:Q5ZY03"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY03"
FT                   /protein_id="AAU26666.1"
FT                   /translation="MNYSIRKFEDKYPELGERVYIDPQSTVIGNVTLGDDVSVWPMAVI
FT                   RGDVNYIQIGHSCSIQDGAVLHVTHDGPYTPGGRPLILGQGITVGHKALLHACTINDYC
FT                   LIGMGSIILDSAHIQKHVMIAAGSIVPPGKILQSGYLYLGSPVQAVRKLTAKEIEQIEY
FT                   SAGHYIRLKNKYLTY"
FT   gene            complement(613930..615294)
FT                   /gene="gor"
FT                   /locus_tag="lpg0578"
FT   CDS_pept        complement(613930..615294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="lpg0578"
FT                   /product="glutathione reductase"
FT                   /function="Amino Acid Metabolism, Metabolism of Other Amino
FT                   Acids"
FT                   /EC_number="1.8.1.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0578"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26667"
FT                   /db_xref="GOA:Q5ZY02"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY02"
FT                   /protein_id="AAU26667.1"
FT                   /translation="MTMKTKHFDLIVLGGGSGGIASAVRAAQYGAKVAVIEQNHLGGTC
FT                   VNLGCVPKKIMYNASSIAETLHKSPDYGFFLENNAKLDWKRLVNKRNAYIERLRENYEK
FT                   RFSQHKITLIQGKGIFHDQSSITIDHTIYQAEHIIIATGSEPALPAINGIKHAIDSDGF
FT                   FSLTKLPAKVAVIGSGYIGVELAGILNSLGSETHLLMRGTRPLSRFDHMIGDTLMEIMQ
FT                   KQGICIHQNHKAQAIHLHSDGRKSILCQSGSIIENIDVIISAVGRKPRTGNLNLDKINV
FT                   NMDDKGLILVDAFQNTSVKGIYAIGDVTNAPALTPVAIAAGRRLADRIFGNQPDACLNY
FT                   DNICSVVFSHPPSGSVGLTEHEAIEKYGKNKIKIYQTRFIPMYDALSIDKTPTAMKLVT
FT                   LGKKEKIIGLHVVGYSADEMLQGFGVAIKMGACKKDFDNTIAIHPTSAEEFVTMV"
FT   gene            614238..614369
FT                   /locus_tag="lpg0579"
FT   CDS_pept        614238..614369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0579"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26668"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY01"
FT                   /protein_id="AAU26668.1"
FT                   /translation="MEDERTLLNKYYHNLSRHQVDSRKFGLPNASLPLLQRELVREH"
FT   gene            complement(615519..616499)
FT                   /gene="add"
FT                   /locus_tag="lpg0580"
FT   CDS_pept        complement(615519..616499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="lpg0580"
FT                   /product="adenosine deaminase"
FT                   /function="Nucleotide Metabolism"
FT                   /EC_number="3.5.4.4"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0580"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26669"
FT                   /db_xref="GOA:Q5ZY00"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZY00"
FT                   /protein_id="AAU26669.1"
FT                   /translation="MNLKKAELHVHLEGTISPELAKKLAKRNQLTLPNGLIAPDEKSYL
FT                   SKDFLDFLKVYDTLASVIKNPQDYYDITFDYLKSNAQEHAIYIEMMYSPDHAEQSSGIP
FT                   SKEHLAAIQQAIDDAKSQFDIVGRIIITAVRHFGVEACERVAKQASIDKFPCVTGFGLG
FT                   GDEAKFPPQLFTKAYQIAADSGLECTVHAGEFDSAKGMEEAMKTLPIKRIGHGVRVIDS
FT                   PDIMAMVKDQGIALEVCPTSNIFLGLFKDMNSHPFPKLYEAGIKVSINSDDPPFMSTTL
FT                   AQEYKRVQKAYGYNNDTMNNITRMAIEAAFVDEKTRKELLTKLEQ"
FT   gene            616597..616782
FT                   /locus_tag="lpg0581"
FT   CDS_pept        616597..616782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0581"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0581"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26670"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ9"
FT                   /protein_id="AAU26670.1"
FT                   /translation="MNTDDINKAYVSPYDKFLYEFDATHKKSASQLQEIKKHQRIFKMR
FT                   DDKDYKIDQSEIWEEF"
FT   gene            616847..617326
FT                   /locus_tag="lpg0582"
FT   CDS_pept        616847..617326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0582"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26671"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ8"
FT                   /protein_id="AAU26671.1"
FT                   /translation="MTGLYCISKDKDEKSIHSALNNPALLNKAMQLKSIGKVALSQNQL
FT                   TYLKIHDEWIHELFPLLQNEQIRKPDYFGNESIGAHISIIYPEENTTINPKELDQEHRF
FT                   KIKNIIKANLELKKYYAIIVEASSLARLRKAYGLPENLYFKGYSIHFHITVGVEI"
FT   gene            complement(617366..618619)
FT                   /locus_tag="lpg0583"
FT   CDS_pept        complement(617366..618619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0583"
FT                   /product="phosphate transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0583"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26672"
FT                   /db_xref="GOA:Q5ZXZ7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ7"
FT                   /protein_id="AAU26672.1"
FT                   /translation="MDYSIYLLFAALILCFLMTWGVGANDLANVMSTTMGSKAVTVRQA
FT                   MLIAIIFEFAGAFLGGEGVTETMRDGIINTSQLSNEPLILIEGMLCVLFACTIWMNLAS
FT                   YLGVPVSITNALVGSMVGFGTIVLGPDAIHWNQVARIAIGWISSPLISGITAYALFISI
FT                   QQTIFVKSNPLTKAKLYIPIYLFLIGFILSFITVFKGLNHFDIHLNLKQDLAVTLATSI
FT                   IITILGMIFIKRIPEYHKIRRRERFIQVEKYFAVLMAMTACAMAFAHGSNDVALAVGPL
FT                   SIVHSLVMHSNQIFDADNYPSWIILLGCVGVVTGFLMYGRKVIETVGSSITALTPSRAF
FT                   AATLSAATTVVVATSTGIPVSATQTLVGAVLGVGLARGIGALNLIVIRNIFMSWVLTLP
FT                   AASMLTILSYKLLHALLG"
FT   gene            complement(618629..619300)
FT                   /locus_tag="lpg0584"
FT   CDS_pept        complement(618629..619300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0584"
FT                   /product="hypothetical phosphate transport regulator"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0584"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26673"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ6"
FT                   /protein_id="AAU26673.1"
FT                   /translation="MGSIFNMFGPSPIKPIEQHIRKAHQCAKQLYPFFEAVLKNDWDTA
FT                   NKIKDKIISIEKEADLIKRDLRLHLPTGLFLPVARTDILELLSAQDRIANKAEDIAALI
FT                   ISRQMSIPKKLIPSFMPFLSRCLDASKQACTAINELDELLETGFRGSEVKIVEEMIVKL
FT                   DEIEHDCDERLADIRHKIFELEKELPAIDVIFLYKLVQWIGELADHAQTVGGRLQILIA
FT                   R"
FT   gene            619488..620252
FT                   /locus_tag="lpg0585"
FT   CDS_pept        619488..620252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0585"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26674"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ5"
FT                   /protein_id="AAU26674.1"
FT                   /translation="MIKRWLLVILLISGNAFSQQMITKVIELNYLQADKVIQLIQPLLQ
FT                   TDEKVSGSGQTLIVNVSPQTLTQIRNVLHKIDVPPVVFNITVYQGDPEWLSSQDGNDVV
FT                   YSTQPQYEVQRSQSVKVMSGESAFVATGEQVPVVTSVGVGLLATGVSYEQHNIQNGLLV
FT                   HPVLQGSQVKLTVRRVREQENVESDQQFDNQQIDTTIMAPLNKWVPLGTAEGVQNTDSS
FT                   STSYTAGRPFSQNSTLYIKVSVVKSTPSGTTK"
FT   gene            620555..621118
FT                   /locus_tag="lpg0586"
FT   CDS_pept        620555..621118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0586"
FT                   /product="transcriptional regulator"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0586"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26675"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXZ4"
FT                   /protein_id="AAU26675.1"
FT                   /translation="MAIISSLANHLLIAMPSLKDPNFERSVVYLCEHNEQGSVGLIINR
FT                   PLQFPLSIVFEQLQIEPIRVEKNGLPLLFGGPVQPERGFVIHKQMGGWRSSLFLQDEVT
FT                   VTTSNDIIRAIAYDEGPKDVLITLGYAAWTEQQLEREIMSNTWLVCPYKSEILYEVPFE
FT                   ERWEYAGLTLGIKMNQLSSDAGHA"
FT   gene            621102..621530
FT                   /gene="yqgF"
FT                   /locus_tag="lpg0587"
FT   CDS_pept        621102..621530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="lpg0587"
FT                   /product="YqgF"
FT                   /function="Replication and Repair"
FT                   /EC_number="3.1.-.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0587"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26676"
FT                   /db_xref="GOA:Q5ZXZ3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXZ3"
FT                   /protein_id="AAU26676.1"
FT                   /translation="MLAMPRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPD
FT                   WNTIQKVITQWNPQALIVGLPTCIDDRELYTTSAARRFAKQLHKRFSLPVHLVDERLST
FT                   VEARGYLFEQGGYRQIKKAEVDSIAACVILEQWLQQSE"
FT   gene            621580..622473
FT                   /gene="pyrB"
FT                   /locus_tag="lpg0588"
FT   CDS_pept        621580..622473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="lpg0588"
FT                   /product="aspartate carbamoyltransferase"
FT                   /function="Nucleotide Metabolism, Amino Acid Metabolism"
FT                   /EC_number="2.1.3.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0588"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26677"
FT                   /db_xref="GOA:Q5ZXZ2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXZ2"
FT                   /protein_id="AAU26677.1"
FT                   /translation="MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYE
FT                   NSTRTRISFELAERHLAMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDG
FT                   LQQNLANKLGDTVNIINAGDGTHAHPSQAILDMVTIIEQKKRLDKLKIAILGNIKHSRV
FT                   ANSFQCICSKLGVGELVLISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQKERLL
FT                   QDDHLDLDFYRNNFALTQKSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVT
FT                   NGVYARMAILESLIAS"
FT   gene            complement(622587..622973)
FT                   /locus_tag="lpg0589"
FT   CDS_pept        complement(622587..622973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26678"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ1"
FT                   /protein_id="AAU26678.1"
FT                   /translation="MRSIRLLFPCILLMIPWQFATANRPTDNALAIIKSCYDESVNLSN
FT                   EFTPCVTKKLKTMPNAENFQLIMNFKTDEKGTNERIPVFMVDKTGYMYYCIVTTGKTLI
FT                   INACAGEQGKPLTQGQMLSIDLPE"
FT   gene            complement(623078..624589)
FT                   /gene="comM"
FT                   /locus_tag="lpg0590"
FT   CDS_pept        complement(623078..624589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="lpg0590"
FT                   /product="competence related protein ComM"
FT                   /function="Transport and binding, Signal transduction /
FT                   other regulatory functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0590"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26679"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXZ0"
FT                   /protein_id="AAU26679.1"
FT                   /translation="MNLAFTKTRSTIGIVAQPVSVEVHLSNGLPGFTMVGLAETAVKES
FT                   KDRVRSAIINSQFEFPCRKITVNLGPANLPKTGSGFDLPIALGILAASEQIPLTNLANH
FT                   EFIGELALSGELRGVSAIIPAVLAAHKDNQHLIIANANAAEASLTGHPKVFTANNLREV
FT                   CDYLCQGTSLQNLPPKPDLLLNNHELDWSDIKGQHHAKNAMVIAACGGHSILLSGAPGS
FT                   GKTMMAKRFSTLLPELSETQALECAAINSIRGKLPDFREWRLPPFRAPHHTASPVALVG
FT                   GGNPPKPGEISLAHHGVLFLDELPEFNRQVLETLREPLESGHICISRAAAQIEFPAKFQ
FT                   LIAAMNPCPCGQWGNSQANCLCTPDRISRYLAKLSAPLLDRIDMQVTIHALSQEELIKP
FT                   NTHLEKQSPAIREKVTKMHEIQMARQDSLNANLNSKTCEMVCELGSEEQLFLREVMSKL
FT                   KLSARGYHRLLKVSRTIADMSECNKVMLNHLQQALSYKQILHLPK"
FT   gene            complement(624654..624914)
FT                   /locus_tag="lpg0591"
FT   CDS_pept        complement(624654..624914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0591"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0591"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26680"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY9"
FT                   /protein_id="AAU26680.1"
FT                   /translation="MFDPKQFDELANKLFATLPTSLQNFEKDIQQKFKEVLQSTFSRMD
FT                   LVTREEFDVQCKVLARTREKLEQLQHQLEDFIKRQEVKNNK"
FT   gene            625023..625397
FT                   /gene="glnK"
FT                   /locus_tag="lpg0592"
FT   CDS_pept        625023..625397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="lpg0592"
FT                   /product="nitrogen regulatory P-II transcription regulator"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0592"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26681"
FT                   /db_xref="GOA:Q5ZXY8"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY8"
FT                   /protein_id="AAU26681.1"
FT                   /translation="MGGSAFNVMEKNMKMITAIIKPFKLDDVHEALMEIGVPGITISET
FT                   RGFGRQKGHTELYRGAEYVVDFLPKIKIELALPDNMVEAAIEAICKSAYTGKIGDGKIF
FT                   VYALEQVVRVRTGEVGTDAL"
FT   gene            complement(625407..625988)
FT                   /locus_tag="lpg0593"
FT   CDS_pept        complement(625407..625988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0593"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /function="Metabolism of Cofactors and Vitamins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26682"
FT                   /db_xref="GOA:Q5ZXY7"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY7"
FT                   /protein_id="AAU26682.1"
FT                   /translation="MSDQYKVALRNTIKQVRSKLSVPYRTASSNQICTRIRSLEQYRQA
FT                   KRIALYFAVNGEVDLTFLWKSAPLQGKYCYFPVLNNDSTLSFLPATPSTPFKTNKYDIP
FT                   EPDVDIELALPIDELDLIIMPLVAFDAHCTRLGMGSGYYDRTLANKSKAHLLGVAYQFQ
FT                   RVDYIEPRPWDVPLDAVITQKAIYWRNPLA"
FT   gene            626235..626420
FT                   /locus_tag="lpg0594"
FT   CDS_pept        626235..626420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0594"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26683"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY6"
FT                   /protein_id="AAU26683.1"
FT                   /translation="MSDLFEEDEEEVIEVVDDFDDVEVDTEIIEAPGVSLDARRRLENM
FT                   LEEKRLRDELDDFVDY"
FT   gene            626434..627249
FT                   /locus_tag="lpg0595"
FT   CDS_pept        626434..627249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0595"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /function="Amino Acid Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26684"
FT                   /db_xref="GOA:Q5ZXY5"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="PDB:3LUL"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY5"
FT                   /protein_id="AAU26684.1"
FT                   /translation="MPTRVIEDKGDMTPSFGIDDRIFLGEGLFETIRVNSSKPSFAYMH
FT                   WERLGNSARQLGIPFEISFDDWFEHLIQKIQKDNLYHGGIKAILSGGPASRGLAERGQV
FT                   SQLIFQTFNYSIQKHPVRLISINWLRDKANPLYQLKSVNYLEAIIAQRQAIAVGADDAL
FT                   FFNTENHVTETTCANLFLIENNILYTPRVEDGILPGITRARLISHCQQHKMSVQEISLT
FT                   KKRIEDADAVFLTNSLQGIRRVLSLDNIIFEVNHPIIDKLIFLLNQDES"
FT   gene            complement(627276..627971)
FT                   /locus_tag="lpg0596"
FT   CDS_pept        complement(627276..627971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0596"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26685"
FT                   /db_xref="GOA:Q5ZXY4"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY4"
FT                   /protein_id="AAU26685.1"
FT                   /translation="MREGLRVLNSCNKVRGIFTLTQKTIKTFCFILAILVLIIFAVVFH
FT                   NHSLEIIDYIDDLGWLAPVLFLITYCLATLLLLPTMVLTLAGGAVFGPVFGTLLNLLGA
FT                   TSGAALAFLITRHLVYDWFSTKKGEKLNKLIAGVDEKGWVFVAFLRLFPIVPFNLVNYG
FT                   LGVTGISFRLYLLTTFIFLIPAEIIYTYFGYVGMDALTRPGHLYRNGGIFLTGLAIFFL
FT                   LVIRIMKKR"
FT   gene            628114..630315
FT                   /gene="aas"
FT                   /locus_tag="lpg0597"
FT   CDS_pept        628114..630315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="lpg0597"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /function="Lipid Metabolism"
FT                   /EC_number="6.2.1.20"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26686"
FT                   /db_xref="GOA:Q5ZXY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY3"
FT                   /protein_id="AAU26686.1"
FT                   /translation="MMTKTNEENLTWKGKQKQRARAWIKIFLEKWFRIEVKGQYQANSH
FT                   SVIIANRASIIDVLLLSVFLPERLTLALHPDMFKKIWVKTLLFFADVIVVDPGSAQATR
FT                   ILIRAIRAGKRCLLFPQGLLRQQEDSLKVFEGPGLILQRVGAEVIPVRIEGAEHSIFSN
FT                   SKNKHRIRIFPKITLHILPAQKLSQAENTGVDREGISLRLFQLISDLSFANSFKPYVLF
FT                   SALIEGVSIGTKNKTKIEDNNRIPLTYRQFLARCFILGRQIKKQTAVGETVGVMMPTTI
FT                   AGMVTFFALQAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTARQFIETAKLEPLVEEF
FT                   QQAGIRIHYLEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKISSDTTGIILFTSGSEG
FT                   KPKGVALSHANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGLTAGSVLPLVNGLNCFF
FT                   YPSPLHYKVIPGLIYQTRATILFGTDTFLTGYARAAGKHDFNSVRYIFAGAEKVKPETI
FT                   RYWSEAFGARIYEGYGATEASPVISLNCPLASVPGSVGMILPFMDFKVEPVEGIVQGGR
FT                   LKLCGPNIMLGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFITIAGRAKRFAKIAGEM
FT                   VSLTAVEGIAASIWPELLHAAVVQKSPRKGEQIFLFTEAEYADKVSFIKKVKERGQSEL
FT                   LVPHMIYPACQIPVLPSGKIDYITLEKQFLEQKETMETV"
FT   gene            630316..630735
FT                   /locus_tag="lpg0598"
FT   CDS_pept        630316..630735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0598"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0598"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26687"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY2"
FT                   /protein_id="AAU26687.1"
FT                   /translation="MKLIWIVLALILALVVILYLFPQINFREMPKGLVEGQLPDDKPNW
FT                   VSSLVNESDSHYIAPLKVESMPQLVACIERKIPELKIQKQEASFLVGYRQSPFFHFVDW
FT                   LCIHADGNVISSATMGYSDFGKNRELVEKIRSLCL"
FT   gene            complement(631254..633014)
FT                   /locus_tag="lpg0599"
FT   CDS_pept        complement(631254..633014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0599"
FT                   /product="poly-beta-hydroxybutyrate polymerase"
FT                   /EC_number="2.3.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26688"
FT                   /db_xref="GOA:Q5ZXY1"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR010963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY1"
FT                   /protein_id="AAU26688.1"
FT                   /translation="MLSGARMTHDTELSELMQAVAKKSLQIMTDFKEKPIPISSLVSQY
FT                   IDLTEHFQNLIAVILKNPEKVWQMQLNYLEDALSLAQAQFNYWLEGKPLPINDQRFNGE
FT                   DWINNPFFNLLSQHYLLANEHMNSLLENMEYGDENLAKRVRFFTRQYLDALSPANFIHT
FT                   NPQLMAETLQSHGKNLLRGLHNLLSDVEAGSSRLIIKMTDTEAFKIGENLATTPGKVIF
FT                   RNSMMELIQYCPRTTKVKSIPLLIVPPWINKYYILDLSPHNSLIRWLVEQGITVFIISW
FT                   VNPDETYANKSFYDYLNEGPREAIAVIQKQLRVKQVNTLGFCIGGTLLASLLAYNKATK
FT                   DHSIRSATFLAAMIDFSDPGDIAVFIDEQQINKLEEEMKSKGYLAGKFMASSFNSLRAN
FT                   DLIWSFFIKNYLRGKSPVPFDILYWNADSTNMPATMHSQYLRWMYLHNNLIKPGKIRLN
FT                   HIPIDVTNIDIPTFFLSTQKDHIAPWKTTYKGFELMKGPKRFVLGGSGHIAGIINPPTQ
FT                   QKYGYRTNNSMDLSAEQWFEKSKEHSGSWWPEWLNWLKLHSGRLINSPDINHLPFAPIM
FT                   DAPGSYVLKK"
FT   gene            633437..633898
FT                   /locus_tag="lpg0600"
FT   CDS_pept        633437..633898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0600"
FT                   /product="rrf2 family protein"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0600"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26689"
FT                   /db_xref="GOA:Q5ZXY0"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR014290"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXY0"
FT                   /protein_id="AAU26689.1"
FT                   /translation="MLRVSKLADYGTVVMVYLAKHSQELCNARDIALHTHLTVPTVSKI
FT                   LKRLTSAGLLTSVRGVSGGYRLQRPAAEISVSQIIFALEEHRGFTECSMQPNDCFLQGV
FT                   CTIQGNWRLISHAIETALDSVSLEALAKPTLPTRDVERVRQLASGVNRG"
FT   gene            633891..635339
FT                   /gene="ycf24"
FT                   /locus_tag="lpg0601"
FT   CDS_pept        633891..635339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf24"
FT                   /locus_tag="lpg0601"
FT                   /product="ABC transporter, permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0601"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26690"
FT                   /db_xref="GOA:Q5ZXX9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX9"
FT                   /protein_id="AAU26690.1"
FT                   /translation="MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIK
FT                   GEPEFLLEWRLKAFRHWLTMPHPEWSSVHYLPIDYQSISYYSAPKSKKDAPKSLDEVDP
FT                   ELLKTYEKLGIPLREQEMLAGVAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYP
FT                   DLVKKYLGSVVPYRDNFYAALNSAVFSDGSFVYVPNGVRCPMELSTYFRINAASTGQFE
FT                   RTLIVADVDSYVSYLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGK
FT                   GGIYNFVTKRGACRGKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQ
FT                   QADTGTKMIHLGKNTRSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGS
FT                   QCSAHTFPYIEVKNPTAQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVL
FT                   KELPMEFAVEATKLLGISLEGAVG"
FT   gene            635341..636093
FT                   /locus_tag="lpg0602"
FT   CDS_pept        635341..636093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0602"
FT                   /product="ATP transporter, ABC binding component,
FT                   ATP-binding protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0602"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26691"
FT                   /db_xref="GOA:Q5ZXX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX8"
FT                   /protein_id="AAU26691.1"
FT                   /translation="MLNIKELNVAVNGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSK
FT                   VLAGHPSYEVTRGDISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVN
FT                   AVRKGQGKNTLDAIEFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALE
FT                   PKLAILDETDSGLDIDALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANG
FT                   RIITSGDKSLALELEKKGYSWLEEVEQL"
FT   gene            636090..637376
FT                   /locus_tag="lpg0603"
FT   CDS_pept        636090..637376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0603"
FT                   /product="ABC transporter, permease component"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0603"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26692"
FT                   /db_xref="GOA:Q5ZXX7"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX7"
FT                   /protein_id="AAU26692.1"
FT                   /translation="MSDILDYYQQQAQLGVSQIPWLAQLQSKALTDLKRRGFPTRYDEE
FT                   WKYTLVDSLLQQHFVPPDPTVKPALKTAFDDSPVKNLFLIQNGFISQEQEWIKNLPQGV
FT                   LILPLSLALIHYADLVKPHLGKIMEQEHGFHYLNTAMLQCGVFIYIPEGICLEEPIVLK
FT                   HIQDQTNQAMYLRHLILMEKESQATLIEEYHGEENICYFTNSITEVFLGAGAKLNHYKI
FT                   QKESKSAYHLGHLSVRQSAASQFSSHSLSLGGKLVRSDISVSMQEEQAQCLMNGIYAPG
FT                   DGQHIDHHTVVHHLVPNCRSDQDYKGILKGHSRAVFNGKVIVAKNAQHTDAKQQNKNLL
FT                   LSANAEIDTKPQLEIFADDVLCSHGATVGQLDEEAIFYLATRGISRDEASHYLIQAFAN
FT                   DNLRLIPNRDLADWMGNLLTQQLGYANEY"
FT   gene            637366..638610
FT                   /locus_tag="lpg0604"
FT   CDS_pept        637366..638610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0604"
FT                   /product="aminotransferase"
FT                   /function="Metabolism of Other Amino Acids"
FT                   /EC_number="4.4.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0604"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26693"
FT                   /db_xref="GOA:Q5ZXX6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="PDB:6C9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX6"
FT                   /protein_id="AAU26693.1"
FT                   /translation="MSTNPSLMTSFDVNKIRKDFPVLHQKINEYDLVYFDNAATTQKPK
FT                   AVIDAIAQFYEKDNSNVHRGVHALSVRATEMYEAARAKVKRFINARSPRECIFVRGTTE
FT                   AINLVAQSLVAPRILPDEEILITHMEHHSNIVPWQMVCKKMGCKLQVAPISLNGEVILE
FT                   EFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQD
FT                   LDCDFYAFSGHKMYGPTGIGVLWGKEELLNSMTPYQGGGEMINSVSFEATEYAAIPHKF
FT                   EAGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAANKV
FT                   PIISFVHGKIHAHDIGTILDSEGIAIRSGHHCTMPLMDFYDVAATSRISMSFYNTFKEI
FT                   DYCMEALQRVKEVFA"
FT   gene            638607..639056
FT                   /locus_tag="lpg0605"
FT   CDS_pept        638607..639056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0605"
FT                   /product="nitrogen fixation protein (Fe-S cluster
FT                   formation) NifU"
FT                   /function="Energy Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0605"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26694"
FT                   /db_xref="GOA:Q5ZXX5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX5"
FT                   /protein_id="AAU26694.1"
FT                   /translation="MSMELRELYQEIIIDHNRNPRNHHAMEDATTEAKGFNPLCGDKLT
FT                   VYLKLQGDLIRDVSFIGCGCAISQASASLMTDALKGKSIKEAHELFHRVHRMLTQEEED
FT                   SLVSMDKLTVLAGVKAFPARVKCATLAWHTLEAALNKETEVVKTE"
FT   gene            639092..639463
FT                   /locus_tag="lpg0606"
FT   CDS_pept        639092..639463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0606"
FT                   /product="metal-sulfur cluster biosynthetic enzyme"
FT                   /function="Nucleotide Metabolism"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26695"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR014291"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V871"
FT                   /protein_id="AAU26695.1"
FT                   /translation="MSVYCKIDQRQLMFGFKKKQSNESIKEGVITALRGVFDPEIPVNI
FT                   YDLGLIYDIAVNDEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEP
FT                   PWSQDRMTEAARLELGIFY"
FT   gene            639466..640419
FT                   /locus_tag="lpg0607"
FT   CDS_pept        639466..640419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0607"
FT                   /product="lysyl tRNA synthetase"
FT                   /function="Amino Acid Metabolism, Translation"
FT                   /EC_number="6.1.1.6"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0607"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26696"
FT                   /db_xref="GOA:Q5ZXX4"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX4"
FT                   /protein_id="AAU26696.1"
FT                   /translation="MSDNSWLPSASIQLLRARAELIGKIRQFFTERQYLEVETPVMARH
FT                   GVTDVYLSNIKAIFRGETCYLQTSPEYHMKRLLAAGSGPIFQLARVFRDDELGRWHNPE
FT                   FTLLEWYQLHIDHHVLMDEVDLLLQIILKSRPMIRKTYQQAFEEACGIDPFSTSIEQFN
FT                   KVLAQHDLDGVLSPNEQDRDQYLFLLMSHVVEPFLAEESTPVAVYHFPASQAALAQVKE
FT                   GLAERFEVYYQGVELANGFHELTDVEAQKKRFMLDQQHRKQKGLTAMEADAYLLKALEY
FT                   GLPPCSGVALGVDRLLALALKQPSIEKILSFDFSRS"
FT   gene            complement(640492..641406)
FT                   /locus_tag="lpg0608"
FT   CDS_pept        complement(640492..641406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0608"
FT                   /product="hypothetical SAM-dependent methyltransferase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0608"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26697"
FT                   /db_xref="GOA:Q5ZXX3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX3"
FT                   /protein_id="AAU26697.1"
FT                   /translation="MELPYHFSTAYVSKPEFIEALSEELGEVSNKIGSLVFSPHQKLDV
FT                   CFALDVWLEPEIVTFQSISEAAKILRQAGKFWYLHPVTEIRRSRLIEEQLRKCPSLMSH
FT                   FPVTSDIPPIGVFSLLDRNTLLFSAKRLKKWPDGQCYFIEDKVNPPNRAYLKLWEALFL
FT                   LNKYPLPGETVLDLGASPGGWTYVMQSLGTQVTSVDKAELDTKIMALPRVSFLKQSAFA
FT                   LDPEQLTESYDWVLSDVACYPDRAYTLIKKWIASKKAKQLIFTIKLQGQTDLNTIKRFQ
FT                   SIPNSKVINLFYNKHEVTFFYPV"
FT   gene            complement(641653..642426)
FT                   /gene="alaS"
FT                   /locus_tag="lpg0609"
FT   CDS_pept        complement(641653..642426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="lpg0609"
FT                   /product="alanyl tRNA synthetase"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0609"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26698"
FT                   /db_xref="GOA:Q5ZXX2"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX2"
FT                   /protein_id="AAU26698.1"
FT                   /translation="MGFVTHSILCLMRQFAYCINSYQNKSLCSPRAYEKDFIDGSVAME
FT                   KIFWSNPYQHTLDTKIISINGNEILLEKTIAFSFSGGQESDRAFINGLEVLSSRIDGNL
FT                   IYYTLPDDHNLAPNDVITMTIDWPRRHRLMRLHFAAELILELVTRTSMLEKVGAHISES
FT                   KARIDFKANFNISSIFSQLLDEYNAIIRQDLVIYKGYHDVTNQRRFWKIDGFAEVPCGG
FT                   THVHSTSEVGFIRLKRSHPGKSIERIEITLMDDSR"
FT   gene            complement(642300..643607)
FT                   /locus_tag="lpg0610"
FT   CDS_pept        complement(642300..643607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0610"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0610"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26699"
FT                   /db_xref="GOA:Q5ZXX1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX1"
FT                   /protein_id="AAU26699.1"
FT                   /translation="MEGVMNQNSFKPKNNFVSLVMWALPLSFFTFQFLLRLWPGLTMQD
FT                   IMAQFSIDAASFGLIAAFYYYGYAGMQIPVALLLDKFGARFVVFAFAMLCGIGTLVFIG
FT                   TNNFYLALSGRFLIGVGSAAGFLGVSKVVSEWFSHSQYSRMIGLSFSVGLLGAIYGGKP
FT                   LAHLIQNFSGQQVGLALAVFSILLGCCALLILRSPPNNTHSVTKTMNLSHCSSLFSSWI
FT                   IWALALANLLMVGALEGFADVWGVPYLIAKYALNKTDAAFLISFIFMGMIFGGPLLAFL
FT                   SQKLGNYFVIALCGTGLAFLFLILLYTATLHWWQLGTLFFAIGLLCCYQVIVFAAGSTL
FT                   VPYEGLGVTIAFLNCINMLGGSFFHTLIGKLMDSSWSGQMSANGLKLYEMESYQWALSL
FT                   IPFCALCGSLLIVLIHIKTRAYAAPELMKKTSLTGV"
FT   gene            644249..645562
FT                   /locus_tag="lpg0611"
FT   CDS_pept        644249..645562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0611"
FT                   /product="metal ion transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26700"
FT                   /db_xref="GOA:Q5ZXX0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXX0"
FT                   /protein_id="AAU26700.1"
FT                   /translation="MYNILLIFIAFLLVLLNAFFVSAEFGMVKLRATRIQAIKENYGLR
FT                   GRILEQVHQNLDAYLSACQLGITLASLGLGWIGEPAFAELLGPLFVALGISSVHIVTIS
FT                   SFFIAFFLISFLHIVIGELMPKSIAIRQSELISIWTAVPLYWFYWIMYPAIWLLNTCSN
FT                   FFLKLSGMDIKNEYEGFYSSEELKLILSGQHLQSELKEDEREILEHTLDLAELNVTEVM
FT                   RPEDEMIIIDINEPFETIKDKILKYRYSRYPVYDSGTKEMIGVIHVKDLFADLLLQKNI
FT                   NTLKPYVRPVLKVSHKLPAMDLLRKFRAGMPHFALVYKHKSSLLGFVTLDNLLHILIGR
FT                   IKDEFHKTHEDWVKNSDGTITTKGDCSLYSLERALDCDITLSPDEEELNTLYGLIITRH
FT                   GKLPNEGEIIQFVEFDALIEKVQDSFITKIKVFPKIKN"
FT   gene            complement(645622..646668)
FT                   /locus_tag="lpg0612"
FT   CDS_pept        complement(645622..646668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0612"
FT                   /product="alcohol dehydrogenase (NADP-dependent,
FT                   zinc-type)"
FT                   /function="Carbohydrate Metabolism, Metabolism of Complex
FT                   Lipids, Biodegradation of Xenobiotics"
FT                   /EC_number="1.1.1.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0612"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26701"
FT                   /db_xref="GOA:Q5ZXW9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW9"
FT                   /protein_id="AAU26701.1"
FT                   /translation="MSETIGYAAHKAGAPLKPFTFERRPVGAHDVAIDILFCGICHSDL
FT                   HQVNNDWAGAFYPMVPGHEIIGRVKEVGHQVRRFKAGDLVGVGCMVDSCRQCTYCHQHE
FT                   EQYCKSGATFTYNSQDNHLGGVTYGGYSKHIVVTEDFVLKIDESLDPAAAAPLLCAGIT
FT                   TYSPLKRAKVGKMSKVGIVGLGGLGHMAVKLARAMGAYVTVFTTSINKIKAGKDLGAHD
FT                   VVLSTDNNVMQTLANQYDFILDTVSAKHDLGQYLNLLKVDGQLTQVGLPSDPLEVTMFP
FT                   VILKRLSINGSLIGGIKETQEVLDFCARHGITADIELIKMHEVNSAYERLLKGDVKYRF
FT                   VIDMSTLD"
FT   gene            complement(646869..647192)
FT                   /locus_tag="lpg0613"
FT   CDS_pept        complement(646869..647192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0613"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26702"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW8"
FT                   /protein_id="AAU26702.1"
FT                   /translation="MVRIFLLALGLFSSTTINAWYGSGITIGVARANVHYYGDDIRVYD
FT                   PWGYGYYDRNYYYNGVRNIIVPSVIVPNVVINVPVQRYYVPSCEEMEVCDPYGQCWLEQ
FT                   FCR"
FT   gene            647400..647804
FT                   /locus_tag="lpg0614"
FT   CDS_pept        647400..647804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0614"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0614"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26703"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW7"
FT                   /protein_id="AAU26703.1"
FT                   /translation="MHKLIELQGVGPKYAEMLKRVGIESQEDLLRVCSGRRGRFRVAEQ
FT                   TGISHKLILKWTNQADLARVNGINEEYAELLEQAGIDSIPELAHCNPEQLYSSLKEKNE
FT                   QCHLAQHVPGLSQVVTWVEQAKKLPRAVYH"
FT   gene            complement(647840..648553)
FT                   /locus_tag="lpg0615"
FT   CDS_pept        complement(647840..648553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0615"
FT                   /product="polypeptide deformylase"
FT                   /function="Translation"
FT                   /EC_number="3.5.1.88"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0615"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26704"
FT                   /db_xref="GOA:Q5ZXW6"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW6"
FT                   /protein_id="AAU26704.1"
FT                   /translation="MGKSIIVYLLLTTLTRIKKKSQQLLILIGFLLGMSPVMSLEIITI
FT                   EKIENHHMLKTRAENIQFPLSREDKDLIEAMKKKLYALGGVGLAAPQVNSAKQIIAVYI
FT                   PEEAQLLRDNAKIYPMHILINPNYEPLPQARIISDFEGCYSVSSKAGKVPRYDEIQLKY
FT                   YDEEGNVHQQIENGFYARVLQHEIDHLNGVLITDRLTPDCVQGTIEEMMTIRRAELPLE
FT                   KRKLFDQIMAKKLKK"
FT   gene            648782..650032
FT                   /locus_tag="lpg0616"
FT   CDS_pept        648782..650032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0616"
FT                   /product="GTP cyclohydrolase I PLUS perhaps regulatory
FT                   protein"
FT                   /note="conserved gene, may be fused protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0616"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26705"
FT                   /db_xref="GOA:Q5ZXW5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW5"
FT                   /protein_id="AAU26705.1"
FT                   /translation="MKFYKIKEISKLTSLSIRTLQYYDEINLLKPSKRSQSDYRLYSSD
FT                   DVLRLQQITTLRYLGCSLASIKEIIQHPDFNLKTSLAVQAKALEKKAEQIHEASSLLNY
FT                   IAMQIEAGQPINWYSTAQIITILEASIMNKELESTYQNITNQSELGQSSNYDDHYNPKR
FT                   LYPIPRAPKRQEINLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCII
FT                   ESKSLKLYFNSLNNTTFPDVETVVQTISKDLSHCIGSEVAVNVYPLSEIASQTIYAAFD
FT                   GICLDKLDIECSVYHVMPDFLSTSSELVEEALYSDLLKSNCLVTNQPDWGSVQIIYKGK
FT                   KINHEGLLKYLISFRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIR
FT                   STEPCVFDGQNIRLIRQ"
FT   gene            650436..651527
FT                   /locus_tag="lpg0617"
FT   CDS_pept        650436..651527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0617"
FT                   /product="major outer membrane protein"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26706"
FT                   /db_xref="InterPro:IPR007825"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW4"
FT                   /protein_id="AAU26706.1"
FT                   /translation="MKKYHQLLMGITLLLFGVCNYAGDTGPVENSDFFRVFIPNLKPGY
FT                   EFSATAFYLQPGANNLGWGVITTVLPIPSPNWQVVTFNPDYQVGFNLGGRYVFANSGSD
FT                   LQLNWSHLRTNDTDNVFVNPSSQWISPFSQTGTPPTPSGQITGVALLKLAHASLDFSYD
FT                   AVSLDVGKFINFGSKLQTRLFTGLSSAWIKEELISTFRGFSLPILSLNNTSTYKGVGPR
FT                   LGFNNSYNISHGFNLVGQLAGSVLYGRMQPAQYQFTGTSQQLIIAGIFVNREGLANPSV
FT                   NQLVPALDAKIGLSYLYSLKQNWDLNFEAGYMGALYFNPLSSYETNTNVIALDTGSLST
FT                   SSAKHTQSNFSVGGPYITVSLRT"
FT   gene            complement(651687..652259)
FT                   /gene="tag"
FT                   /locus_tag="lpg0618"
FT   CDS_pept        complement(651687..652259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="lpg0618"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="3.2.2.20"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0618"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26707"
FT                   /db_xref="GOA:Q5ZXW3"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW3"
FT                   /protein_id="AAU26707.1"
FT                   /translation="MSQNIILNRCEWVGQNKPHYELYHDTEWGIPVHDDEKHFEMLILE
FT                   GAQAGLNWETILKKRDGYRRAFKQFNPQAVAQMTDDELNALLTNPEIIRNRLKIFSTRK
FT                   NAKVFLSIQQEYGSFDSYVWQFVNGAPIINRPESIRAIPATSKESDALSKDLKKRGMSF
FT                   VGSTIIYAYMQAIGMVNDHIVTCFRAK"
FT   gene            652576..652956
FT                   /locus_tag="lpg0619"
FT   CDS_pept        652576..652956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0619"
FT                   /product="glyoxylase"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0619"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26708"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW2"
FT                   /protein_id="AAU26708.1"
FT                   /translation="MTQAAFGEFCWNELATSDVKKAKDFYGKVFGWQFREIESKEMTYT
FT                   LIQCNDKEMAGIWQIPKDQQSHIPPHWMAYIYVQDVSEALKKAKQHGAQEVKGITQAGE
FT                   MGRFAIIVDPTGAHVALWESFE"
FT   gene            complement(653057..654031)
FT                   /locus_tag="lpg0620"
FT   CDS_pept        complement(653057..654031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0620"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0620"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26709"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW1"
FT                   /protein_id="AAU26709.1"
FT                   /translation="MKSREKFMARNKRLDRFHNAQNSNTCGYDQAFSEIQDGRKRSHWI
FT                   WYIFPQLENLGKSPSAKLYGIKDFNEACDYLKDPVLFKRYFELIKLIEEKLKNIPLPHL
FT                   MGGFPDDRKFISSLTLFQATSNYLSSKDTDSQNKYHELYETCNRVFKQIAPQGYSPCQQ
FT                   TELLVKHQSNSPVKKTTEKSSQPPQVTIFSPKRSKPNTAHPILKDLAQYINKRGNEWSY
FT                   HYNFLGLVAFVYFIQDLILGTDHFNHKAREVKLTAASKLQKILDPQCHERCNLNPSERK
FT                   ALSDGRLGEIINKHGGLNKILTEAPDKPPKNDRAQEINSNPFL"
FT   gene            complement(654121..655545)
FT                   /gene="sidA"
FT                   /locus_tag="lpg0621"
FT   CDS_pept        complement(654121..655545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidA"
FT                   /locus_tag="lpg0621"
FT                   /product="SidA"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0621"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26710"
FT                   /db_xref="GOA:Q5ZXW0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXW0"
FT                   /protein_id="AAU26710.1"
FT                   /translation="MSKKYRTPIRLSDKMKTLKKNLQEQLTQSKSLGEQIHAGTTTAST
FT                   ITTGINHLFNVIASFLSSYRQIPLVGGVLQLVAILAKSISIVSDPEKSIAEKIISSILI
FT                   AAIIALSIAAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFID
FT                   LVAKRIEPNNDKYNDLFEIRAIELQHELEKSYPNQIEQQQLKEELNFINAVLRKKNITP
FT                   GNNKENDAYKLNQLYAKRAEQLKTLVDKIALINPTGKRAEQNKLLSEIKALQKEITKTD
FT                   DSIEEIIAPLAKIERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMV
FT                   PIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAEKTAKHEDAVLDEALNVYEQQLNLEL
FT                   VSPSNPARQVKNILIVHDKVPALSPTESTVSSLDSRFTLFGSSSREHTKIAEQKTTDTT
FT                   NEQVPTTFDSISKPTR"
FT   gene            complement(655706..657649)
FT                   /locus_tag="lpg0622"
FT   CDS_pept        complement(655706..657649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0622"
FT                   /product="transmembrane protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0622"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26711"
FT                   /db_xref="GOA:Q5ZXV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV9"
FT                   /protein_id="AAU26711.1"
FT                   /translation="MPTKKMTRAQTCPHQTTVISNLKIIPLTLGWLLKSALLIIIIAVF
FT                   IPLSPKMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATDFMMVG
FT                   GSLYLALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEIS
FT                   GKETSFKSNFCTLFALLFTPFGLFPLIKGSLLILSIITVLLCSLFLILYKQRNLAVLCL
FT                   ASPVVSILFFWIASGQSIFNLPAYVSNTILLASGFTEAMAIEGDNKELIFFGVTSSCIL
FT                   LSILLQKQLSPLSKAFLFCIYLVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNS
FT                   NNKVIVPLLALSLYTASYINGHYTKISVRDNFISTYTAAYYGLKNRIQNKNWLKENFSL
FT                   TMNYLKARDDFPRLPGTTDIYSYNQTSLIASGMTWSPRPIFQSYSVFTAKMAEINTNYL
FT                   LSENKPDNILFKVEPIDNRIPSMEDGMSWPILINHYQPVRLENDFLFLRKKLVNKPVTS
FT                   LVPLKTEIHTFGEQVKIPDTDKSLFVEIDIQPTLWGMLATTFFKPHQLEANLELKNGTQ
FT                   RQYRLISNMAKSGFLLSPFIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTK
FT                   YTIHYKTFASNN"
FT   gene            complement(657760..658152)
FT                   /locus_tag="lpg0623"
FT   CDS_pept        complement(657760..658152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0623"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26712"
FT                   /db_xref="GOA:Q5ZXV8"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV8"
FT                   /protein_id="AAU26712.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWVMGWPVVITLFAWLVLLGGLIRFLCPDTAVRIGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
FT   gene            658289..658666
FT                   /locus_tag="lpg0624"
FT   CDS_pept        658289..658666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0624"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26713"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV7"
FT                   /protein_id="AAU26713.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDAPNELH
FT                   NDENVTNHPIQVMVIQLNDKA"
FT   gene            658819..660174
FT                   /locus_tag="lpg0625"
FT   CDS_pept        658819..660174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0625"
FT                   /product="expressed protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26714"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033891"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV6"
FT                   /protein_id="AAU26714.1"
FT                   /translation="MCYHLIIDSFIDRISRMHTQRGLEVTTGSIEAVDSINYFHEQVLS
FT                   SGQNAIQILDSAKKHTDNLLIQTYAAAFYLYAQEDVANEQASDYLQSAFRLLTSANERE
FT                   KLIFEAVTNWSKRDYANAISLLVTLLERYPRDTLALKFMEWLFYCTGQAFNAEYFLKVC
FT                   DKCAPENQDESHFLAIHSFALELCGQYSKAKEMAEEAITMNLLTPWAHHTLAHVHLLTS
FT                   DITGGINRLRDLQKTWEDILPLLKGHNTWHLALFYLANRNEEEVKKLYPHISGALPDTV
FT                   LEQLDTISLLWRMDMAGLPQDRLLNQVVDHLSTHPLEYYTGFTNAHFIYCLVKSGYKNE
FT                   ADESLKRMKFYACSPSSDALWGDVVLPLCQGIYAFADADYKTALMLMEPVIGECAQLGG
FT                   SDAQIELFFQTYLLVLIHNKQKDKALQFFTEHLKYYNNTPLSDWWFQSANKA"
FT   gene            complement(660200..662407)
FT                   /locus_tag="lpg0626"
FT   CDS_pept        complement(660200..662407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0626"
FT                   /product="DNA uptake/competence protein ComA"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0626"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26715"
FT                   /db_xref="GOA:Q5ZXV5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV5"
FT                   /protein_id="AAU26715.1"
FT                   /translation="MEIFCFLIGVLYAYTYNIYLTIAIPLLFYITPRYPIVLFFIAGCG
FT                   FALIHQWIVSPKGMPDTQVITQAQLEGTIASIPMQHPNKTQFHFAIEKINNNPAQGLIQ
FT                   LNWYNKPPVLRAGQRWQLSVKLKKPRNFHNPGGFNYVRYLAARHIHWTGYIRYRNNKLI
FT                   SNQPPSFSWLALREKIGDALTKLAPDTETAGIIEALTLNVTHHISSDHWNLFRRTGTIH
FT                   LFGISGEHIALVSGIFFIVMRWIWSINYRCCLFLPANTIASIGGLLAALPYAFLAGFEP
FT                   PVQRALIGCVLYTIYAIGKQRFTPWQIWRYALFLVLCIEPHAVFLQGFYFSFLAVACLL
FT                   LTHQRWPLKNYKKTLALQLSCLIGLMPLTLHWYSYGSINGFLANLFAIPLVSFLIVPLA
FT                   LMTMITSPFHWSWILMKPLAWLVALLLQGLTYVEQIAGINITWSITSVTMMLAMTAGLF
FT                   LRVLLPVKPFKHLAILWIILPLFPPRTAIYPGEALINILDVGQGLAVAIQTQHHVLLYD
FT                   TGDSYFQGSDLGQMAIIPFFRSIGIKTIDKIVISHPDKDHKGGLNSLEKEMKVNQLIVN
FT                   DPYFYKRGSNCHSYPQWQWDGVSFRFLPIRESFNKKNNNSCILQVSNSAGRVLLTGDIE
FT                   KAAEEYLVRNYGSQLASEILVVPHHGSKTSSSYRFLLEVNPLYAIASLGFDNRFKFPHS
FT                   KTLQSMKTLGITFFRTDECGMAAIKLPASGKINKPTCMQAV"
FT   gene            complement(662485..662934)
FT                   /gene="pilE3"
FT                   /locus_tag="lpg0627"
FT   CDS_pept        complement(662485..662934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilE3"
FT                   /locus_tag="lpg0627"
FT                   /product="type IV pilin"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0627"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26716"
FT                   /db_xref="GOA:Q5ZXV4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV4"
FT                   /protein_id="AAU26716.1"
FT                   /translation="MLSHVHFMKNSRMKQSAFTLVEVLISMVIMGILVSIAYPSYLQYI
FT                   QKSRRADAHATLTQDQIILERCYSQNFSYAAACGALPAFPQTTPNGYYTINISNLTATT
FT                   YTLTATPVGTQAKDTECASMSINQANVKTAVDSSANAQPECWNPG"
FT   gene            complement(662946..666464)
FT                   /locus_tag="lpg0628"
FT   CDS_pept        complement(662946..666464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0628"
FT                   /product="type IV fimbrial biogenesis PilY1-related
FT                   protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0628"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26717"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV3"
FT                   /protein_id="AAU26717.1"
FT                   /translation="MIIMDALKLCILIREGAQKAIRVLPRIFLAISLSASVSLYAVPLT
FT                   IPQIPLIIASPIHPQVLILIGNSQSMDGNLSGAIMTGSGSLSSGLSSLYNSSSPVNYTV
FT                   PAGFTPPVQGPDANGLAPYTVIQGGNKVDNSSSRLNVAKAGVKAIIENYMPTTDFALGT
FT                   YSTSNISTYNTWVYYMSPPGSNFVFTNTPVAGNRYVINPCYNYGSASSTVSSNCASIGS
FT                   LYGTSLVSSSQYLQIGGASDDPTINDVLYAGSGFPGVFVSFNGPSPATPYPPNFSLSNY
FT                   NNGNVLLSYSSTRPSIGSFATGPTNAGFVPFSQQVMYVQRGFGYYSNQSFNTGNMRVNM
FT                   TTAGTNPTTTSVTNAINAFLPHLRPETNSTSTTEIKAAAVQSPLAGLLTRSRSFMKTVG
FT                   TTSGNCPQKQYIILISDGLPTQDLQARYWPPLGSAAATGYGVTATFNADGSLNSTNSQA
FT                   LSDAINEINALKNDGVLTFVIGMGAGVDPAVNPEAAATLRAMAVAGGTENYYPATSPQA
FT                   LVNSLNSILSNIQNGSFSTSAAAISSTRIDSSTVEYQANFITRDTPYQDWTGNLTAIEL
FT                   DENTGQPTNIIQWSAQSTLDSLVSGTGWSTNRKIATWDPIAADGVPFRWANINATQQAQ
FT                   LQPSDLLGENRLEYLRGNATLEKRNGGTFRDRSHVLGDIIDSQVIYVGPPSGPYLTASY
FT                   ISFAKANANRQPMLYVGANDGMLHAFNATTGEEFFAFIPNAVFNNLHQLTSPLYNQNHL
FT                   FFVNGSPESADVQFSDGSWHTILVGGENAGGKSIFALDITNPTNLSSEPGVANAVLWEF
FT                   ADTDLGFTYSKPQIGQIRSGSPSSLNFAVFFGNGYNNTNNKSVFYAVDPQTGTLLRKID
FT                   LCAAVPSACNVNLPQGLSTVALGQKDGLQADPVTVVYAGDLQGNLWAIDVSSADPASWS
FT                   ARVLFQARDSAGTPQPITTPPLVTLNPNYPRNPGLFVVFGTGQLLTTSDLVTTQRQTIY
FT                   GVWDKPLSSVPYVRANLQQQTLTLVNSATSGLSTNIITATATTINWSNKVGWFADLPIA
FT                   GQRLITTPELINGAFIATLNTPPLNSCGFGFTSMLLELNFLNGGAFQYARFDISGDGGF
FT                   DIADQYNGAYPVGIGLSNSYANSPTVLGPNKDNNLVILITQSDGTQTTVIAPNITPRKI
FT                   GWWQIQ"
FT   gene            complement(666468..666980)
FT                   /locus_tag="lpg0629"
FT   CDS_pept        complement(666468..666980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0629"
FT                   /product="Tfp pilus assembly protein PilX"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0629"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26718"
FT                   /db_xref="GOA:Q5ZXV2"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV2"
FT                   /protein_id="AAU26718.1"
FT                   /translation="MNVSFTAQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQAGYFLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
FT   gene            complement(666977..668044)
FT                   /locus_tag="lpg0630"
FT   CDS_pept        complement(666977..668044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0630"
FT                   /product="type IV fimbrial biogenesis PilW related protein,
FT                   transmembrane)"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0630"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26719"
FT                   /db_xref="GOA:Q5ZXV1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV1"
FT                   /protein_id="AAU26719.1"
FT                   /translation="MNIKYRLQQGFSLVELMIATLVGLILTYSILQIYLAQTQLYKASN
FT                   SQDLIQSTENAISNLLIPMIRSAGFAGCGSIITAVSSLNAGGPRPLGILNTTPTILMGY
FT                   NGSGASFTITQSNPANSTNASHWSPALDSTLVGNAQQGSDVLVVLGSTSDSYPTGITAI
FT                   DPGSNTFVVQGTSGMSLTSGMFGAVSDCGKTVIFQITGVAGTTITHDAGAGVLQNASSA
FT                   FPVNFQTGSQFIPIQQTAFFVGQGQGGQSALMRASLVGNNWTIQPLVPGVEIMKVQYGI
FT                   GNNGVITRYVSANAVTDWAQVYAIRLGFLIAGQLGSGSLTTRQYNVLDTQVTVPADNRL
FT                   RHVFELTINLRNSIS"
FT   gene            complement(668041..668580)
FT                   /locus_tag="lpg0631"
FT   CDS_pept        complement(668041..668580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0631"
FT                   /product="type IV fimbrial biogenesis protein PilV"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0631"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26720"
FT                   /db_xref="GOA:Q5ZXV0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXV0"
FT                   /protein_id="AAU26720.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLARYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
FT   gene            complement(668593..669300)
FT                   /locus_tag="lpg0632"
FT   CDS_pept        complement(668593..669300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0632"
FT                   /product="type IV pre-pilin"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0632"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26721"
FT                   /db_xref="GOA:Q5ZXU9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU9"
FT                   /protein_id="AAU26721.1"
FT                   /translation="MNKVITESQKFTLRNIANMLFCVESSVLPAQSNIAQKIQTQGIMY
FT                   NDLCKDSFDTEAPLNSNPLSIAGFTLVELLVTLSVFAIILTLIVPSLRTMILNSRLTSN
FT                   IDSLVSSLNYARGVALDRAVNVAVCPLGSPGSTACGANWSSGWIVVTQPVAGAPTLLKS
FT                   HQTSVNDPVITSNVSSVVFDPHGLSTTQSNFTMCDNRGNAFARSAMVLATGFVQSGTTP
FT                   GQAVWNNGALNCP"
FT   gene            complement(669522..670427)
FT                   /locus_tag="lpg0633"
FT   CDS_pept        complement(669522..670427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0633"
FT                   /product="polysaccharide deacetylase"
FT                   /function="Metabolism of Complex Carbohydrates"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0633"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26722"
FT                   /db_xref="GOA:Q5ZXU8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU8"
FT                   /protein_id="AAU26722.1"
FT                   /translation="MTIFFSIDLTHIKFRMKIKTVTRYLLLFSIFFLIGFNNVFAQKKA
FT                   IAITIDDLPFVGEYRNFHLNMMMNTMKDEKIPATGFIIAKEVRPDNWEILHKFREAGFG
FT                   LGNHTFSHANLNKLKAKEYIQEIKEADSLLMPVLTEPKYFRYPYLAMSSGSKKNKILCY
FT                   LEKHHYQVAPITIDSKDFVFNQRLLSVPELGRRAYLDELKPFYLDFIWQQTLKAEEHTQ
FT                   YHHNPDQAQILLIHANLLNAYVLPDIINLYKQNGYTFVSLEDALKTFKENYHCHKTRIL
FT                   TKKPAGEETDLNIESFMDWD"
FT   gene            complement(670559..671908)
FT                   /locus_tag="lpg0634"
FT   CDS_pept        complement(670559..671908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0634"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26723"
FT                   /db_xref="InterPro:IPR031758"
FT                   /db_xref="PDB:5ES2"
FT                   /db_xref="PDB:5FIA"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU7"
FT                   /protein_id="AAU26723.1"
FT                   /translation="METNMTFVLKEFDALKSHFNDTVKIILQREKKDKIEDLPNPRKEE
FT                   LQFLTAVLNQLEAKIDELKPRSLASYVHVFYGAMLLVCKDVENNLRVMEKKENSLLFTR
FT                   LMDGMGISDENIPTSEQNIMFYRGLNKFLNFIYESNDSRKGLKKEHFLQVLSLKKIYSL
FT                   AKLSYEQEEAAENNALAKLTADGKTKANANSFHVEKPIDSSIVEQFKSWDEMKGALHQL
FT                   ILDELSDKNVAKISALSQARSAQLKFLQTMAEQLDKIPNQSLEPSEKMAILAGAMYIVR
FT                   GQIAQEYGKDPLSNDKISATVIHTGLSTILHANADCCEDKEVLIAAANKFIRHMVIERP
FT                   EQSNKKITKESVRENNMFSDIAGFQLISVLTLIQNMIKTCRTDAIEACVTKRKEELEAL
FT                   KPKKEGYSIASSVTGYVGSWFKKAPSMSEEDEEDDLKDQNTAEETSKPTV"
FT   gene            672196..673677
FT                   /locus_tag="lpg0635"
FT   CDS_pept        672196..673677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0635"
FT                   /product="melitin resistance protein"
FT                   /function="Detoxification / adaptation, Metabolism of
FT                   Complex Carbohydrates"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0635"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26724"
FT                   /db_xref="GOA:Q5ZXU6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU6"
FT                   /protein_id="AAU26724.1"
FT                   /translation="MSFQTDKEIQQKFFNYTLFVLVVLLICRLIANYFFPLFDTTESRY
FT                   AEIARKMLETGNWVTLQQDYGVPFWAKPPLSIWLSAFFMQLLGVNEFAVRLPGLLLSIG
FT                   VLWLVWGVAKKQSGSMAALFSLLTLAGSLYFFLDAGTVMTDPALLFCITLASVSFWHAM
FT                   VYENKIWSYAFFAGLGLGLLAKGPIAVVLVGMAVFFWVLLRNEWLNLWKRLPWVKGTLL
FT                   LLLIAVPWYVLAELRTPGFLNYFILGEHFHRFLTPGWSGDKYGIVHHVPKGTIWLYATA
FT                   GVFPWNIIAGGWLVKHGKMLPSLCQSGDGWLSYLTLWMITTLLFFTFASNIIYPYVFPS
FT                   LPAFALFFAEILNRLNLELKHLKWIFISSLLCGVLFLAVAFVFSVKPNVVPNTHKPIIT
FT                   AWLNQNPTAGSYLVYWGYKTDFSAEFYSEGQVKAVKNSNDLCKLISNRLENYLVINSKE
FT                   TQQIREGLLARFTLIDTFRVHRDTLILFYAPVLTC"
FT   gene            673832..674497
FT                   /gene="tdk"
FT                   /locus_tag="lpg0636"
FT   CDS_pept        673832..674497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="lpg0636"
FT                   /product="thymidine kinase"
FT                   /function="Nucleotide Metabolism"
FT                   /EC_number="2.7.1.21"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0636"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26725"
FT                   /db_xref="GOA:Q5ZXU5"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXU5"
FT                   /protein_id="AAU26725.1"
FT                   /translation="MSNTNEDGNNQSMAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQT
FT                   LLFTPAIDTRFQYGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQF
FT                   LTREQVYQLTEITDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRK
FT                   AIMNMRIDENGQAVVEGEQVLIGGNESYVATCRLHYKRGEAEVTFPRNKLFNKDTNAF"
FT   gene            674545..675816
FT                   /locus_tag="lpg0637"
FT   CDS_pept        674545..675816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0637"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0637"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26726"
FT                   /db_xref="GOA:Q5ZXU4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU4"
FT                   /protein_id="AAU26726.1"
FT                   /translation="MVSHSVAVESRTFVPRGDFMAWVVCLSAGLFFLYEFFQLNIFDVI
FT                   NQSLREDFHIDATQLSWMSSTYLWADILFLLPAGLILDRFSTRKVILTAMFVCVVGTIG
FT                   FAVTESFFLASFFHFLSGIGNAFCFLSCVVLVSHWFPPRRQALVIGSLVTMAFIGGMMA
FT                   HTPFAYLNDLFGWRRALLIDGVVGAFLILWIYMIVQDRPEESPSHKLTNEGQILSSFMK
FT                   ALSNKQNWLAGLYTSLLNLPIMVLCALWGASYLQVAHHLPDIAASNVVSLIFMGSVVGC
FT                   PLVGWLSDTQGRRKPLMIFGAIATLITTIPLFINVVLTQTSLSILFFALGLFTSTQVIS
FT                   YPLVAESNQPENTGAATGIASVIIMGGGGVAQVLFGWLMTHHAGTNVTAYTVSDFQFAM
FT                   WMFPVAAIAGLVAVLMTRETYCKR"
FT   gene            675829..677112
FT                   /locus_tag="lpg0638"
FT   CDS_pept        675829..677112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0638"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0638"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26727"
FT                   /db_xref="GOA:Q5ZXU3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXU3"
FT                   /protein_id="AAU26727.1"
FT                   /translation="MQVVDEFKAFDVKASLMPWLVCFAATMFFFYEFIQGNMFASIAAN
FT                   IMQDFQIQADKMAYLSSIYYLANVIFLFIAGMVLDRFSIKNTILIAMFLCVISTFILSY
FT                   SDSFYVALFCRFVTGIGSAFCFLGPVRLASHWFPPQRMALVTGAIVTVAMTGGMLAQYP
FT                   LTKLVLYVGWRQAVQDVGILGLAMLVLMFFWIKERPQVAIKKEGKPINVLVAARKAYLN
FT                   AQNLRAALYTSLMNMAIAVFGAMMGTLYLEQRLGISPDQAAMINGMLFFGAIIGSPLMG
FT                   WISDKVGLRVLPMKGGVLASLLILLGVLYLPVSVTMMAVLFFLLGLFTSAQVISYALVA
FT                   ESSPPMMTATAVSVVSILTQGGYLIYQNLFSALLTNYGDVRLINGVPVYLLEAYQHAAI
FT                   ILPIGLLIALLLLFGLKETRCQQVEHTV"
FT   gene            677109..678332
FT                   /gene="deoB"
FT                   /locus_tag="lpg0639"
FT   CDS_pept        677109..678332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="lpg0639"
FT                   /product="phosphopentomutase"
FT                   /function="Carbohydrate Metabolism, Nucleotide Metabolism"
FT                   /EC_number="5.4.2.7"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0639"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26728"
FT                   /db_xref="GOA:Q5ZXU2"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXU2"
FT                   /protein_id="AAU26728.1"
FT                   /translation="MTGRVCVLVMDSFGIGASLDAARYGDAGANTLVHIYEACKRGECD
FT                   IEGVRKGPLMLPNLAGKGLYHAAMASSGLSFIDLATLAIPSGYYGYAVEQSLGKDTPSG
FT                   HWEMAGVPVTFEWGYFPDKPYCFPEELISEFIKQCNLPGVLGEKHASGTIIIDELGEKH
FT                   IRTGKPIVYTSADSVFQIAAHEEAFGLQRLYDICKIARNLVDKYQIGRVIARPFTGKPG
FT                   SFKRTGNRKDYATPPPEKTLLDFLKEDGREVIAIGKIADIYAHQGVTQEIKADGNMALF
FT                   DATLSAMKTAPQGSLVFTNFVDFDSSYGHRRDIAGYAHALEQFDARLPELDALLQPDDM
FT                   VFIAADHGCDPTFPGSDHTREHIPVLVFGPQVNSKFIGRRDCFADIGQSIAEHLQLSSP
FT                   LAHGVSFL"
FT   gene            678519..679067
FT                   /gene="hslV"
FT                   /locus_tag="lpg0640"
FT   CDS_pept        678519..679067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="lpg0640"
FT                   /product="heat shock protein, HslVU, proteasome-related
FT                   peptidase subunit"
FT                   /function="Detoxification / adaptation, Protein fate /
FT                   hydrolases / secretion"
FT                   /EC_number="3.4.25.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0640"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26729"
FT                   /db_xref="GOA:Q5ZXU1"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXU1"
FT                   /protein_id="AAU26729.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
FT   gene            679051..680394
FT                   /gene="hslU"
FT                   /locus_tag="lpg0641"
FT   CDS_pept        679051..680394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="lpg0641"
FT                   /product="ATP dependent Hsl protease, ATP binding subunit"
FT                   /function="Detoxification / adaptation, Protein fate /
FT                   hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0641"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26730"
FT                   /db_xref="GOA:Q5ZXU0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXU0"
FT                   /protein_id="AAU26730.1"
FT                   /translation="MMKANNMVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKI
FT                   KDPVLRNEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDS
FT                   IIRDLTDMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFR
FT                   KQLREGELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVA
FT                   KAMKILREEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGV
FT                   QRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALS
FT                   VEDFVRILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRL
FT                   YTVMERLLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
FT   gene            680594..682168
FT                   /locus_tag="lpg0642"
FT   CDS_pept        680594..682168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0642"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26731"
FT                   /db_xref="InterPro:IPR041234"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT9"
FT                   /protein_id="AAU26731.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNTDFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYTLPELQADYWGTEAPVFSAENKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALYDQGADFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGAISNEEVLNIYHQVYKKHLKIISYSLDPD
FT                   ANEIKVFSHAGIGLNHIRGLARKFKVPYSEESAVDLAKTIDAINKKFAEKASSGEIHTL
FT                   YTHDMMYRGYAGEHLNSTDEVVAATVWGREYGDLIRTSKKFKITFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQYLNPDKKIQGSREKDRPDKPNDYVVKIH
FT                   HTKPSFFKTSNPKITFPDSYKRIWDSADGDSNITKIKALLKDYTKEDSILGSFWGLIFT
FT                   LHWGRHHVKSVHQIAQTKYTSVEAILSDLKALKPREGGSLDKRIKFIELQIIAQRCDSP
FT                   EPQFNLK"
FT   gene            complement(682215..683453)
FT                   /locus_tag="lpg0643"
FT   CDS_pept        complement(682215..683453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0643"
FT                   /product="ribonuclease BN"
FT                   /function="DNA/RNA degradation / restriction, Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0643"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26732"
FT                   /db_xref="GOA:Q5ZXT8"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXT8"
FT                   /protein_id="AAU26732.1"
FT                   /translation="MNWKDKVKTTFYSCDRFVRFVIQHFIQDDCTYIASALAFTSLLAV
FT                   VPLMSVGLAIFSSFPVFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFTSQVSKLSIWGI
FT                   VFLIFTALLVMFTIERAMNKIWRVSSSRHGVSAFLLYWAIISLAPVLLGLSLAASSYLF
FT                   SMPILADHRAPYTILHYSPFFLSLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAK
FT                   HAFAYYLIRYNTYALLYGAFATVPIFFIWVYWVWIITLLGAEISYAFSVHHQRRGGKSL
FT                   DGFSHALLWLHQLWLAQQHGKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADG
FT                   HYMLSRDLSHVTLYDLTQLLPYRLPTHLELQYSKASLAEQWRAAFKRHNEELKKSLDIN
FT                   LEELFKKTGTVIK"
FT   gene            683868..688331
FT                   /locus_tag="lpg0644"
FT   CDS_pept        683868..688331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0644"
FT                   /product="hypothetical protein"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0644"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26733"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT7"
FT                   /protein_id="AAU26733.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNVQGQASLVKSGARLEEGDVLTLLS
FT                   GEAYIQFIHGFPEALALEKPVKLDGVSPTLQYGAEDLKEQMVQEAIAKGIDPSVILDVL
FT                   GSAAAGAVAVGSGGDAFIIDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGAI
FT                   AESELTTEPEFTPQIPQFTTNQAVLTVFEDALPSGIPDSAGQARTASSSLSTLLTSSPD
FT                   VAASFAFNTNLSVLPTLKSGGIDLDYNLSPDKRTLTASIPGGGDVMQFELTADGRLTQT
FT                   LMDSIDHPTTDSDDGEWMRLDLSPLIYVTFTRTSDGTVLESRTLPANAVVAGIQDDVPI
FT                   ARAQLTNNEILLDETVGVKVGDADAANDDFNPTITTDPFNNTYGIPIGLVQNANLLDNG
FT                   TSEMGGDYKNATMTHLLKITDAVSGLQTTDGTSINLFLESNGDITGRAGDIGEPAVFAI
FT                   RMNPNTGSITVAQYGSIKQFDTNSHDEAVDLTGRISAVVTAKDSDGDVSNVEIPIGQLI
FT                   IFADDGPSVTMAVSDNNAITLNTQDADTIGAASDSDSASFAAAFAVTPNYGADGAGTTV
FT                   TTYALSVSAQGVDSGLDNNGNNIYLYNIAGSVVGSTSATQAGITTGNTIFSLDVNSSSG
FT                   VVTLTQHQEVDHGLPGASSNYAAQEAILNTGLVFLNATAVTTDGDGDTATASASLDLGG
FT                   NVKFDDDGPSVTMAVSDNNAITLNTQDADTIGAASDSDSASFAAAFAVTPNYGADGAGT
FT                   TVTTYALSVSAQGVDSGLDNNGNNIYLYNIAGSVVGSTSATQAGITTGNTIFSLDVNSS
FT                   SGVVTLTQHQEVDHGLPGASSNYAAQEAILNTGLVFLNATAVTTDGDGDTATASASLDL
FT                   GGNVKFDDDGPSVTMAVSDNNAITLNTQDADTIGAASDSDSASFAAAFAVTPNYGADGA
FT                   GTTVTTYALSVSAQGVDSGLDNNGNNIYLYNIAGSVVGSTSATQAGITTGNTIFSLDVN
FT                   SSSGVVTLTQHQEVDHGLPGASSNYAAQEAILNTGLVFLNATAVTTDGDGDTATASASL
FT                   DLGGNVKFDDDGPSVTMAVSDNNAITLNTQDAETIGVLSDTDSASFAAAFAVTPNYGAD
FT                   GAGTTVTTYALSVSAQGVDSGLDNNGNNIYLYNIAGSVVGSTSATQAGITTGNTIFSLD
FT                   VNSSSGVVTLTQHQEVDHGLPGASSNYAAQEAILNTGLVFLNATAVTTDGDGDTATASA
FT                   SLDLGGNVKFDDDGPSVTMAVSDNNAITLNTQDADTIGAASDSDSASFAAAFAVTPNYG
FT                   ADGAGTTVTTYALSVSAQGVDSGLDNNGNNIYLYNIAGSVVGSTSATQAGITTGNTIFS
FT                   LDVNSSSGVVTLTQHQEVDHGLPGASSNYAAQEAILNTGLVFLNATAVTTDGDGDTATA
FT                   SASLDLGGNVKFDDDGPSVTMAVSDNNAITLNTQDADTIGAASDSDSASFAAAFAVTPN
FT                   YGADGAGTTVTTYALSVSAPRGGFRP"
FT   gene            690883..692928
FT                   /locus_tag="lpg0645"
FT   CDS_pept        690883..692928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0645"
FT                   /product="hypothetical protein"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene, may be truncated RtxA"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26734"
FT                   /db_xref="GOA:Q5ZXT6"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT6"
FT                   /protein_id="AAU26734.1"
FT                   /translation="MSGLGGNDTLDGGSGDDVIIGGLGDDILTGGSGADQFVLVKGQGG
FT                   ASAGAAPIDTITDFEVNIDKIVINGNNITGVSVSTPVSNTYTITVNYSDAATEHFKMTL
FT                   SNGALLNDSGKTHLNGVVISGGTATIDGTIVGAVLYLDLNANNQEDEGERLGITDQYGH
FT                   VEWVVDLSKFDVNGDGQYVIGEARAVQTGGFDIDTGLSYEINLYGPVGSAVISPLTSLL
FT                   QAQLEAGMDYETANAALVARLGLPEGTQIISFNPITGSGEVLAQNAGVMTAAIQFAEIA
FT                   AIHYSTDEGHVSFVVFEAISKALLELPEGVVADFGDEGFLQSISNYLGLDALVTSDMID
FT                   YMATSQKALEASILTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLDALKNMSA
FT                   VLKAYADGDITDEQLNSFEDKLSAVIVNWEDNNVTDTSHQATLQTERIVDDSSVKSEAN
FT                   HEMAQEVNAVINDFMDEHNISLYYYDQQAQMPQEVQEQQPTEDQAEETVMHDDVVQDLL
FT                   LDDHSLTMLANNPQLNGGNGNDVLHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSGDDD
FT                   GGVDTITDFKANPVDQSSDASVLNLSDLLSDADLETNSLDNYLNVSTTEEGDTAIKVDP
FT                   NGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMIANGNLIVEQ"
FT   gene            693107..693706
FT                   /gene="wrbA"
FT                   /locus_tag="lpg0646"
FT   CDS_pept        693107..693706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="lpg0646"
FT                   /product="trp repressor binding protein"
FT                   /function="Transcription factors / DNA binding proteins"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0646"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26735"
FT                   /db_xref="GOA:Q5ZXT5"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT5"
FT                   /protein_id="AAU26735.1"
FT                   /translation="MSNPYILVLYYSRTGSTAQLAQYIARGVESVSGLEARLRTVPPVS
FT                   TTCEAVDKPVPDAGAIYVSLDDLRHCHGLALGSPTRFGNMAAPMKYFWDGTTSLWLGGD
FT                   LVNKPACVFSSSASMHGGQETTLISMMIPLLHHGMILLGVPYTEPALTSTQSGGTPYGV
FT                   THVAGGDNENPLSQDEITLAKALGERLGRVAMGLKV"
FT   gene            693821..695227
FT                   /locus_tag="lpg0647"
FT   CDS_pept        693821..695227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0647"
FT                   /product="hypothetical protein"
FT                   /function="Viral functions / Phage / Transposases"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0647"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26736"
FT                   /db_xref="GOA:Q5ZXT4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT4"
FT                   /protein_id="AAU26736.1"
FT                   /translation="MASCEWIINESKEANFGDKRLDKRYGDILSGLLSSPNASIPTTFQ
FT                   SWNETLAAYRFFNHVNVNPESILLPHSEATLERIKAEKIVLIPQDTTEVDFTGRKSLSG
FT                   MGYLSNERSRGLYLHPSIAFTPERVCLGVVEMQHWIRKEIGTRNSRKGKSIEEKETYCW
FT                   LKGYNAANKIALAVPDTMVVSISDREGDIYEVLEKLPSEENKAYWLIRCQHDRAVLNEE
FT                   TNQFELLLKKEVSKACVLGTIEFEIPAGTSYRNCKKRHTRKARSVRQEIRICSVSLRPP
FT                   RRKSKKLNVIEIQVVHCKEINTPEGEQPVEWFLITSVPIKTLDRAVEIVNWYLCRWLIE
FT                   MYIKILKSGCKIEELRFETYEATLNCIAFYMIVAWRVFYLTMLGRTCPDIDCTTVFEDN
FT                   EWQATYAMATKKKPPKKPPKLYEIILMIAKFGGHLGRGSDGLPGTKVMWIGLQRMKDFT
FT                   LAWETFHTLS"
FT   gene            696023..696805
FT                   /gene="xth"
FT                   /locus_tag="lpg0648"
FT   CDS_pept        696023..696805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="lpg0648"
FT                   /product="exodeoxyribonuclease III"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="3.1.11.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0648"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26737"
FT                   /db_xref="GOA:Q5ZXT3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT3"
FT                   /protein_id="AAU26737.1"
FT                   /translation="MKVISFNANGIRSSARNGFYDWLVGQDVDFVCIQETKSQVEQLIP
FT                   EELYFPRDYFCDYFDAEKKGYSGVAIYSKYKPMRIVKGLGFDYCDKEGRYIQFDYPKLS
FT                   VVSLYLPSGTSGDDRQEVKYAFLEQFARHLMNLKNEGRELIICGDYNIAHKKIDLKNWR
FT                   GNQKNSGFLPEERAWMDELFGSMGFVDAFRVHNQEEEQYTWWSYRARAWEKNVGWRIDY
FT                   QVITPGLTEYVADSRIFREARFSDHAPLMIEYKGDWCV"
FT   gene            696777..697568
FT                   /gene="xthA1"
FT                   /locus_tag="lpg0649"
FT   CDS_pept        696777..697568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xthA1"
FT                   /locus_tag="lpg0649"
FT                   /product="exodeoxyribonuclease III"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="3.1.11.2"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26738"
FT                   /db_xref="GOA:Q5ZXT2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT2"
FT                   /protein_id="AAU26738.1"
FT                   /translation="MNTRETGVFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKL
FT                   TDDNFPVASFIDKGYHVIFSGQKTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVK
FT                   GIRLINLYVPNGGELTSDKYQYKLDWLNKVTRFIQHEISIYSKVAVVGDFNIAPEDRDV
FT                   YDPVEWEGCVLVSPPERQAFMKILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLR
FT                   IDHVLLSHELNALCRQSKIDKEPRKAERPSDHAPVWVELEL"
FT   gene            697705..697932
FT                   /gene="rpmE"
FT                   /locus_tag="lpg0650"
FT   CDS_pept        697705..697932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="lpg0650"
FT                   /product="50S ribosomal protein L31"
FT                   /function="Translation"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0650"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26739"
FT                   /db_xref="GOA:Q5ZXT1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ZXT1"
FT                   /protein_id="AAU26739.1"
FT                   /translation="MKASVHPDYQTVKVTCSCGEVFETRSTLCKDLNIEVCSMCHPFYT
FT                   GKQKLVDTGGRVQKFRDRYNMRTGQAKSKE"
FT   gene            698059..699294
FT                   /locus_tag="lpg0651"
FT   CDS_pept        698059..699294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0651"
FT                   /product="malate oxidoreductase"
FT                   /function="Carbohydrate Metabolism"
FT                   /EC_number="1.1.1.38"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0651"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26740"
FT                   /db_xref="GOA:Q5ZXT0"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXT0"
FT                   /protein_id="AAU26740.1"
FT                   /translation="MDNEVIKQRALDYHEFPVPGKLSVHLTKSTNSQDDLSLAYTPGVA
FT                   APVLAIAEAPENAYRFTSKGNLVAVMTNGTAVLGLGNLGPLASKPVMEGKAVLFKRFAD
FT                   LDVFDIEIDAEDPQSFIATAKRIAPTFGGINLEDIKAPECFEIEQALIEQLNIPVFHDD
FT                   QHGTAIVVAAGLLNALELQNKKLSDIKIVCMGAGAAGIASMRLLVALGAPKSNMLLLDT
FT                   KGVIHSGREDLNPYKFAFARNTSCRTLEDALVDADVFIGVARPDLLNAHLLSLMAPNPV
FT                   IFALSNPDPEIKPELAHSVRKDLVMATGRSDYPNQVNNVLCFPYIFRGALDVRATCINQ
FT                   AMQIAAVEAIRQLVHEPVPQVVKDNYPGVVNWDFGPDYIIPKPIDPRLKERVPAAVAKA
FT                   AIASGASQFNNL"
FT   gene            699505..700797
FT                   /locus_tag="lpg0652"
FT   CDS_pept        699505..700797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0652"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0652"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26741"
FT                   /db_xref="GOA:Q5ZXS9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS9"
FT                   /protein_id="AAU26741.1"
FT                   /translation="MHTENRTNYAMIGWLLCGLGAIFYSYEYLLRIAPSVMENALRTHF
FT                   NLSASGFGFLSSIYYLAYVPMQLPVGVLLDRYGPKRLLTMACLVCVIGTYMFTGTTIFW
FT                   VAATGRFLVGFGSAFAFVGVLKIATLWLPENRLAMISGMTSALGPIGAMLGDNFLELFI
FT                   VKMGWVKTLNMTAAFGIVLTLVLWVGIRDRKGHHRQSGTVPTLKKGLVDLGIIITSRQI
FT                   WVNGMYGCLVYLPTTVFAELWGIPYLHHAHGLTTQAAGLANSVLFLGFIIGAPIMGYIS
FT                   DRLYRRKFPMLIGASGAAIVMMMILYLPGLNESNIQALMFLLGLLYSAQAIVFAVGREL
FT                   SPGEAAGTAMAVTNMIVMLGAMFLQPLVGHLLDFSLSTHLSDTTGIVVDNMSKLYTVDD
FT                   YQFALSIIPLGILIAAILTFFLKETHAKAPK"
FT   gene            700778..702055
FT                   /locus_tag="lpg0653"
FT   CDS_pept        700778..702055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0653"
FT                   /product="major facilitator family transporter"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0653"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26742"
FT                   /db_xref="GOA:Q5ZXS8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS8"
FT                   /protein_id="AAU26742.1"
FT                   /translation="MQKHLNNMTTKKQISYGVLVCFIGAVFYCYEFILRIVPGALQTEL
FT                   STALGHISATTFGQISALYYFAYSPMQMPVGMLMDRYGPRRLLTFACLCCALGSWMFTL
FT                   TWSIVLVGIGRFLVGFGSSFAFVGVLSLALHWLPRRYFSLVAGLITTLGMLGLVYGEIK
FT                   ITEWSEVIGWDHVLMHIAMIGSALCILTFFVVRDGPEGYQPNKYPWPEFFHNVLKVLTS
FT                   HEVWLIGFVGACLYTSLSVFGELWGKTYLEQAHHLTKVEAAKTVSAVFLGWAVGAPLAG
FT                   YISDITRRRLLPLVIGAIVSLICISFVLYCPGLSYLTLNILLFLYGVFSATEIIVFIMA
FT                   KECSGAKLSGTVFAVTNMIISLAGAIFQPLVGKLLDTFGDSGIVAGEHIYTVDDYQVAL
FT                   SILPISLLLVTILAFFIKDKDHSNNS"
FT   gene            complement(702084..702902)
FT                   /gene="dam"
FT                   /locus_tag="lpg0654"
FT   CDS_pept        complement(702084..702902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="lpg0654"
FT                   /product="DNA adenine methylase"
FT                   /function="DNA/RNA degradation / restriction"
FT                   /EC_number="2.1.1.72"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0654"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26743"
FT                   /db_xref="GOA:Q5ZXS7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS7"
FT                   /protein_id="AAU26743.1"
FT                   /translation="MVKIRPFLKWAGSKYNCLNEIISSLPTGQRLIEPFAGSGVVFMNT
FT                   SYSSYLLAESNSDLVNIYRILQLNGESFIDYCQQYFTPEANCKEKYYELRSEFNNLMDS
FT                   NQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYFPRKEMMLFYKKCLSAQFIHG
FT                   DFRNTFALAKPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIP
FT                   VIISNHDTEFTRHHYKKAQIKSFYVPRWISCRSKMRLPVKELVAVFNCSS"
FT   gene            complement(703073..704299)
FT                   /locus_tag="lpg0655"
FT   CDS_pept        complement(703073..704299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0655"
FT                   /product="tryptophan/tyrosine permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0655"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26744"
FT                   /db_xref="GOA:Q5ZXS6"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS6"
FT                   /protein_id="AAU26744.1"
FT                   /translation="MYLYCFGLYFVINSKLIGGILLIVGTSIGGGMLALPVSTAEVGFA
FT                   NSLFFLFFCWLVMTAGALLILEVNLRLPAGSNMISMAKSTLGLPGQVIAWITYLLLLYT
FT                   LLAAYISGGSDVFSSLLHKAHIDLPNWITSVIFTAMFSLIVYSGIRSVDYVNRGLMFGK
FT                   LGVYILLVIIISPHVSTAGLTGGSAKAFTGTLMILVTSFGFASIVPSLRDYFNDDIRSL
FT                   RRVILFGSLIPLFCYIVWDAVIMGVISREGENGLLSLMNSDHATSGLTEALSQSVSSQW
FT                   ISGFFGFFTSICMVTAFLGVSLGLFDFLADGLKLKKSGNQGKYTLALTFIPPLAVVLFN
FT                   PGIYLHALSYAGVCCVILLLLLPAIMAWKGRQTCSQSPSETHLIPGGNPALSLIGFIAI
FT                   GLLIIAIMY"
FT   gene            complement(704468..705658)
FT                   /locus_tag="lpg0656"
FT   CDS_pept        complement(704468..705658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0656"
FT                   /product="tryptophan/tyrosine permease"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0656"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26745"
FT                   /db_xref="GOA:Q5ZXS5"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS5"
FT                   /protein_id="AAU26745.1"
FT                   /translation="MRSRFIGGILLIVGTSIGGGMLALPVANAATGFWQSSLFLLICWA
FT                   FMTFGAFFILEANLYLSRGKHMVSMAKATLGDYGLLTAWISYLFLLYTLLSAYISGGAD
FT                   VLNSLLSKANWHLSDWQASSLFTLIFGLVVYGGIHSVDVANRALMFGKLAVYCILVIMI
FT                   APHIEFHYFQHGDYQQIGGAIMILITSFGFAIIVPNLRDYFDDDIKTLKKVIFIGSLIP
FT                   LICYIAWDAVIIGSLPSAGTSGLESLMQNPRTTSALASLLTDKVENTTISALFNFFTSI
FT                   CMLTAFLGVSLCLFSFLADGLKLRERGRHGIGLFVLTFLPPLLIVIYYPGAYIYALRYA
FT                   GIFCIILLLLLPALMCYFGRKRYKSPFWVPGGKISQFAVIIISVVLLTHEFIALFK"
FT   gene            complement(705669..706418)
FT                   /locus_tag="lpg0657"
FT   CDS_pept        complement(705669..706418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0657"
FT                   /product="outer membrane protein, OmpA family protein"
FT                   /function="Toxin production / other pathogen functions"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26746"
FT                   /db_xref="GOA:Q5ZXS4"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="PDB:3LDT"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS4"
FT                   /protein_id="AAU26746.1"
FT                   /translation="MRNLMRCLIMIKSLIKGVDMSRKLAKTRILGYGLMICFLAGCFHP
FT                   PYNNFQPDRRAVKRVGVDTGIGAVAGAIASGTASGTLIGAAAGGTVGLVASIYRDSKRK
FT                   IIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTI
FT                   YVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHG
FT                   SAQNRRIEIQWFTSPAQPPQPQMAYVK"
FT   gene            706807..707664
FT                   /locus_tag="lpg0658"
FT   CDS_pept        706807..707664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0658"
FT                   /product="HlyD family secretion protein"
FT                   /function="Protein fate / hydrolases / secretion"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0658"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26747"
FT                   /db_xref="GOA:Q5ZXS3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS3"
FT                   /protein_id="AAU26747.1"
FT                   /translation="MENYMSKKAIAISIVIALFFITAIWFAYNFVKQEENQNWLTLYGN
FT                   IDIRDVSLSFRVSGRILSMDVDEGAHVKKGQVLARLDKDTFIANLETAKAQLEQAIANQ
FT                   KNASRTYKRREQLVDNGAVSKALFDDAVAMKDSSSAEVAVAKANLEKAQISLNDTEIHA
FT                   PTHGTILTRIQEPGAIVNIAEPVYTLAIDNPVWVRTYIDEPFLGKIYPGQEALVYTDSN
FT                   PEKPYKGHIGFISPQAEFTPKIVETTQLRTDLVYRIRVVVDQPDNGLRQGMPVTVKIHL
FT                   KANS"
FT   gene            707667..709409
FT                   /locus_tag="lpg0659"
FT   CDS_pept        707667..709409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0659"
FT                   /product="ABC transporter ElsE"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0659"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26748"
FT                   /db_xref="GOA:Q5ZXS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS2"
FT                   /protein_id="AAU26748.1"
FT                   /translation="MNSSKPLVSINGVSKCFPGNIDPALDNVSATIFEGQITGLVGPDG
FT                   AGKSTLMRLICSLMMPTQGTIKVDSLNTRTDSEKIHAITGYMPQKFGLYEDLTIIENLR
FT                   LYAELRNLHGEKREEQFSTLLKFTALEPFQKRLAGNLSGGMKQKLGLACALMGEPKLLL
FT                   LDEPSVGVDPISRRELWTMVQGLLGRGMGVVWSTAYLDEAEKCDQILLLNAGKPIYHGK
FT                   PGDFLQKTKDRTFQICGVSLLNRRQALMNALNTPEVIDGVIQGKNIRIVIGDKKIKPSL
FT                   DSITREPGVHFQEVESRFEDAFIDSLKTKISGRSLLAEHIAEKPHSDKPIIEARKLTKR
FT                   FGSFTAVSNNEFTIKRGEIFGLLGPNGAGKSTTFKMMCGLLQPTQGQAFVMGLDLKTSS
FT                   SEARSRIGYMAQKFSLYSHLDALQNMRFFSGLYGLSGKRQEAQINSMIEIFDLKKHLKQ
FT                   NSGDLPLGFKQRLALACAVMHEPDVLFLDEPTSGVDPLTRREFWTHINGMVNKGVTVMV
FT                   TTHFMDEAEYCDRIALIYRGKNIATGTPDDLKDKVRNSTLPNPTLEDAFIELIRLDELR
FT                   EPVH"
FT   gene            709427..710548
FT                   /locus_tag="lpg0660"
FT   CDS_pept        709427..710548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0660"
FT                   /product="ABC transporter permease protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0660"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26749"
FT                   /db_xref="GOA:Q5ZXS1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS1"
FT                   /protein_id="AAU26749.1"
FT                   /translation="MNIRFLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADSLSGNPKPALQTIVDGSYPQVAGFAENYALGALQTWISSQAYEHGQLTVKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   AKDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
FT   gene            710548..711672
FT                   /locus_tag="lpg0661"
FT   CDS_pept        710548..711672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0661"
FT                   /product="ABC transporter permease protein"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0661"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26750"
FT                   /db_xref="GOA:Q5ZXS0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXS0"
FT                   /protein_id="AAU26750.1"
FT                   /translation="MAKLSPTTRIFALVIKEILTLFKDPKGRIVLIAPPLLQLLIFSFA
FT                   ATMEIKNISIGILNQDFGKHGYEVIQRFIGSPTFSKVFFIQKQSDIKPIIDNQEAMVVM
FT                   TIPQDFSRKIESNSQANIQLILDGRRSNATQIVNGYISSIIENYNQEIQKTHGAIMTPP
FT                   VMVTRSWFNENLLYLWFTVPSLVCILSMLISLVVTALSVARERELGTFDQLLVSPLTPY
FT                   EILIGKTIPAIIIGLAEGLLMWVAAVWLFDVPFYGSPLLMVYILFIFIMSTVGVGLFIS
FT                   SMCKTQQQAILGVFIYMVPVVTLSGYASPVENMPEWLQDLTWFNPLKFTLIAVIGIFLK
FT                   GMSALEVFITTWPLLLVGAVTLFIAGWFFKQRME"
FT   gene            711681..713120
FT                   /locus_tag="lpg0662"
FT   CDS_pept        711681..713120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0662"
FT                   /product="multidrug efflux MFS outer membrane protein (RND
FT                   family)"
FT                   /function="Transport and binding"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0662"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26751"
FT                   /db_xref="GOA:Q5ZXR9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXR9"
FT                   /protein_id="AAU26751.1"
FT                   /translation="MDRKLALLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISS
FT                   SAPVHLTWWKAFHDPLLDRYINEAATNNLDIKAAEARIRQARAMKQISLANFYPQINGS
FT                   ASANSLQISKGTLEGIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKAS
FT                   LEEAYESRRTILLSTIAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVS
FT                   SEVDVSLAEGQLKNTESVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKMQSLPKPPQ
FT                   KVPMGLRSDILRQRPDIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTL
FT                   FQSSSGFWLMGPQVSLPIFRGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALAR
FT                   YSQSLDTNHSLRAAIIANKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVS
FT                   SLTALISLYKALGGGWENFEA"
FT   gene            complement(713454..715274)
FT                   /locus_tag="lpg0663"
FT   CDS_pept        complement(713454..715274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="lpg0663"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /function="Metabolism of Complex Carbohydrates, Nucleotide
FT                   Metabolism"
FT                   /EC_number="3.2.1.-"
FT                   /note="conserved gene"
FT                   /db_xref="EnsemblGenomes-Gn:lpg0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAU26752"
FT                   /db_xref="GOA:Q5ZXR8"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ZXR8"
FT                   /protein_id="AAU26752.1"
FT                   /translation="MPNNCPQALLRGIMKRLLIFLCGLLCSFNLFALSGQAYMDRFNRY
FT                   LAWYEHLPINPSPEFLEFVKESTPLANKLRDKWLYELARIKDWANYNKYYQPTNDINLR
FT                   CFAQIAKFNLGLYKEAIAGSIPIWLTGESRPQACNTLFALLLKQDNFDQKFITQRITLA
FT                   LDKRNVLLARYLLKQYKTPHDTEIKNLTSVYENPSNISKLNPGKLNDYFYLYGLKRLVS
FT                   INMDKAVKLWQEKKTNIMLNERQKQDFLAHLALYKAMRNHADAQEWFAKIKPEYYTDVL
FT                   VDWQIRFALKNKNWKQVEKLINNSPNKEMPCWQYWLARSLEEQGKKAEAIKIYEPLAKN
FT                   RHYYGFLASKRLKKRPSFDNEKPTTNTEILKPYQPVIEQIKSFYNSKQLLQASRLLNDF
FT                   ISELPKEEASALVYWIATELKWHGKSVYLSNNDTLNNQLALRFPLAYKDTIKAYASKYA
FT                   IPPELVYAIIRQESGFREDVTSSAGAKGLMQVMPQTASAVSKTSKIPYSDHKQLFLSQK
FT                   NINIGIAYLQHLTKRFSNHPVLVAAAYNAGPRQVVYWLKNHPPKEIDIWIETLPWQETR
FT                   NYLKNVMAFYIVYQYRLNQQPDMNRFLTPL"
FT   gene            complement(715277..715930)
FT                   /gene="rpe"
FT                   /locus_tag="lpg0664"
FT   CDS_pept        complement(715277..715930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="lpg0664"
FT                   /product="D-ribulos