(data stored in ACNUC15324 zone)

EMBL: AF004774

ID   AF004774; SV 2; linear; mRNA; STD; ROD; 1107 BP.
XX
AC   AF004774;
XX
DT   11-SEP-1997 (Rel. 52, Created)
DT   08-JUL-1999 (Rel. 60, Last updated, Version 4)
XX
DE   Rattus norvegicus c49a mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1107
RX   DOI; 10.1002/(SICI)1097-4644(19990701)74:1<1::AID-JCB1>3.3.CO;2-D.
RX   PUBMED; 10381256.
RA   Soo C., Shaw W.W., Freymiller E., Longaker M.T., Bertolami C.N., Chiu R.,
RA   Tieu A., Ting K.;
RT   "Cutaneous rat wounds express c49a, a novel gene with homology to the human
RT   melanoma differentiation associated gene, mda-7";
RL   J. Cell. Biochem. 74(1):1-10(1999).
XX
RN   [2]
RP   1-1107
RA   Soo C., Ting K.;
RT   ;
RL   Submitted (19-MAY-1997) to the INSDC.
RL   Surgery, UCLA School of Medicine, 10833 Le Conte Ave, Los Angeles, CA
RL   90095, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1107
RA   Soo C., Ting K.;
RT   ;
RL   Submitted (07-JUL-1999) to the INSDC.
RL   Surgery, UCLA School of Medicine, 10833 Le Conte Ave, Los Angeles, CA
RL   90095, USA
XX
DR   MD5; 1eb55629c038ed7a89e6cab921a04a13.
XX
CC   On Jul 7, 1999 this sequence version replaced gi:2352478.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1107
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        181..732
FT                   /codon_start=1
FT                   /product="c49a"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR020423"
FT                   /db_xref="InterPro:IPR020444"
FT                   /db_xref="UniProtKB/TrEMBL:Q9WVP8"
FT                   /protein_id="AAB69171.1"
FT                   /translation="MQTSLRQQILPGLSLILLVLNQVPELQGQEFRFGPCQVTGVVLPE
FT                   LWEAFWTVKNTVKTQDELTSARLLKPQVLQNVSDAESCYLAHSLLKFYLNTVFKNYHSK
FT                   IVKFKVLKSFSTLANNFLVIMSKLQPSKDNAMLPISDSARRRFLLFHRTFKQLDIEVAL
FT                   AKAFGEVDILLAWMQNFYQL"
XX
SQ   Sequence 1107 BP; 267 A; 301 C; 249 G; 290 T; 0 other;
     cgcccgggca ggtatttcca cagtggagac aggcgcttcc tacccaccag aagaccccct        60
     accagtgaat gttgacggag cttgcccaac ttttcgtgca ataagaagaa ccagccacct       120
     tcacacagca gcctccagcg tcacttcagg acctgagcag gagcacgggc cctttcttca       180
     atgcagacaa gcttgagaca acagattctc cccggcctga gcctaatcct tctcgttttg       240
     aaccaagtac cagagcttca gggtcaagag ttccgatttg ggccttgcca agtgaccggg       300
     gtggttctcc cagaactgtg ggaggccttc tggactgtga agaacactgt gaaaactcag       360
     gacgagctca caagtgcccg gctgttgaaa ccacaggttc tgcagaatgt ctcggatgcc       420
     gagagctgtt accttgccca cagcctgctg aagttctact tgaacactgt tttcaaaaac       480
     tatcacagca aaatagtcaa attcaaggtc ttgaagtcat tctccactct ggccaacaac       540
     tttttagtca tcatgtccaa actgcagcct agtaaggaca atgccatgct tcccattagt       600
     gacagtgcac gccggcgttt tttgctgttc cacagaacat tcaaacagtt ggacatagaa       660
     gtggctttgg cgaaagcctt tggggaagtg gacattctcc tggcctggat gcagaatttc       720
     taccagctct gattgccaat ccggataact tcctcctttg ttctccgtgc catttcaagg       780
     cattgttcat atccctgttg tcctcagggc acttcagacc cttggccatg gacccctgtc       840
     gttggctcag gcttttcttc agacctcact ctttagtcca aacgacagcc atggacagca       900
     cctttggatg ctccgactga cccacaacgt ggatttgcat atttattaca gccctattta       960
     actaatgtca ctgtttcggt agaaaccgta tttatttgtg agactggacg ttccatgaaa      1020
     gcatcatgcc ccgtgtttgc accttacttc ctgtgagctg gctcaccatg ggggcagtag      1080
     atggttgctc agtaaatatt taaaatg                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page