(data stored in ACNUC15324 zone)

EMBL: AF009224

ID   AF009224; SV 2; linear; genomic DNA; STD; PRO; 18158 BP.
XX
AC   AF009224; M23245; M29714; M29848; M62649; M76990-M76991;
XX
DT   11-SEP-1997 (Rel. 52, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Acinetobacter sp. ADP1 ben operon and cat operon, complete sequence.
XX
KW   .
XX
OS   Acinetobacter baylyi
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter.
XX
RN   [1]
RP   2316-18158
RX   PUBMED; 3170486.
RA   Neidle E.L., Hartnett C., Bonitz S., Ornston L.N.;
RT   "DNA sequence of the Acinetobacter calcoaceticus catechol 1,2-dioxygenase I
RT   structural gene catA: evidence for evolutionary divergence of intradiol
RT   dioxygenases by acquisition of DNA sequence repetitions";
RL   J. Bacteriol. 170(10):4874-4880(1988).
XX
RN   [2]
RP   2316-18158
RX   PUBMED; 2793826.
RA   Neidle E.L., Hartnett C., Ornston L.N.;
RT   "Characterization of Acinetobacter calcoaceticus catM, a repressor gene
RT   homologous in sequence to transcriptional activator genes";
RL   J. Bacteriol. 171(10):5410-5421(1989).
XX
RN   [3]
RP   2316-18158
RX   PUBMED; 1885518.
RA   Neidle E.L., Hartnett C., Ornston L.N., Bairoch A., Rekik M., Harayama S.;
RT   "Nucleotide sequences of the Acinetobacter calcoaceticus benABC genes for
RT   benzoate 1,2-dioxygenase reveal evolutionary relationships among
RT   multicomponent oxygenases";
RL   J. Bacteriol. 173(17):5385-5395(1991).
XX
RN   [4]
RP   2316-18158
RX   DOI; 10.1111/j.1432-1033.1992.tb16612.x.
RX   PUBMED; 1740120.
RA   Neidle E., Hartnett C., Ornston L.N., Bairoch A., Rekik M., Harayama S.;
RT   "cis-diol dehydrogenases encoded by the TOL pWW0 plasmid xylL gene and the
RT   Acinetobacter calcoaceticus chromosomal benD gene are members of the
RT   short-chain alcohol dehydrogenase superfamily";
RL   Eur. J. Biochem. 204(1):113-120(1992).
XX
RN   [5]
RP   2316-18158
RX   DOI; 10.1016/0378-1119(94)90783-8.
RX   PUBMED; 8125318.
RA   Shanley M.S., Harrison A., Parales R.E., Kowalchuk G., Mitchell D.J.,
RA   Ornston L.N.;
RT   "Unusual G + C content and codon usage in catIJF, a segment of the ben-cat
RT   supra-operonic cluster in the Acinetobacter calcoaceticus chromosome";
RL   Gene 138(1-2):59-65(1994).
XX
RN   [6]
RP   2316-18158
RX   PUBMED; 7592340.
RA   Romero-Arroyo C.E., Schell M.A., Gaines G.L.III., Neidle E.L.;
RT   "catM encodes a LysR-type transcriptional activator regulating catechol
RT   degradation in Acinetobacter calcoaceticus";
RL   J. Bacteriol. 177(20):5891-5898(1995).
XX
RN   [7]
RP   1-18158
RX   PUBMED; 9294456.
RA   Collier L.S., Nichols N.N., Neidle E.L.;
RT   "benK encodes a hydrophobic permease-like protein involved in benzoate
RT   degradation by Acinetobacter sp. strain ADP1";
RL   J. Bacteriol. 179(18):5943-5946(1997).
XX
RN   [8]
RP   1-18158
RX   PUBMED; 9573203.
RA   Collier L.S., Gaines G.L.III., Neidle E.L.;
RT   "Regulation of benzoate degradation in Acinetobacter sp. strain ADP1 by
RT   BenM, a LysR-type transcriptional activator";
RL   J. Bacteriol. 180(9):2493-2501(1998).
XX
RN   [9]
RP   1-18158
RA   Collier L.S., Neidle E.L.;
RT   ;
RL   Submitted (18-JUN-1997) to the INSDC.
RL   Microbiology, University of Georgia, 529 Biological Sciences Bldg., Athens,
RL   GA 30602, USA
XX
RN   [10]
RC   Sequence update by submitter
RP   1-18158
RA   Collier L.S., Neidle E.L.;
RT   ;
RL   Submitted (30-MAR-1998) to the INSDC.
RL   Microbiology, University of Georgia, 529 Biological Sciences Bldg., Athens,
RL   GA 30602, USA
XX
RN   [11]
RC   Sequence update by submitter
RP   1-18158
RA   Elby D.M., Neidle E.L.;
RT   ;
RL   Submitted (17-DEC-2001) to the INSDC.
RL   Microbiology, University of Georgia, 529 Biological Sciences Bldg., Athens,
RL   GA 30602, USA
XX
DR   MD5; d052f5f502056da1cd2d714826cc97c0.
DR   EuropePMC; PMC101918; 10715011.
DR   EuropePMC; PMC107193; 9573203.
DR   EuropePMC; PMC107259; 9603882.
DR   EuropePMC; PMC107456; 9721284.
DR   EuropePMC; PMC110988; 10986248.
DR   EuropePMC; PMC111261; 10735855.
DR   EuropePMC; PMC1196051; 16030237.
DR   EuropePMC; PMC124324; 12032345.
DR   EuropePMC; PMC135353; 12218013.
DR   EuropePMC; PMC1392982; 16461648.
DR   EuropePMC; PMC1393229; 16517618.
DR   EuropePMC; PMC139574; 11751829.
DR   EuropePMC; PMC1855702; 17158677.
DR   EuropePMC; PMC193950; 13129960.
DR   EuropePMC; PMC92364; 11055908.
DR   EuropePMC; PMC92901; 11375157.
DR   EuropePMC; PMC93058; 11472934.
DR   EuropePMC; PMC95491; 11673430.
DR   EuropePMC; PMC98904; 9529885.
XX
CC   On Dec 17, 2001 this sequence version replaced gi:3025420.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..18158
FT                   /organism="Acinetobacter baylyi"
FT                   /strain="ADP1"
FT                   /mol_type="genomic DNA"
FT                   /note="formerly Acinetobacter calcoaceticus"
FT                   /db_xref="taxon:202950"
FT   CDS_pept        1..1401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benK"
FT                   /product="benzoate transport protein"
FT                   /db_xref="GOA:O30513"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O30513"
FT                   /protein_id="AAC46425.1"
FT                   /translation="MSREINVNQMIDDSKLTPFHWRVIILSTLIIIFDGYDLVIYGVAL
FT                   PLLMKEWAIDPVTAGFIGSIALFGMMFGALIFGTIADKLEHLGVSRKKVIAVCIILFSL
FT                   CTVLCGFSETTTQFSIFRFLAGVGIGGVMPNVIALVSEYAPKKFKSFFVTLMFSGYAIG
FT                   GMTAAFLGSILVPLYGWKIMFMIAGIPLVLLLPLMEVLPESIDYLVRKKKDETVRFIMT
FT                   KMVPSYQYQPDHVFVLNSSNQNQAQAPVKMIFQEQRAFSTMMFWCSIFMTLIMVYALGN
FT                   WLPKLMIEAGYNLSKSLIFLFSLNVGGMIGSILGGYLADRYNVKFVTMGLLLLGAISLS
FT                   LLSFQFSSVILYILIACAGAASIGAQIMLLAYMAKFYAPNVRSTGIGWGLGMGRVGAIL
FT                   GPILTGWLLSLQLPHFYNFLALSIPAVLGIVTVFLINDRRMYQPEPISPIANQNDTTTV
FT                   KVNEAVSH"
FT   misc_feature    1
FT                   /gene="benK"
FT                   /note="this position is contiguous with first position of
FT                   Genbank Accession Number AF150928, but extends in the
FT                   opposite direction"
FT   CDS_pept        complement(1454..2368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benM"
FT                   /product="LysR-type transcriptional activator"
FT                   /db_xref="GOA:O68014"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2F6G"
FT                   /db_xref="PDB:2F6P"
FT                   /db_xref="PDB:2F78"
FT                   /db_xref="PDB:2F7A"
FT                   /db_xref="PDB:2F8D"
FT                   /db_xref="PDB:2F97"
FT                   /db_xref="PDB:2H99"
FT                   /db_xref="PDB:2H9B"
FT                   /db_xref="PDB:3K1M"
FT                   /db_xref="PDB:3K1N"
FT                   /db_xref="PDB:3K1P"
FT                   /db_xref="PDB:3M1E"
FT                   /db_xref="PDB:4IHS"
FT                   /db_xref="PDB:4IHT"
FT                   /db_xref="UniProtKB/Swiss-Prot:O68014"
FT                   /protein_id="AAC46441.1"
FT                   /translation="MELRHLRYFVAVVEEQSFTKAADKLCIAQPPLSRQIQNLEEELGI
FT                   QLLERGSRPVKTTPEGHFFYQYAIKLLSNVDQMVSMTKRIASVEKTIRIGFVGSLLFGL
FT                   LPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRSLLRNER
FT                   LMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKIN
FT                   EVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTY
FT                   IYSLYETIRQIYAYEGFTEPPNW"
FT   misc_feature    2316
FT                   /note="corresponds to position 1 of the previous entries
FT                   M76990 and M76991"
FT   CDS_pept        2662..4047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benA"
FT                   /product="BenA"
FT                   /function="reductive oxygenase for benzoate"
FT                   /db_xref="GOA:P07769"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017639"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07769"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46436.2"
FT                   /translation="MPRIPVINTSHLDRIDELLVDNTETGEFKLHRSVFTDQALFDLEM
FT                   KYIFEGNWVYLAHESQIPNNNDYYTTYIGRQPILIARNRNGELNAMINACSHRGAQLCR
FT                   HKRGNKTTYTCPFHGWTFNNSGKLLKVKDPSDAGYSDCFNQDGSHDLKKVARFESYKGF
FT                   LFGSLNPDVPSLQEFLGETTKIIDMIVGQSDQGLEVLRGVSTYTYEGNWKLTAENGADG
FT                   YHVSAVHWNYAATTQHRKEKQAGDTIRAMSAGSWGKHGGGSYGFEHGHMLLWTQWGNPE
FT                   DRPNFPKAAEYTEKFGAAMSKWMIERSRNLCLYPNVYLMDQFGSQIRVLRPISVNKTEV
FT                   TIYCIAPVGEAPEARARRIRQYEDFFNASGMATPDDLEEFRACQAGYAGIELEWNDMCR
FT                   GSKHWIYGPDDAANEIGLKPAISGIKTEDEGLYLAQHQYWLKSMKQAIAAEKEFASRQG
FT                   ENA"
FT   CDS_pept        4044..4553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benB"
FT                   /product="BenB"
FT                   /function="reductive oxygenase for benzoate"
FT                   /db_xref="GOA:P07770"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR017641"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07770"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46437.1"
FT                   /translation="MNATALLDTISIEQISQFLYSEARFLDDEQWDDWLECYAPQASFW
FT                   MPAWDDNDQLTENPQTEISLIYYPDRQGLEDRVFRIKTERSSATMPDTRTAHNISNIEV
FT                   ESRDGLQITVRFNWNTLSFRYKNSYSYFGMSRYVIDFSGEQPKILSKYVMLKNDYINQV
FT                   IDIYHI"
FT   CDS_pept        4626..5642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benC"
FT                   /product="BenC"
FT                   /function="reductive oxygenase for benzoate"
FT                   /db_xref="GOA:P07771"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="PDB:1KRH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07771"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46438.1"
FT                   /translation="MSNHQVALQFEDGVTRFICIAQGETLSDAAYRQQINIPMDCREGE
FT                   CGTCRAFCESGNYDMPEDNYIEDALTPEEAQQGYVLACQCRPTSDAVFQIQASSEVCKT
FT                   KIHHFEGTLARVENLSDSTITFDIQLDDGQPDIHFLAGQYVNVTLPGTTETRSYSFSSQ
FT                   PGNRLTGFVVRNVPQGKMSEYLSVQAKAGDKMSFTGPFGSFYLRDVKRPVLMLAGGTGI
FT                   APFLSMLQVLEQKGSEHPVRLVFGVTQDCDLVALEQLDALQQKLPWFEYRTVVAHAESQ
FT                   HERKGYVTGHIEYDWLNGGEVDVYLCGPVPMVEAVRSWLDTQGIQPANFLFEKFSAN"
FT   CDS_pept        5661..6446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benD"
FT                   /product="benzoate diol dehydrogenase"
FT                   /note="BenD"
FT                   /db_xref="GOA:P07772"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07772"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46439.1"
FT                   /translation="MNSTQRFEHKVVIVTGAAQGIGRGVALRIAQEGGCLILADRSDLI
FT                   QAVLAEIKALGALAIAVETDLETYAGAELVVSHAIAEYGRIDVLINNVGGAIWMKPFQE
FT                   FSEEEIIQEVHRSLFPALWCCRAVLPEMLKHQQGTIVNVSSIATRGIHRIPYSACKGGV
FT                   NALTASLAFEHAQHGIRVNAVATGGTKAPPRKIPRNAQPLSKSEQVWMQQVVDQTIDRS
FT                   FLGRYGSIDEQVNAITFLASDESSYITGSVLPVGGGDQG"
FT   CDS_pept        6488..7672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="benE"
FT                   /product="BenE"
FT                   /db_xref="GOA:P07775"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07775"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46440.1"
FT                   /translation="MTTLLKTLKQDWSLSATIAGFLAVLISYSGPLIIFFQAAQKAHVS
FT                   TEMMISWIWAISIGAAVTGIFLSIRFKTPVVTAWSAPGTALLVTLFPNISLNEAVAAYI
FT                   TAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTLPLIVFSMLLC
FT                   YLISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDFQIARPQFIAPEWSWFSTLNLAL
FT                   PLILVSLTGQFLPGMAILKLSGYNTPAKPIIAAASLASLFAAFAGGITIVLASITATLC
FT                   MGKDAHELKDKRYIAGIANGLFYVLGGVFAGSIVALFSLLPKELVAALAGLALLGAIAS
FT                   NIKIAMQEDQQRDPALITFLATVSGMHFLGLSSVFWGMCIGMLAYFILLKPKAS"
FT   CDS_pept        8287..9222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catA"
FT                   /product="catechol 1,2-dioxygenase"
FT                   /db_xref="GOA:P07773"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR012801"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="PDB:1DLM"
FT                   /db_xref="PDB:1DLQ"
FT                   /db_xref="PDB:1DLT"
FT                   /db_xref="PDB:1DMH"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07773"
FT                   /citation=[1]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46426.1"
FT                   /translation="MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAI
FT                   EDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRT
FT                   IEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGF
FT                   YSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRP
FT                   AHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEG
FT                   PFAEMVFDLKLTRLVDGVDNQVVDRPRLAV"
FT   CDS_pept        9307..10566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat operon"
FT                   /product="unknown"
FT                   /note="ORF1"
FT                   /db_xref="GOA:P07776"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07776"
FT                   /citation=[2]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46427.1"
FT                   /translation="MDNQIIQETVDKILSVLPNQAGQLARLVRLMQFACDPTITVIGKY
FT                   NHGKSRLLNELIGTDIFSVADKRETIQLAEHKQDQVRWLDAPGLDADVAAVDDRHAFEA
FT                   VWTQADIRLFVHSVREGELDATEHHLLQQLIEDADHSRRQTILVLTQIDQIPDQTILTQ
FT                   IKTSIAQQVPKLDIWAVSATRHRQGIENGKTLLIEKSGIGALRHTLEQALAQVPSARTY
FT                   EKNRLLSDLHHQLKQLLLDQKHVLQQLQQTQQQQLHDFDTGLINILDKIRVDLEPIVNI
FT                   DGQDQALNPDSFATMFKNTAAKQQRAKVQIAYSRACIEINSHLIRHGVVGLPAEQQTTI
FT                   KSIDTVIVAVFGISVKFRDQLRALFYTDTERQRLQREFRFYFEKSAGRMILAAKIEQTM
FT                   RQQGCIQNAMMALQQMESAA"
FT   CDS_pept        10563..11585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat operon"
FT                   /product="unknown"
FT                   /note="ORF2"
FT                   /db_xref="GOA:P07777"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07777"
FT                   /citation=[2]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46428.1"
FT                   /translation="MTSGGHIQLFIEHTRQIATAQGDIQLALQSMQQWREAFATALKQN
FT                   TFDLTGWSPQTKIANQLKQFNHKLTTHVSNWDTEWHTFSAAQSVAEVFHDRVMLLVFGK
FT                   FNAGKSSLCNLLAECFRSHEQTVQYFHVQNEQIFYTESHLREGATETTAQLQGVCLGEK
FT                   LILLDTPGLHSGTQKNAALTQKFIDSADGVLWLSSATSPGQVQELDALGRELKRHKPLF
FT                   PVITRSDFVEEDEIDGELCTVLCNKNSEQRALQESDVLMRAKEKLHSMQVDVSLLKPPV
FT                   SVSTQMAREADMNPQAMNEAGFERLFAALLLLLSLLCAISSVNLPKYCCIFCKNISLKV
FT                   "
FT   CDS_pept        complement(12116..13027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catM"
FT                   /product="transcriptional activator protein"
FT                   /function="activator of cat-gene expression"
FT                   /db_xref="GOA:P07774"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2F7B"
FT                   /db_xref="PDB:2F7C"
FT                   /db_xref="PDB:2H98"
FT                   /db_xref="PDB:3GLB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07774"
FT                   /citation=[6]
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46429.1"
FT                   /translation="MELRHLRYFVTVVEEQSISKAAEKLCIAQPPLSRQIQKLEEELGI
FT                   QLFERGFRPAKVTEAGMFFYQHAVQILTHTAQASSMAKRIATVSQTLRIGYVSSLLYGL
FT                   LPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKITDPAIRRIVLHKEQ
FT                   LKLAIHKHHHLNQFAATGVHLSQIIDEPMLLYPVSQKPNFATFIQSLFTELGLVPSKLT
FT                   EIREIQLALGLVAAGEGVCIVPASAMDIGVKNLLYIPILDDDAYSPISLAVRNMDHSNY
FT                   IPKILACVQEVFATHHIRPLIE"
FT   CDS_pept        13151..14263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catB"
FT                   /product="muconate cycloisomerase"
FT                   /function="conversion of muconate to (+)-muconolactone"
FT                   /note="growth with muconate or benzoate"
FT                   /db_xref="GOA:Q43931"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q43931"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46430.1"
FT                   /translation="MYKSVETILVDIPTIRPHKLSVTTMQTQTLVLIKIITEDGIVGWG
FT                   EATTIGGLNYGEESPESVKANIDTYFKPLLLSIKAPLNVAQTLKLIRKSINGNRFAKCA
FT                   IQTALLEIQAKRLNVPVSELLGGRIRDRLPVLWTLASGDTDKDIAEAKKMIELKRHNTF
FT                   KLKIGSNPLQHDVDHVIAIKKALGPEISVRVDVNRAWSELECVKGIQQLQDGGIDLIEQ
FT                   PCAIENTDALARLTARFDVAIMADEVLTGPDSAYRIAKKSGADVFAVKVEQSGGLIEAC
FT                   EVAKIARLAGISLYGGTMLEGAVGSIASAHAFSTFETLEFGTELFGPLLLTQSILKTPL
FT                   QYENFELVVPNTPGLGIEVDEDKLEQLRRH"
FT   CDS_pept        14281..14571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catC"
FT                   /product="muconolactone isomerase"
FT                   /function="conversion of muconolactone to ketoadipate
FT                   enol-lactone"
FT                   /db_xref="GOA:Q43932"
FT                   /db_xref="InterPro:IPR003464"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR026029"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q43932"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46431.1"
FT                   /translation="MLFQVRMDVHLPVSMPTDQANQIKSVEKAYSQELQRQGKWRHIWR
FT                   ITGQYSNISIFDVESNEELHTILQGLPLYPYMKIEVMALNRHPSSVRDDDS"
FT   CDS_pept        14661..15347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catI"
FT                   /product="beta-ketoadipate succinyl-CoA transferase
FT                   alpha-subunit"
FT                   /function="conversion of beta-ketoadipate to
FT                   beta-ketoadipyl CoA"
FT                   /db_xref="GOA:Q43973"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q43973"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46432.1"
FT                   /translation="MIDKSAATLTEALSQIHDGATILIGGFGTAGQPAELIDGLIELGR
FT                   KNLTIVSNNAGNGDYGLAKLLKTGAVKKIICSFPRQADSYVFDELYRAGKIELEIVPQG
FT                   NLACRIQAAGMGLGPIYTPTGFGTLLAEGKPTLNFDGKDYVLENPIKADFALIKAYKGD
FT                   RWGNLVYRKSARNFGPIMAMAANVTIAQVSEVVALGELDPENVVTPGIFVQHVVPVQST
FT                   PASAAP"
FT   CDS_pept        15358..16011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catJ"
FT                   /product="beta-ketoadipate succinyl-CoA transferase
FT                   beta-subunit"
FT                   /function="conversion of beta-ketoadipate to
FT                   beta-ketoadipyl CoA"
FT                   /db_xref="GOA:Q59091"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q59091"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46433.1"
FT                   /translation="MSYHKLTRDQIAQRVAQDIPEGSYVNLGIGLPTKIASYLPADKDV
FT                   FLHSENGLLAFGPPPAAGEEDPELINAGKEYVTMLEGGCFFHHGDSFAMMRGGHLDICV
FT                   LGAFQIAANGDLANWHTGAPDAIPSVGGAMDLAVGAKKVFVTTDHVTKKGEPKIVAELT
FT                   YPATGQKCVDRIYTDLCIIDVVPEGLKVIEKVEGLSFEELQRLTGATLIDATQG"
FT   CDS_pept        16024..17229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catF"
FT                   /product="beta-ketoadipyl CoA thiolase"
FT                   /function="thiolytic cleavage of beta-ketoadipyl CoA"
FT                   /db_xref="GOA:Q43935"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012793"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q43935"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46434.1"
FT                   /translation="MKHAYIVDAIRTPFGRYAGGLAAVRADDLGAIPIAALIERNPSVN
FT                   WAQVDDVIYGCANQAGEDNRNVGRMSALLAGLPVEVPATTVNRLCGSSLDAIAMAARAI
FT                   KAGEAHLIIAGGVESMSRAPYVMGKSEGAFGRTQKIEDTTMGWRFINPKLKAMYGVDTM
FT                   PQTAENVAEQFGIQREDQDQFAYTSQQRTAAAQAKGYFAKEIVPVTIPQRKGEPVVIAT
FT                   DEHPRASTTLEGLAKLKGVVKPEGSVTAGNASGINDGAAAVLIASDEAVAQYQLKARAK
FT                   IIASTTVGIEPRIMGFAPAPAIKKLLKQANLTLDQMDVIELNEAFAAQALACTRDLGLA
FT                   DDDARVNPNGGAIALGHPLGASGARLVTTALNQLEQSGGKYALCSMCIGVGQGIALIIE
FT                   RV"
FT   CDS_pept        17239..18042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="catD"
FT                   /product="beta-ketoadipate enol-lactone hydrolase"
FT                   /function="hydrolysis of beta-ketoadipate enol-lactone"
FT                   /db_xref="GOA:P00632"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P00632"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC46435.1"
FT                   /translation="MPVFHFKDTLTAQDVALNYATFGQADRPALIFSNSLGTNLSMWQQ
FT                   QIAYFQDKYFVICYDTRGHGASSTPVGPYRIDQLGTDVIALLDHLQIPQATFCGISMGG
FT                   LTGQWLAIHFPERFNQVIVANTAAKIGEAQAWQARAQLVREQGLTPIAQTAATRWFTPG
FT                   FIEDSPEIVEKLSHDLAQGSAEGYASCCEALAEADVRPQLQRISIPVLVIAGAQDPVTT
FT                   VADGQFLCEHIVHSTLEVLEASHISNVEQPQAFNHAVEAVMKRFN"
XX
SQ   Sequence 18158 BP; 4992 A; 3854 C; 4353 G; 4959 T; 0 other;
     atgtctagag aaattaatgt caatcagatg attgacgact caaagctcac gccgtttcat        60
     tggcgagtga ttatactcag taccctcatt attatttttg atggctacga tctggtaatt       120
     tacggggtgg cgctaccgct tctgatgaaa gagtgggcca ttgatccggt taccgcaggc       180
     tttattggca gtattgcatt gtttggtatg atgtttggtg ccctgatttt tggcaccatc       240
     gccgacaagc ttgaacattt gggtgtgagc cgtaaaaaag tcattgcggt ctgtattatt       300
     ttatttagct tgtgcacggt attgtgcggt ttttctgaaa ccaccacgca attttccata       360
     tttcgctttt tggcaggtgt aggcattggt ggtgtaatgc caaacgtaat tgcactggtc       420
     agtgagtacg caccgaaaaa atttaaaagt ttttttgtaa ccttgatgtt tagtggttat       480
     gccattggcg gcatgacggc agcttttctg gggtcgattt tagtgccgct ttatggctgg       540
     aaaatcatgt ttatgattgc cggaattcca ttggtgttgt tattgcctct catggaagtt       600
     ttgcctgaat cgattgacta tttggttcgc aaaaagaaag atgaaacggt tcgttttatt       660
     atgaccaaaa tggtgccgtc gtatcagtat cagcccgatc atgtttttgt actgaactca       720
     tcgaatcaaa atcaggcaca agcgccagtc aaaatgattt ttcaggaaca gcgtgcgttt       780
     agtacgatga tgttctggtg ctcaattttt atgacactga ttatggttta tgcactgggg       840
     aactggttgc caaaactgat gattgaagca ggttataacc tctcgaagag tctcattttc       900
     ttgttctctt taaacgtggg gggaatgatc ggctctattt tgggtggata tctggcggac       960
     cgctataacg tcaaatttgt gaccatgggc ttgttattgc tgggtgcgat ttcactgagt      1020
     ctgttgtctt tccagtttag cagtgtgatt ttgtatatct taattgcatg tgcgggcgca      1080
     gcctcaattg gtgctcaaat tatgctgctg gcctatatgg caaaatttta tgcgccaaat      1140
     gttcgctcta ctggaattgg ttgggggctt ggcatgggac gtgtcggcgc aattttaggg      1200
     ccaatcttga ctgggtggtt attgtctttg caactgccgc acttctataa ctttctggca      1260
     ctgagtattc ctgcggttct tggtattgtc acggtatttt taatcaatga cagacgtatg      1320
     tatcaacctg aaccgatcag cccgattgcc aatcaaaacg acaccactac ggtgaaagtg      1380
     aacgaagcag tctcgcatta atctaaaaaa ttataaaaac ccatcagcac ctcacagtct      1440
     gatgggtttt ttgttaccag tttggcggct cagtaaaacc ttcataggca tatatctggc      1500
     gaatcgtttc gtacaacgaa taaatataag tgctttcctc catattgcgc acggcaatat      1560
     agatgggcgt gatggcatcg ggatctagaa gcggcacata gctcagatta aaaagctgga      1620
     tactttgcgt actggccggt accaatgaaa ttccttcacc cgctgccacc aatccaagcg      1680
     ccagttgaac ttcacggact tcattaattt tggtgggttc taagccatga tcagaaaaga      1740
     tattcattac atgggtagaa aaattaggct taggcgagct tggataaagc aaaatttttt      1800
     catcaattaa atcatttaag tgcacgcctt tatctttcat ttgattaagc ggatggctgg      1860
     catgtacggc taccatcaaa cgttcattac gcaataagga acgtttaatg gcgggatcac      1920
     tgattttaag tcgaccaaat ccggcatcga tacggccttc ttttaatgct tcggtttgtg      1980
     ccttggtgcc catttcgtaa agttcaatgc gtaaattggg gtgtgcctga cgatacaaat      2040
     gaataatccg tggcagtaaa ccaaatagga gcgaacccac aaatccgata cgaatggttt      2100
     tttcaaccga ggcaatgcgc ttggtcatgg aaaccatttg atcgacattc gacaatagtt      2160
     tgatggcgta ctgataaaaa aagtgaccct caggtgttgt cttgaccggt ctgctgccgc      2220
     gctctaaaag ctgaatcccc aattcttctt caagattttg aatttgtcgg cttaagggcg      2280
     gctgtgcaat gcataatttg tctgcggctt tggtgaagct ttgctcctca accacagcca      2340
     caaaatagcg gagatgtcta agttccattt aaaaatactc cataggtatt ttattataca      2400
     aataatgtgt ttgaacttat taaaacattc ttttaaggta taaacaagca agaaagacaa      2460
     gaagaaggca ggggcttgac ccattaaatg ctttcttcaa tttggaaaat tgaaagctga      2520
     aatggatatt cgttttattt gtcggttctg ccgttaagta aacattttat gcgttgcgtt      2580
     gtttaattga atgtttgact aagcacagcg ttttgctctg gcctagacaa gtttcttatt      2640
     ttggaatgtt ggagaaagga tatgccacgt attcccgtca ttaatactag ccatcttgac      2700
     cgaattgatg aactgcttgt agacaatacc gaaacaggtg aatttaagtt acatcgttct      2760
     gtatttacag atcaggcact ttttgatctt gaaatgaaat acattttcga aggaaattgg      2820
     gtttatttgg ctcatgaaag ccagattccc aacaacaacg actattacac cacctatatt      2880
     ggcagacaac cgattttgat tgcgcgtaat cgcaacggtg aactcaacgc catgattaac      2940
     gcatgttcac atcgtggtgc acagctgtgc cgtcataagc gtggtaataa gaccacatat      3000
     acttgcccat ttcatggctg gaccttcaat aactcaggaa aattgttgaa ggtgaaagat      3060
     ccaagcgatg ctggttattc agattgtttt aatcaggacg gttcccacga cttaaaaaag      3120
     gtggcgcgtt ttgaaagtta taaaggtttt ttatttggca gtctgaatcc tgatgtaccg      3180
     tcactgcaag agtttttggg ggaaaccacc aaaattatcg acatgattgt cgggcaatcc      3240
     gatcagggcc ttgaagtact gcgtggtgtt tcgacctaca cctatgaagg aaactggaag      3300
     ttgaccgcag aaaacggagc agatggctat catgtttcgg cggtgcactg gaactatgca      3360
     gccaccacgc agcatcgtaa agaaaaacag gcaggtgata ccattcgcgc gatgagcgcg      3420
     ggctcgtggg ggaaacatgg tggcggttca tatggatttg aacatggtca tatgttgctc      3480
     tggacacaat ggggtaatcc ggaagaccga ccaaactttc ctaaagcagc ggaatatacc      3540
     gaaaaattcg gtgctgcaat gtcgaaatgg atgatcgaac gctcacgtaa cttgtgttta      3600
     tatccaaacg tgtacctgat ggatcagttt ggttcgcaaa ttcgtgtttt acgtccaatt      3660
     tcggtcaata aaaccgaagt caccatttac tgtattgcgc ctgtaggtga agcacccgaa      3720
     gcgcgtgcac gccgtattcg ccagtatgaa gatttcttta atgcatctgg aatggcgacg      3780
     ccagacgatc ttgaggagtt ccgtgcctgt caggctggtt atgcaggtat cgaactggaa      3840
     tggaacgaca tgtgccgcgg atcaaaacat tggatttatg gaccagatga tgccgctaat      3900
     gaaatcggat taaaaccggc tattagtggt attaaaactg aagacgaagg cttgtatttg      3960
     gcacagcatc aatactggct caaaagtatg aagcaagcga ttgctgcgga aaaagaattt      4020
     gcatcgcgtc agggagagaa cgcatgaatg ctacagcact tttagacacc atcagcatcg      4080
     aacagattag ccagtttttg tatagcgagg cccgtttttt agatgatgag caatgggatg      4140
     actggcttga atgttatgca cctcaagcct cattttggat gcccgcgtgg gacgataacg      4200
     accagctcac tgaaaacccc caaactgaga tttcgctgat ttattatcca gatcgccaag      4260
     gtcttgaaga tcgagtattt cggattaaaa ccgagcgttc atcggcgacc atgccagata      4320
     cgcgtacggc acacaatatt agcaatatcg aagttgaatc acgtgatggc cttcaaatca      4380
     cagtacgttt taactggaat acgctcagtt tccgctataa aaacagttac agctattttg      4440
     gcatgtcacg ctatgtaatc gatttctcag gtgaacaacc aaaaatcttg agcaagtatg      4500
     tgatgcttaa gaatgactat attaatcaag tcattgatat ttatcatatt taaatcagtt      4560
     atacctcagt caaacggaca cttgactgag ggtttatgag tttatatttg aataggattc      4620
     ctgccatgtc aaaccatcaa gtagcacttc aatttgaaga tggcgttacc cgttttatct      4680
     gcatcgctca aggtgaaacc ttatccgatg cagcataccg tcagcaaatc aatattccaa      4740
     tggactgccg tgaaggcgag tgtggtacct gccgtgcttt ttgtgaatcg ggcaactatg      4800
     acatgcctga agacaattac attgaagatg cactcacccc agaagaagcg cagcagggct      4860
     acgttttggc atgtcaatgc cgtccaactt cagatgctgt atttcaaatt caggcgtctt      4920
     ctgaggtatg taaaaccaag attcatcact ttgaaggcac gttggcgcgg gttgaaaatc      4980
     tatcggattc gaccatcacc tttgatattc agctcgatga cggtcagccc gatattcatt      5040
     ttctggcagg gcagtatgtc aacgtgacgc tgccgggcac cacggaaaca cgctcgtatt      5100
     cgtttagctc acaaccaggc aatcgcttaa ccgggttcgt ggttcgtaat gtgccgcaag      5160
     gtaaaatgag cgaatattta agtgtgcagg ccaaagcagg cgacaaaatg agctttactg      5220
     gaccatttgg tagtttttat ctgcgtgatg tcaagcgtcc tgtgctcatg ctggctggcg      5280
     gtacgggaat cgcaccgttt ttatcgatgt tgcaagtact tgagcaaaaa ggcagtgagc      5340
     atccagtacg actggtgttt ggcgtaaccc aagattgtga tctggtggcg cttgaacaac      5400
     tcgatgcact tcagcagaaa ctaccatggt ttgaatatcg taccgtggtg gcacatgcag      5460
     aaagtcaaca tgaacgtaaa ggttacgtga cgggtcatat cgaatatgac tggctaaatg      5520
     gcggtgaagt tgatgtgtat ctgtgcggac cggttcctat ggtggaagcg gtgcggagct      5580
     ggctggatac gcaaggtatt caaccggcga actttttatt tgaaaaattc tctgccaact      5640
     aactcaaaac ggagaccgat atgaattcga cacaacgttt tgaacataaa gttgtcattg      5700
     taacaggtgc agctcaaggc attggtcgtg gtgttgcact acggattgcc caagagggag      5760
     ggtgtctgat attggccgac cgttctgatc tgattcaggc ggtattggct gagatcaaag      5820
     ccttgggcgc attggcaatt gctgttgaga cagatttgga aacttatgct ggcgcagagt      5880
     tggtggtatc acatgcaatt gccgaatacg gacgcatcga cgtgctgatc aataatgtcg      5940
     gtggtgcaat ctggatgaaa ccctttcagg agttttcaga agaggaaatt attcaggagg      6000
     ttcatcgctc cctatttcca gcgctctggt gctgccgtgc agtacttcca gaaatgctaa      6060
     aacatcaaca gggcactatt gtaaatgtgt cgtcaattgc gacacgaggt attcaccgaa      6120
     ttccatattc ggcttgtaaa ggcggtgtaa atgccttaac ggcttcactt gcctttgagc      6180
     atgcccagca tggtattcgt gtgaatgcgg ttgcaacggg aggaactaaa gcaccgccgc      6240
     gtaagattcc acgtaatgcc cagcctttat cgaaaagtga acaagtctgg atgcaacaag      6300
     tggttgacca aaccattgat cgaagctttt tagggcgtta tggcagtatt gatgaacaag      6360
     tcaatgcgat taccttttta gcctcagatg aatcttctta catcacgggc agcgtgcttc      6420
     cggtgggtgg aggcgatcag ggatgatctg atggtcatta tttaaaggga gactgcaagg      6480
     aggcatcatg acaaccctgt taaaaacatt gaagcaagat tggtcgttat cggccacgat      6540
     tgcaggcttt ttagcggtcc tgatttcata ctcgggcccg ttaattatct tctttcaggc      6600
     ggcacaaaaa gcacatgtct cgacagagat gatgatctct tggatttggg ctatttcgat      6660
     cggtgccgcc gtgacaggta tttttttatc tattcggttt aaaacacctg tagtgaccgc      6720
     gtggtcggca cccgggacag cattgttggt tactttgttt cccaacatta gtttaaatga      6780
     agccgttgcc gcttatatta ccgcggcaat tgtgattttt ctggtcggca ttaccggcta      6840
     ttttgacaaa ctactcaaat ggataccgca gggaattgct gctggcatga tggccggcat      6900
     tttattccag tttggtcttg ggctatttct tgccaccgat actttaccgc tgatcgtgtt      6960
     tagcatgttg ctgtgttatc tgatcagtcg acgcttttca ccacgttact gcatgctttg      7020
     ggtacttatt tgtggtgtag cgtttagttt ttttcttgga aaaatgaatc cggtgccgct      7080
     agattttcaa attgcacgcc cgcagtttat tgcaccagag tggtcatggt tttcaacctt      7140
     aaatttggcg ctgccgctaa ttttggtgag cttaacaggg cagtttctgc ctggtatggc      7200
     cattttaaaa ctcagtgggt ataacacacc cgccaaacca attattgccg ccgcaagctt      7260
     ggcctcgttg tttgctgcct ttgcaggtgg aattaccatt gtactggcct ccattacagc      7320
     caccttatgt atgggtaaag atgcacatga actcaaagac aaacgctata ttgctggaat      7380
     agcaaatggt ttgttttatg ttttaggagg tgtgtttgca ggcagtattg tagcgttgtt      7440
     tagcttattg cccaaagagc tggttgctgc actggccgga cttgcgcttt tgggtgcaat      7500
     agcaagcaat attaaaattg ccatgcaaga agatcagcaa cgagatcctg cactgattac      7560
     ctttttggca accgtttcgg gaatgcattt cttgggcttg agttcagtgt tttgggggat      7620
     gtgtattggc atgctggcct attttatttt acttaaaccc aaagccagct aaactaaatt      7680
     tgtcatttag accattcgat tatttctatc atattcgctt tattctaagg cgaattttgt      7740
     tttttaagag atgacatatc actcagctta atttgtttct atttcattcc tgttgaaacc      7800
     acgataggtt tgagtagttc aatgcatgac aattttttaa ctcctgaata ttccttttat      7860
     gaaggtattt agcgatatct gctcgaccat agtaatgatc acattatgag ctaaatttac      7920
     tttttaaaat ttaaatatat tatatatatt tgaattttat tgttttattt taatttttag      7980
     cttagaagtt tttattaaga tttattttta aattagatgt cgaaaaaatt agtataccaa      8040
     aaaagcatga aaacatactc tcttaggaat tggagtcgcc atgagtttca gatacagttg      8100
     atcagtatgg aaggtataga aacgactatc gaaataaata agtttgtggt gtgtgaagca      8160
     aggtaaagct caaggctgag gcaaaccaag caaaggttaa ttgaaccgat atgcacaaca      8220
     cattcaacga tagcgtcgac agataagttt atcaaatgat gttttggcga tttcaaggag      8280
     aaagccatgg aagttaaaat attcaatact caggatgtgc aagatttttt acgtgttgca      8340
     agcggacttg agcaagaagg tggcaatccg cgtgtaaagc agatcatcca tcgtgtgctt      8400
     tcagatttat ataaagccat tgaagatttg aatatcactt cagatgaata ctgggcaggt      8460
     gtggcatatt taaatcagct aggtgccaat caagaagctg gtttactctc gccaggcttg      8520
     ggttttgacc attacctcga tatgcgtatg gatgccgaag atgccgcact aggtattgaa      8580
     aatgcgacac cacgtaccat tgaaggcccg ctatacgtgg caggtgcgcc tgaatcggta      8640
     ggttatgcgc gcatggatga cggaagtgat ccaaatggtc ataccctgat tctacatggc      8700
     acgatctttg atgcagatgg aaaaccttta cccaatgcca aagttgaaat ctggcatgcc      8760
     aataccaaag gcttttattc acacttcgac ccaacaggcg agcagcaggc gttcaatatg      8820
     cgccgtagta ttattaccga tgaaaacggt cagtatcgcg ttcgtaccat tttgcctgcg      8880
     ggttatggtt gcccaccaga aggtccaacg caacagttgc tgaatcagtt gggccgtcat      8940
     ggtaaccgcc ctgcgcacat tcactatttt gtttctgccg atggacaccg caaactaact      9000
     acgcaaatta atgtggctgg cgatccgtac acctatgacg actttgctta tgcaacccgt      9060
     gaaggcttgg tggttgatgc agtggaacac accgatcctg aagccattaa ggccaatgat      9120
     gttgaaggcc cattcgctga aatggttttc gatctaaaat tgacgcgttt ggttgatggt      9180
     gtagataacc aagttgttga tcgtccacgt ctagcggtgt aatacaccaa aatggttcaa      9240
     aattatcagg cgagtgatca tgatcactgg cctgttttta tttcagggaa gggtggagac      9300
     aattacgtgg acaatcaaat cattcaggaa accgtagata aaattttaag cgtattgccg      9360
     aatcaggctg ggcaattggc acgcttggtt cgtctgatgc agtttgcttg tgaccccacc      9420
     attaccgtca ttggtaaata taatcatggt aaaagccgac tactcaatga gctgatcggg      9480
     acagatattt tttctgttgc cgataaacga gagacgattc aactggccga acataaacaa      9540
     gatcaggtgc gttggttgga tgcacccgga ctcgatgcag atgttgcggc agtggatgat      9600
     cgtcatgctt ttgaagcagt ctggacacag gcagatattc gcctttttgt gcattcagtc      9660
     cgagaaggcg aactcgatgc aactgagcat catcttttac aacaacttat tgaagatgca      9720
     gaccatagcc ggcgccaaac catactggtc ttgacccaga tagatcagat accggatcag      9780
     acaattttaa cccagattaa aacctcaatt gcacagcagg tacccaaact cgatatttgg      9840
     gctgtttcgg ccactcgcca ccgtcagggt attgaaaatg gaaaaacctt gctgatcgaa      9900
     aaaagtggaa tcggcgcgtt acgacataca cttgagcagg cacttgctca ggttccatct      9960
     gcacgaacgt atgaaaagaa tagattgctg tctgacttgc atcatcaact taagcagtta     10020
     ttactcgatc aaaaacatgt acttcagcaa ctacaacaga cacagcagca gcaattgcat     10080
     gactttgata caggactcat caacatactc gataagattc gagtagatct tgagcccatt     10140
     gtaaatatag atggtcaaga ccaagcactc aatccagatt catttgccac gatgtttaaa     10200
     aatacagcag ccaagcagca acgtgccaaa gtgcagattg cttactcacg tgcctgtatc     10260
     gagatcaata gccatctcat acgtcacggt gtggtgggtt tacccgcaga gcaacaaacc     10320
     acgataaaaa gtattgatac ggtcattgtt gcggtttttg gaatttcagt gaaatttcgc     10380
     gatcagctac gtgcattgtt ttataccgat accgaacgac aacgcttgca aagagagttt     10440
     cgattttatt ttgaaaagtc agcaggccga atgattttag ctgccaagat tgagcagaca     10500
     atgcggcagc aagggtgtat tcaaaatgca atgatggcgt tgcaacagat ggagagtgca     10560
     gcatgaccag cggcggacac attcaattgt ttatcgaaca cacccggcag attgcgactg     10620
     cccaagggga tatacagttg gcattgcaat cgatgcagca atggcgcgaa gcatttgcta     10680
     cagcattaaa acaaaatacc tttgatttaa cgggctggtc accgcagaca aagatcgcca     10740
     atcaactcaa gcaatttaac cataagctta caacgcatgt atcgaattgg gataccgaat     10800
     ggcatacttt tagtgctgct caatcggttg cagaagtatt tcatgatcgg gtgatgttgc     10860
     ttgtattcgg taagtttaat gccggaaaga gttcattgtg taacttactg gccgaatgct     10920
     ttcgttctca cgaacaaacc gtgcaatatt ttcatgttca aaatgaacag atattttata     10980
     ccgaatctca cttacgcgaa ggtgcaaccg agacgacagc gcaactacag ggcgtatgtc     11040
     tgggtgaaaa acttattttg ctagatacac caggtttgca ttctggtact cagaaaaatg     11100
     cagcgctcac acaaaaattt atcgacagtg cagatggtgt gctgtggctc agtagcgcaa     11160
     cttcaccggg tcaggtgcaa gagctagatg cactggggcg cgagttaaag cgtcataaac     11220
     ctttatttcc tgttattacc cgaagcgatt ttgtcgaaga agatgaaatt gatggtgagc     11280
     tatgtacagt gctttgcaat aaaaattcag aacaacgtgc gttgcaagag tctgatgtat     11340
     tgatgcgtgc gaaagaaaaa ctgcacagta tgcaagtgga tgtgagttta ttaaagccgc     11400
     ccgtgtccgt ttcaactcaa atggcgcgtg aagcagatat gaacccacaa gccatgaacg     11460
     aggctggttt tgagcgatta tttgcagcac ttttgctctt attgagcctg ctttgcgcta     11520
     taagcagcgt aaacctgccg aagtattgtt gcattttttg caagaacata tcattgaagg     11580
     tttaaggttt tacctgcaac ccgatctaga gcaaatacaa caggacctca aacaggctca     11640
     agatgattta cgacagctac acaccgattt agccgaggca gtctggcgta cgtattgcct     11700
     gagctaccac aacttcttga gcaacatgca agtacacaaa atattgatgc cgtagtgaac     11760
     agtttgaacg agtggataaa cgtcgcattc gaacaacagc ttgcaattca gcttgatgct     11820
     tatggtttaa atttggattc gcttagcaag atcgaaaaaa ccgaaaaaat gcagtatgaa     11880
     cgcattgcgg aatggtggtg catgatggct tgtacacgac tctcacgcag cagattcaac     11940
     aagctgtcaa agcttctacg agtgaattga ttgatcagtg tcaggctcaa cttgagcagt     12000
     caatcaaaca tgttcaaaca ctcgatgaaa ccttcatcga ttacagcgca gcactcgatc     12060
     aactcagcca agcgctacgc attgaataaa gagcagtaaa tttttcagac atattttatt     12120
     cgatgagtgg cctgatatgg tgcgttgcaa acacctcctg tacacaggcg agaattttag     12180
     gaatgtaatt actgtggtcc atatttcgca ccgcgagtga aattgggcta taggcatcat     12240
     catctaaaat tggaatataa agtagattct tcaccccaat atccatggca gacgccggta     12300
     cgatgcagac gccttcacct gctgccacca agccgagtgc cagttgaatt tctcgaattt     12360
     cggtgagttt ggatggtact aggcctagtt cggtaaagag tgactgaata aaggtcgcaa     12420
     aattgggctt ttgagagact gggtacagca gcatcggttc atcaataatt tgagagagat     12480
     gaacccctgt tgctgcaaac tgattgaggt gatgatgctt atggattgca agtttgagct     12540
     gttctttatg caacacgata cgtcgaattg caggatcggt aattttgagc cgaccaaaac     12600
     ccagatcgat ttttccctgc ttaagggcat taatttgatc tttggtgccg cattcgatga     12660
     gttcgatgtg aatttcagga ttttgttgac gaaacagata aataatttca ggtaacaaac     12720
     catacagtaa ggagctgacg taaccaattc tcaaggtttg actgaccgtt gcaatccgtt     12780
     ttgccattga ggacgcttgt gcagtatgag tcaaaatctg cacagcatgc tgataaaaaa     12840
     acatgcctgc ttcagtcact ttagccggtc tgaagccgcg ttcaaatagc tgaattccca     12900
     attcttcttc gagtttttga atttgtcggc tgaggggcgg ctgggcaata cacaactttt     12960
     cagcagcttt ggaaatgctt tgctcttcaa ccacggtcac aaaatatctg aggtgtctta     13020
     gttccattta tacgccctaa ttggttttat ataccttttt agtatgcaaa aataccaaat     13080
     tgtttatctt ttttattatt acattaattt aaggtatgta aatagtattt attgaaaaga     13140
     agatggaccg atgtataaat cagtggaaac tattttagtc gatattccaa ctattcgtcc     13200
     gcacaagctt tcggtcacca cgatgcagac gcagacatta gttttgatca aaatcatcac     13260
     ggaagatggc attgtaggct ggggcgaagc aaccacgatt ggtggattaa actatggcga     13320
     agaaagtcca gagagtgtta aagccaatat cgacacctat ttcaagccat tgctgttgtc     13380
     catcaaggcg cctttaaatg tggctcagac cctaaaatta attcgtaaaa gtatcaatgg     13440
     caaccgcttt gccaaatgcg caattcaaac tgcgctttta gagatacagg ctaaacgact     13500
     gaatgtacct gtgagcgaat tgctgggtgg acgtatccgt gatcgattac ctgtgctgtg     13560
     gacactggct tcaggtgata ccgataaaga tattgccgaa gccaaaaaaa tgatcgaatt     13620
     aaagcgccac aataccttta aattaaaaat tggttcaaat ccgctacagc atgatgtcga     13680
     tcatgtaatt gccattaaaa aagcacttgg cccggaaatc agtgtgcgtg tagatgtgaa     13740
     ccgtgcatgg tctgagcttg aatgtgttaa agggattcaa cagcttcaag atggtgggat     13800
     cgatctgatt gagcagccct gtgcgattga aaatacagat gctttagcac gtctgaccgc     13860
     acgttttgat gtggccatta tggcagatga ggtcttgact ggcccagaca gtgcctatcg     13920
     aattgccaaa aaatcgggtg ccgatgtgtt tgcagtaaaa gtcgaacaat cgggtggtct     13980
     gattgaagcc tgtgaagtgg caaaaattgc gcgtcttgct ggaatcagtc tatatggtgg     14040
     caccatgctt gaaggcgctg tcggcagtat tgcatcggca catgccttta gtacctttga     14100
     aacactggag tttggaactg aactgttcgg gcctttatta ctaacacaaa gcattttgaa     14160
     aacacctttg caatatgaaa acttcgagct ggtggttccc aatacgccag gtctgggaat     14220
     tgaggtcgac gaagacaaac tcgaacagtt acgccgtcat taaggaagag gaaatttact     14280
     atgttgtttc aagttcgtat ggatgtgcat ttacctgtta gcatgcctac tgatcaggcc     14340
     aatcagatta aatcggtcga gaaggcttat tcacaagagt tgcaacgcca aggcaaatgg     14400
     cgtcatatct ggcgtattac cggacaatat tccaatatca gtatttttga tgtcgaaagt     14460
     aatgaagagc tacatacgat tttacaaggc ttaccgctat atccgtatat gaaaatcgaa     14520
     gtcatggcgc tcaatcgtca tccgtcttct gtgcgtgatg acgatagcta atatgtaaat     14580
     agagatgaca cttcatcagt gttcatctct tacgtttatg gtatttcttt attttccgtt     14640
     ttcatccaaa ggttgatgac atgatagata aaagtgcagc gaccctaacg gaagcgctct     14700
     cccagatcca cgacggtgcc accatcctga ttggtggttt tggaacagcc ggccaacccg     14760
     ccgagctgat tgacggactg attgaactag gtcgcaagaa cctgaccatc gtcagcaaca     14820
     acgccggcaa tggagactat ggactggcca agctgctaaa aactggcgca gttaaaaaga     14880
     tcatctgttc cttcccacgt caggccgact cctacgtatt tgacgagcta taccgtgcgg     14940
     gcaaaattga acttgaaatc gtgccgcagg gcaatctggc ctgtcgtata caggccgccg     15000
     gcatggggct ggggccgatc tacaccccaa ccggttttgg cactttactc gcagaaggta     15060
     aacctaccct gaactttgat ggcaaagact acgtactgga aaacccgatc aaggccgact     15120
     ttgccctgat caaagcctac aagggcgacc gctggggcaa tctggtctat cgcaaatcag     15180
     cacgaaactt cggcccgatc atggccatgg ccgccaacgt gaccatcgca caagtgagcg     15240
     aagtggtggc actaggagaa ctcgacccgg aaaacgtggt gaccccaggc atctttgttc     15300
     aacacgttgt accagtccaa tctaccccag caagcgctgc accataagga gatcgagatg     15360
     agttatcaca aactgacccg tgaccagatc gcccagcgcg ttgcccaaga cattccggaa     15420
     ggctcctatg tcaatcttgg cattggcctg ccgaccaaga ttgccagcta tctgcctgcc     15480
     gacaaagacg tatttctaca ttcagaaaac ggactgctgg cctttggccc accaccagcg     15540
     gccggcgaag aagatccgga actgatcaac gcaggcaaag aatacgtaac catgctcgaa     15600
     ggcggttgct tctttcacca tggcgactcc ttcgccatga tgcgcggtgg acatctggat     15660
     atctgcgtat taggcgcatt ccagatcgcc gccaatggag acctggccaa ctggcacacc     15720
     ggtgcaccgg atgccatacc gtcggtcggt ggagccatgg atcttgcggt tggggcaaaa     15780
     aaagtttttg taaccaccga tcatgtcacc aaaaaaggtg agccgaagat tgtagctgaa     15840
     ctgacgtatc cagccacggg tcagaaatgt gtcgaccgga tctacaccga cctgtgcatc     15900
     atcgatgtgg tgccagaagg actgaaagtg atcgagaaag tcgaaggctt aagctttgaa     15960
     gaactacaac gcctgaccgg tgcaacactg atcgatgcga cacaaggcta aggataaccg     16020
     aatatgaaac atgcatacat cgtcgatgcg atccgtaccc catttggccg ctatgcaggc     16080
     ggattggcag cagtacgtgc ggatgatctc ggcgcaatcc cgattgctgc cctgatcgaa     16140
     cgcaacccaa gcgtgaactg ggcacaggtc gatgacgtga tctacggctg tgccaatcag     16200
     gcaggagaag acaaccgtaa cgttggccgt atgtcggcac tgctggcagg tctaccggtc     16260
     gaagtgccgg caacgacggt caaccgcctg tgtggctcat ctctggatgc aatcgccatg     16320
     gcagcacgtg cgatcaaagc aggcgaagcc catctgatca ttgcaggggg tgtcgaaagc     16380
     atgagccgcg caccgtatgt gatggggaaa tcagaagggg cgtttggacg cacccagaag     16440
     atagaagaca ccaccatggg ctggcgcttc atcaatccga agcttaaagc catgtatggt     16500
     gtggatacca tgccgcaaac cgcagaaaat gtggccgagc agtttggcat ccagcgtgaa     16560
     gaccaagacc agtttgccta caccagccag caacgcaccg cggcggcaca ggccaaaggc     16620
     tactttgcaa aagaaatcgt gcctgtcacg attccacagc gcaaaggaga gccggtggtg     16680
     atcgccaccg atgagcatcc acgtgcctca actacactag agggactggc caagctaaaa     16740
     ggcgtggtca agccggaagg cagcgtgaca gcgggcaatg cgtcaggcat caacgacggt     16800
     gcagcagcag ttctgattgc atcagacgaa gcggttgcac aataccagct taaagcacgc     16860
     gccaagatca ttgcctccac cacggtgggc atcgagccgc gcatcatggg ctttgcaccg     16920
     gcaccagcga tcaaaaagct actcaagcag gccaatctga cgcttgatca gatggatgtg     16980
     attgagctga acgaagcctt tgctgcacag gcactggcct gtacccgaga cttagggctg     17040
     gcagatgacg atgcacgggt gaatccgaat ggcggtgcaa ttgcactggg tcatccattg     17100
     ggtgcatctg gtgcgcgtct ggtgacgacg gctttaaacc agcttgaaca gtcgggcggt     17160
     aagtatgcgc tgtgttcgat gtgtatcggc gtaggtcagg ggattgcgct cattattgag     17220
     cgggtttaag gaataaatat gccagtattt cactttaaag acacactaac ggcgcaggat     17280
     gttgctctca attatgcaac attcggtcag gcggatcgtc ctgcactgat cttttcaaat     17340
     tcgttgggta ccaacctgag tatgtggcaa caacagatag cgtattttca ggacaagtat     17400
     tttgtcattt gctacgacac gcgtggtcat ggtgcatcat cgacacctgt tggcccttat     17460
     cggattgatc agctaggtac cgatgtaatt gcattgcttg atcatttgca aattcctcaa     17520
     gctacgtttt gtggaatttc gatgggtggt ttaaccggac aatggctggc aatacatttt     17580
     cctgagcgtt ttaatcaggt gattgtagcc aacaccgcag caaaaattgg agaagctcaa     17640
     gcttggcaag cacgtgcgca attggtgcgt gagcaagggt taacgccgat tgcccaaact     17700
     gcggcaacac gctggtttac gccaggcttt attgaagact caccagaaat tgtagaaaag     17760
     ctgagtcatg atttagctca aggtagtgcc gaaggctatg ccagttgctg tgaagcattg     17820
     gcagaggccg atgtgcgccc tcaactgcaa cgtataagca taccggtact ggtgattgct     17880
     ggtgcacaag atccagtgac tacagtggcc gatggtcagt ttttatgtga gcacattgta     17940
     cattcaacac ttgaagtgct ggaggcatcg catatttcga atgtggaaca gccacaggca     18000
     tttaatcatg cagtcgaagc agtaatgaag cgcttcaatt gatttgatct ttttgacaga     18060
     tagagatttt aaacctttat ctatgaattt tcaaaacgcc acgcgttcat gcacgtggcc     18120
     tttttttgta tatagcaatc cgaccataca ttgaattc                             18158
//

If you have problems or comments...

PBIL Back to PBIL home page