(data stored in ACNUC23059 zone)

EMBL: AF011644

ID   AF011644; SV 1; linear; mRNA; STD; MUS; 981 BP.
XX
AC   AF011644;
XX
DT   15-AUG-1997 (Rel. 52, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus oral tumor suppressor homolog (Doc-1) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-981
RX   DOI; 10.1074/jbc.273.12.6704.
RX   PUBMED; 9506968.
RA   Tsuji T., Duh F.M., Latif F., Popescu N.C., Zimonjic D.B., McBride J.,
RA   Matsuo K., Ohyama H., Todd R., Nagata E., Terakado N., Sasaki A.,
RA   Matsumura T., Lerman M.I., Wong D.T.W.;
RT   "Cloning, mapping, expression, function, and mutation analyses of the human
RT   ortholog of the hamster putative tumor suppressor gene Doc-1";
RL   J Biol Chem 273(12):6704-6709(1998).
XX
RN   [2]
RP   1-981
RA   Wong D.T.W., Tsuji T., Todd R., McBride J.;
RT   ;
RL   Submitted (30-JUN-1997) to the INSDC.
RL   Oral Medicine and Diagnostic Sciences, Harvard School of Dental Medicine,
RL   188 Longwood Avenue, Boston, MA 02115, USA
XX
DR   MD5; dcf87a90e70b536636fdcd53372b2e36.
DR   Ensembl-Gn; ENSMUSG00000029394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078154; mus_musculus.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030522; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030563; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028909; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000031341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104959; mus_musculus.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0074898; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074064; mus_musculus_pwkphj.
DR   EuropePMC; PMC58517; 11535822.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..981
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="NIH3T3"
FT                   /cell_type="fibroblast"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..331
FT                   /codon_start=2
FT                   /gene="Doc-1"
FT                   /product="oral tumor suppressor homolog"
FT                   /note="similar to Mesocricetus auratus doc-1 encoded by
FT                   GenBank Accession Number U10249"
FT                   /db_xref="GOA:O35207"
FT                   /db_xref="InterPro:IPR017266"
FT                   /db_xref="MGI:MGI:1202069"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35207"
FT                   /protein_id="AAB65752.1"
FT                   /translation="NLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQ
FT                   GTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETE
FT                   RNARS"
XX
SQ   Sequence 981 BP; 247 A; 264 C; 228 G; 242 T; 0 other;
     gaacttgacc gcgcacatgc ccgccgccgc cctcaacgcc ggaagtgtcc actcaccctc        60
     tactagcatg gcgacctcct cccaatatcg ccagctgctg agtgactatg ggcctccatc       120
     gctaggctac acccagggaa ctggaaatag ccaggtgcct cagagtaaat atgcagagct       180
     gctggccatc attgaagagt tggggaaaga gatcagaccg acgtatgcag ggagcaagag       240
     cgccatggag aggctaaaac gaggcatcat tcatgcccgg agcctggttc gggagtgctt       300
     ggctgaaacg gaacggaatg ccaggtccta gcccctggct ggtctgaagg cccatctcac       360
     taccccgtgg agatgagagg ctttgtgcaa aatggcagtc atttttctac cacagtcatt       420
     aagctctgaa cccacactca aaagattggg aggacatttt gcagtaactg acggatgtgc       480
     attttaagta gttaggaatg acccagctct ttttttcttt ccaaacattt gaaagatgtt       540
     tgtgaagcca cttcacagca agctattgtt tgtccccaaa taccagtgtc ccctctaacc       600
     tgcctttgga tacgcatcac cccagctgac ttcctttccc tgagctcacc tgcctccgag       660
     gagttgagtg caaaccacag cgcctttgct cagtagctgg cccgcctgtg tacagtgtag       720
     accctgcttc atggagcttc tctgcctaag cgtttgcatg actgagtgct tggaagtcaa       780
     tctttaaaat gcacaggtta cacatgcaga agaaagagcc atctacccaa cctcccaagc       840
     accctgcaga tgtccatcct gaggctgtag atctcagttc tgtgtttact gtgagcccat       900
     cacaacatct ggaagaaaac gactgaaact gttgcatctt tgtatttatt acttgatgta       960
     ataaagctta ttttcattaa c                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page