(data stored in ACNUC8465 zone)

EMBL: AF022112

ID   AF022112; SV 1; linear; mRNA; STD; MUS; 1032 BP.
XX
AC   AF022112;
XX
DT   06-MAY-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mitogen-activated protein kinase kinase 7 (MKK7) mRNA, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1032
RX   DOI; 10.1074/jbc.273.15.9344.
RX   PUBMED; 9535930.
RA   Foltz I.N., Gerl R.E., Wieler J.S., Luckach M., Salmon R.A., Schrader J.W.;
RT   "Human mitogen-activated protein kinase kinase 7 (MKK7) is a highly
RT   conserved c-Jun N-terminal kinase/stress-activated protein kinase
RT   (JNK/SAPK) activated by environmental stresses and physiological stimuli";
RL   J Biol Chem 273(15):9344-9351(1998).
XX
RN   [2]
RP   1-1032
RA   Foltz I.N., Schrader J.W.;
RT   ;
RL   Submitted (29-AUG-1997) to the INSDC.
RL   Biomedical Research Centre, 2222 Health Sciences Mall, Vancouver, BC V6T
RL   1Z3, Canada
XX
DR   MD5; c2c4c0f637f1032a48575c6215933fe8.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1032
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="Ba/F3 (IL-3 dependent pro-B cell line)"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        148..>1032
FT                   /codon_start=1
FT                   /gene="MKK7"
FT                   /product="mitogen-activated protein kinase kinase 7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAC16274.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQL
FT                   PLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
FT                   YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRI
FT                   LMDLDVVLKSHDCPYIVQCFGTFITNTDVFIVMELMGTCAEKLKKRMQGPIPERILGKM
FT                   TVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCA
FT                   AYMAPERIDPPDPT"
XX
SQ   Sequence 1032 BP; 238 A; 293 C; 317 G; 184 T; 0 other;
     gcacgcgagg cagggcgggc acgcgctggg gtggtctagg caggacggcg gctcggcggg        60
     gtcatccgag cgcaggcgca gtgcggtgtt tgtctacccc ggactgacgg gtggcctggc       120
     ggtgacggcg gcaggcgggc ggggaagatg gcggcgtcct ccctggagca gaagctgtcc       180
     cgcctggaag ccaagctgaa gcaggagaac cgtgaggccc gcaggaggat cgacctcaac       240
     ttggatatca gcccacagcg gcccaggccc accctgcaac tcccactggc caacgatggg       300
     ggcagccgct caccatcctc agagagctcc ccacagcacc ctacaccccc cacccggccc       360
     cgccacatgc tggggctccc atcaaccttg ttcacaccgc gcagtatgga gagcatcgag       420
     attgaccaga agctgcagga gatcatgaag cagacagggt acctgactat cgggggccag       480
     cgttatcagg cagaaatcaa tgacttggag aacttgggtg agatgggcag tggtacctgt       540
     ggtcaggtgt ggaagatgcg gttccggaag acaggccaca tcattgctgt taagcaaatg       600
     cggcgctctg ggaacaagga agagaataag cgcattttga tggacctgga tgtagtactc       660
     aagagccatg actgccctta catcgttcag tgctttggca ctttcatcac caacacagac       720
     gtctttattg tcatggagct catgggcaca tgtgcagaga agctgaagaa acgaatgcag       780
     ggccccattc cagagcgaat cctgggcaag atgactgtgg cgattgtgaa agcactgtac       840
     tatctgaagg agaagcatgg cgtcatccat cgcgatgtca aaccctccaa catcctgcta       900
     gatgagcggg gccagatcaa gctctgtgac tttggcatca gtggccgcct tgttgactcc       960
     aaagccaaaa cacggagtgc tggctgtgct gcctatatgg ctcccgagcg catcgaccct      1020
     ccagatccca cc                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page