(data stored in ACNUC8465 zone)

EMBL: AF022113

ID   AF022113; SV 1; linear; mRNA; STD; MUS; 1080 BP.
XX
AC   AF022113;
XX
DT   06-MAY-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mitogen-activated protein kinase kinase 7c (MKK7c) mRNA,
DE   partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1080
RX   DOI; 10.1074/jbc.273.15.9344.
RX   PUBMED; 9535930.
RA   Foltz I.N., Gerl R.E., Wieler J.S., Luckach M., Salmon R.A., Schrader J.W.;
RT   "Human mitogen-activated protein kinase kinase 7 (MKK7) is a highly
RT   conserved c-Jun N-terminal kinase/stress-activated protein kinase
RT   (JNK/SAPK) activated by environmental stresses and physiological stimuli";
RL   J Biol Chem 273(15):9344-9351(1998).
XX
RN   [2]
RP   1-1080
RA   Foltz I.N., Schrader J.W.;
RT   ;
RL   Submitted (29-AUG-1997) to the INSDC.
RL   Biomedical Research Centre, 2222 Health Sciences Mall, Vancouver, BC V6T
RL   1Z3, Canada
XX
DR   MD5; ac0bf5d444fc502aa51a472481c1f2b2.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1080
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        148..>1080
FT                   /codon_start=1
FT                   /gene="MKK7c"
FT                   /product="mitogen-activated protein kinase kinase 7c"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAC16275.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVI
FT                   TLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSME
FT                   SIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIA
FT                   VKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIVMELMGTCAEKL
FT                   KKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGIS
FT                   GRLVDSKAKTRSAGCAAYMAPERIDPPDPT"
XX
SQ   Sequence 1080 BP; 246 A; 311 C; 327 G; 196 T; 0 other;
     gcacgcgagg cagggcgggc acgcgctggg gtggtctagg caggacggcg gctcggcggg        60
     gtcatccgag cgcaggcgca gtgcggtgtt tgtctacccc ggactgacgg gtggcctggc       120
     ggtgacggcg gcaggcgggc ggggaagatg gcggcgtcct ccctggagca gaagctgtcc       180
     cgcctggaag ccaagctgaa gcaggagaac cgtgaggccc gcaggaggat cgacctcaac       240
     ttggatatca gcccacagcg gcccaggccc attattgtga tcactctaag ccctgctcct       300
     gccccgtccc agcgagcagc cctgcaactc ccactggcca acgatggggg cagccgctca       360
     ccatcctcag agagctcccc acagcaccct acacccccca cccggccccg ccacatgctg       420
     gggctcccat caaccttgtt cacaccgcgc agtatggaga gcatcgagat tgaccagaag       480
     ctgcaggaga tcatgaagca gacagggtac ctgactatcg ggggccagcg ttatcaggca       540
     gaaatcaatg acttggagaa cttgggtgag atgggcagtg gtacctgtgg tcaggtgtgg       600
     aagatgcggt tccggaagac aggccacatc attgctgtta agcaaatgcg gcgctctggg       660
     aacaaggaag agaataagcg cattttgatg gacctggatg tagtactcaa gagccatgac       720
     tgcccttaca tcgttcagtg ctttggcact ttcatcacca acacagacgt ctttattgtc       780
     atggagctca tgggcacatg tgcagagaag ctgaagaaac gaatgcaggg ccccattcca       840
     gagcgaatcc tgggcaagat gactgtggcg attgtgaaag cactgtacta tctgaaggag       900
     aagcatggcg tcatccatcg cgatgtcaaa ccctccaaca tcctgctaga tgagcggggc       960
     cagatcaagc tctgtgactt tggcatcagt ggccgccttg ttgactccaa agccaaaaca      1020
     cggagtgctg gctgtgctgc ctatatggct cccgagcgca tcgaccctcc agatcccacc      1080
//

If you have problems or comments...

PBIL Back to PBIL home page