(data stored in ACNUC1829 zone)

EMBL: AF022813

ID   AF022813; SV 1; linear; mRNA; STD; HUM; 1358 BP.
XX
AC   AF022813;
XX
DT   18-NOV-1997 (Rel. 53, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens tetraspan (NAG-2) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1358
RX   DOI; 10.1074/jbc.272.46.29181.
RX   PUBMED; 9360996.
RA   Tachibana I., Bodorova J., Berditchevski F., Zutter M.M., Hemler M.E.;
RT   "NAG-2, a novel transmembrane-4 superfamily (TM4SF) protein that complexes
RT   with integrins and other TM4SF proteins";
RL   J Biol Chem 272(46):29181-29189(1997).
XX
RN   [2]
RP   1-1358
RA   Tachibana I., Bodorova J., Berditchevski F., Zutter M.M., Hemler M.E.;
RT   ;
RL   Submitted (04-SEP-1997) to the INSDC.
RL   Tumor Virology, Dana-Farber Cancer Institute, 44 Binney Street, Boston, MA
RL   02115, USA
XX
DR   MD5; 22a73726676fe4d5defc60b709547a9f.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
DR   EuropePMC; PMC24397; 9826724.
DR   EuropePMC; PMC311163; 11591653.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1358
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="MDA-MB-435"
FT                   /cell_type="breast cancer"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        105..821
FT                   /codon_start=1
FT                   /gene="NAG-2"
FT                   /product="tetraspan"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000062691.12"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAC51864.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 1358 BP; 265 A; 428 C; 400 G; 265 T; 0 other;
     cttggtcgca cccaccacct gcctgcccac tggtcagcct tcagggaccc tgagcaccgc        60
     ctggtctctt tcctgtggcc agcccagaac tgaagcgctg cggcatggcg cgcgcctgcc       120
     tccaggccgt caagtacctc atgttcgcct tcaacctgct cttctggctg ggaggctgtg       180
     gcgtgctggg tgtcggcatc tggctggccg ccacacaggg gagcttcgcc acgctgtcct       240
     cttccttccc gtccctgtcg gctgccaacc tgctcatcat caccggcgcc tttgtcatgg       300
     ccatcggctt cgtgggctgc ctgggtgcca tcaaggagaa caagtgcctc ctgctcactt       360
     tcttcctgct gctgctgctg gtgttcctgc tggaggccac catcgccatc ctcttcttcg       420
     cctacacgga caagattgac aggtatgccc agcaagacct gaagaaaggc ttgcacctgt       480
     acggcacgca gggcaacgtg ggcctcacca acgcctggag catcatccag accgacttcc       540
     gctgctgtgg cgtctccaac tacactgact ggttcgaggt gtacaacgcc acgcgggtac       600
     ctgactcctg ctgcttggag ttcagtgaga gctgtgggct gcacgccccc ggcacctggt       660
     ggaaggcgcc gtgctacgag acggtgaagg tgtggcttca ggagaacctg ctggctgtgg       720
     gcatctttgg gctgtgcacg gcgctggtgc agatcctggg cctgaccttc gccatgacca       780
     tgtactgcca agtggtcaag gcagacacct actgcgcgta ggccgcccac cgcccgcttc       840
     tctgccaaaa ggacgcccac ggggagatgg ccgcacccac agctgccttt cccaccacca       900
     gcctcggtgc tctgccccat gctgggagga gggagggagg gacaggtgcc tggagccccc       960
     ggaaccctgt ttctggaagg ccctggctca ggtggcttca gggcctccgg accccccctg      1020
     ggaggggtgg ccacgtgctg gctgcggaac ccagggcagg ggtgggaggg gcctccagca      1080
     ctttttatat ttacgtattc tccaaagcag tgttcacacg ggagccagcc tgtggccccc      1140
     agcctcctgg aaaacaggtt ggcgctggag gagccgggtc ttggcatcct ggaggtggcc      1200
     ccactggtcc tggtgctcca ggcggggccg tggacccctc acctacattc catagtgggc      1260
     ccgtggggct cctggtgcat cttaataaag tgtgagcagc aaaaaaaaaa aaaaaaaaaa      1320
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                              1358
//

If you have problems or comments...

PBIL Back to PBIL home page