(data stored in ACNUC8465 zone)

EMBL: AF026216

ID   AF026216; SV 2; linear; mRNA; STD; MUS; 2231 BP.
XX
AC   AF026216;
XX
DT   01-NOV-1997 (Rel. 53, Created)
DT   07-JAN-2017 (Rel. 131, Last updated, Version 3)
XX
DE   Mus musculus mitogen-activated protein kinase kinase (MKK7) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2231
RX   DOI; 10.1074/jbc.272.51.32378.
RX   PUBMED; 9405446.
RA   Yao Z., Diener K., Wang X.S., Zukowski M., Matsumoto G., Zhou G., Mo R.,
RA   Sasaki T., Nishina H., Hui C.C., Tan T.-H., Woodgett J.P., Penninger J.M.;
RT   "Activation of stress-activated protein kinases/c-Jun N-terminal protein
RT   kinases (SAPKs/JNKs) by a novel mitogen-activated protein kinase kinase";
RL   J Biol Chem 272(51):32378-32383(1997).
XX
RN   [2]
RP   1-2231
RA   Yao Z., Diener K., Wang X.S., Penninger J.M.;
RT   ;
RL   Submitted (19-SEP-1997) to the INSDC.
RL   Medical Biophysics, Ontario Cancer Institute, 610 University Ave, Toronto,
RL   Ont M5G 2C1, Canada
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-2231
RA   Yao Z., Diener K., Wang X.S., Penninger J.M.;
RT   ;
RL   Submitted (05-JAN-2017) to the INSDC.
RL   Medical Biophysics, Ontario Cancer Institute, 610 University Ave, Toronto,
RL   Ont M5G 2C1, Canada
XX
DR   MD5; 9965b3c935922cc1582bc89fd5067775.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
XX
CC   On Jan 5, 2017 this sequence version replaced gi:2564716.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2231
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2231
FT                   /gene="MKK7"
FT   CDS_pept        143..1183
FT                   /codon_start=1
FT                   /gene="MKK7"
FT                   /product="MKK7"
FT                   /note="mitogen-activated protein kinase kinase; specific
FT                   activator of SAP kinase"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAB81848.1"
FT                   /translation="MLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEIN
FT                   DLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCP
FT                   YIVQCFGTFITNTDVFIAMELMGICAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEK
FT                   HGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPT
FT                   KPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQ
FT                   SFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTDSPRTSGVLSQH
FT                   HLPFFR"
XX
SQ   Sequence 2231 BP; 561 A; 618 C; 550 G; 502 T; 0 other;
     gaggatcgac ctcaacttgg atatcagccc acagcggccc aggcccaccc tgcaactccc        60
     actggccaac gatgggggca gccgctcacc atcctcagag agctccccac agcaccctac       120
     accccccacc cggccccgcc acatgctggg gctcccatca accttgttca caccgcgcag       180
     tatggagagc atcgagattg accagaagct gcaggagatc atgaagcaga cagggtacct       240
     gactatcggg ggccagcgtt atcaggcaga aatcaatgac ttggagaact tgggtgagat       300
     gggcagtggt acctgtggtc aggtgtggaa gatgcggttc cggaagacag gccacatcat       360
     tgctgttaag caaatgcggc gctctgggaa caaggaagag aataagcgca ttttgatgga       420
     cctggatgta gtactcaaga gccatgactg cccttacatc gttcagtgct ttggcacctt       480
     catcaccaac acagacgtct ttattgccat ggagctcatg ggcatatgtg cagagaagct       540
     gaagaaacga atgcagggcc ccattccaga gcgaatcctg ggcaagatga ctgtggcgat       600
     tgtgaaagca ctgtactatc tgaaggagaa gcatggcgtc atccatcgcg atgtcaaacc       660
     ctccaacatc ctgctagatg agcggggcca gatcaagctc tgtgactttg gcatcagtgg       720
     ccgccttgtt gactccaaag ccaaaacacg gagtgctggc tgtgctgcct atatggctcc       780
     cgagcgcatc gaccctccag atcccaccaa gcctgactat gacatccgag ctgatgtgtg       840
     gagcctgggc atctcactgg tggagctggc aacaggacag ttcccctata agaactgcaa       900
     gacggacttt gaggtcctca ccaaagtcct acaggaagag cccccactcc tgcctggtca       960
     catgggcttc tcaggggact tccagtcatt tgtcaaagac tgccttacta aagatcacag      1020
     gaagagacca aagtataata agctacttga acacagcttc atcaagcact atgagatact      1080
     cgaggtggat gtcgcgtcct ggtttaagga tgtcatggcg aagaccgatt ccccaaggac      1140
     tagtggagtc ctgagtcagc accatctgcc cttcttcagg tagcctcatg gcagcggcca      1200
     gccccgcagg ggccccgggc cacggccacc gacccccccc ccaacctggc caacccagct      1260
     gcccatcagg ggacctgggg acctggacga ctgccaagga ctgaggacag aaagtagggg      1320
     gttcccatcc agctctgact ccctgcctac cagctgtgga caaaagggca tgctggttcc      1380
     taatccctcc cactctgggg tcagccagca gtgtgagccc catcccaccc cgacagacac      1440
     tgtgaacgga agacagcagg ccatgagcag actcgctatt tattcaatca taacctctgg      1500
     gctggggtaa cccccagggg cagagagacg gcacgagctc aaaccaactc tgagtatgga      1560
     actctcaggc tctctgaact ctgaccttat ctcctggact cactcaccaa cagtgaccac      1620
     ttggatcttt aacagacctc agcacttcca gcacactgct gttgggagcc ttgcactcac      1680
     tatagtctca aacacaacaa caacaacaac aataataaca acaacaacaa caacaacaac      1740
     aagctgcctc tggttagctt actgcatgct tccctcagct cttgagtatc gctttctggg      1800
     agggttcctc gaggtccctg gacggatgac ttcccagcat cgttcactgc acttactatg      1860
     cactgacata atatgcacca cattttgtga ttgcaagata cacatttgtc ttaaaatttg      1920
     ccacagctga aacaaagggt atattaaagg tataacgtca aagcttgtac caagctttct      1980
     cactggtctg tgggggcttc agccggtgct tggaatacta tcaactggag gaaactgttc      2040
     aagtgttctg tttagaccac actggacaga aaacagatac ctatggggtg aggttcctat      2100
     tctcagggtt tgtttgtttg tttgtttgtt tgtttgtttt tcagtgcaaa ttagagacag      2160
     ttcatgtttt cttgcagttg tttttttctg gggggataat tctggctttg tttatctctc      2220
     gtgccgaatt c                                                           2231
//

If you have problems or comments...

PBIL Back to PBIL home page