(data stored in ACNUC32233 zone)

EMBL: AF026487

ID   AF026487; SV 1; linear; mRNA; STD; HUM; 2117 BP.
XX
AC   AF026487;
XX
DT   13-OCT-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens beta III spectrin (SPTBN2) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2117
RX   DOI; 10.1073/pnas.95.24.14158.
RX   PUBMED; 9826670.
RA   Stankewich M.C., Tse W.T., Peters L.L., Ch'ng Y., John K.M., Stabach P.R.,
RA   Devarajan P., Morrow J.S., Lux S.E.;
RT   "A widely expressed betaIII spectrin associated with Golgi and cytoplasmic
RT   vesicles";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(24):14158-14163(1998).
XX
RN   [2]
RP   1-2117
RA   Tse W.T., Peters L.L., John K.M., Lux S.E.;
RT   "SPTBN2, a new, widely expressed beta III spectrin gene located on human
RT   chromosome 11q13 and mouse chromosome 19";
RL   Unpublished.
XX
RN   [3]
RP   1-2117
RA   Tse W.T., Peters L.L., John K.M., Lux S.E.;
RT   ;
RL   Submitted (24-SEP-1997) to the INSDC.
RL   Division of Hematology/Oncology, Children's Hospital, 300 Longwood Ave,
RL   Boston, MA 02115, USA
XX
DR   MD5; e2f7b25c85bdb3b684d2ec7e6a3013ec.
DR   Ensembl-Gn; ENSG00000173898; homo_sapiens.
DR   Ensembl-Tr; ENST00000309996; homo_sapiens.
DR   Ensembl-Tr; ENST00000529997; homo_sapiens.
DR   Ensembl-Tr; ENST00000533211; homo_sapiens.
DR   EuropePMC; PMC24343; 9826670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2117
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q13, near D11S913"
FT                   /mol_type="mRNA"
FT                   /dev_stage="24 week fetus"
FT                   /clone="141000"
FT                   /tissue_type="brain"
FT                   /note="contains EST44464 (GenBank Accession Number
FT                   AA339388); the clone is available from ATCC, Rockville, MD"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..1478
FT                   /codon_start=3
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="membrane skeletal protein; beta spectrin
FT                   nonerythroid form 2"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000062823.12"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="AAC79502.1"
FT                   /translation="RQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADL
FT                   VIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQ
FT                   EKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSA
FT                   VAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTASVPPGDLVGGQTASDT
FT                   TWDGTQPRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRG
FT                   ERQTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAA
FT                   NRSWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKL
FT                   GLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTRAMTMPP
FT                   VSPVGAEGPVVLRSKDGREREREKRFSFFKKNK"
XX
SQ   Sequence 2117 BP; 468 A; 637 C; 656 G; 356 T; 0 other;
     gccggcagct gctgctggac accacagaca agttccgctt cttcaaggct gtccgggaac        60
     tgatgctctg gatggatgag gtcaacctgc agatggatgc ccaggagcgt ccccgggatg       120
     tgtcctccgc ggatctagtc atcaagaacc agcaaggcat caaggcagag atagaggccc       180
     gggcagaccg cttctcctcc tgcatcgaca tggggaagga gctgctggcc aggagccact       240
     atgcggccga ggagatctca gagaagctgt ctcagctgca ggcacggcgc caggagacag       300
     ctgagaagtg gcaggagaag atggactggc ttcagctggt tttggaggtg cttgtgtttg       360
     gaagagatgc agggatggca gaggcctggc tctgcagcca ggagccactg gtgcgcagcg       420
     ctgagctggg ttgcacggtc gacgaagttg agagcctcat caagcggcac gaggccttcc       480
     agaagtcagc agtggcctgg gaggagcgat tctgtgcgct ggagaagctt actgcgctag       540
     aggagcggga gaaggagcga aagagaaaga gggaggagga ggagcggcgg aaacagccgc       600
     ctgctcccga acccacagcc agtgtgcctc caggggacct ggtgggcggc cagacagctt       660
     ctgacaccac ctgggacgga acccagccac ggccaccacc atccacacaa gcacccagtg       720
     ttaatggagt ctgcacagat ggagagccct cacagcccct gctgggacaa cagagacttg       780
     agcacagcag cttccccgaa gggccgggac ctggctcagg ggacgaagcc aatgggcccc       840
     ggggagagag gcagacccgg actcggggcc cggccccatc tgcaatgccc cagagcaggt       900
     ctaccgagtc agcccatgct gccaccctgc cgcctcgagg cccagagcca tctgcccagg       960
     agcagatgga ggggatgctg tgccgcaagc aggagatgga ggccttcggg aagaaggctg      1020
     ccaacaggtc ctggcagaac gtgtactgtg tcctgcggcg tgggagcctc ggcttttaca      1080
     aggatgccaa ggcagccagc gcgggagtgc cataccacgg agaagtgcct gtcagcctgg      1140
     ccagggccca gggcagcgtc gcctttgatt accgaaagcg caaacatgtc ttcaagctgg      1200
     gcttacagga tggaaaagaa tatttattcc aggccaagga tgaggcagag atgagctcgt      1260
     ggctacgggt ggtgaatgca gccattgcca cagcgtcttc tgcctctgga gagcctgaag      1320
     agccggtggt gcccagcacc acccggggca tgacccgggc catgaccatg cccccagtgt      1380
     cacccgtcgg ggctgagggg cctgttgtgc tccgcagcaa agacggcaga gaacgagagc      1440
     gagaaaaacg cttcagcttc tttaagaaga acaagtagtt gggggcaagg tcccaggcca      1500
     actccctccc tccgttcagg aaactgccag ggacagtcga cagggaccgc cctcttgtca      1560
     ggacaactgc ctgctgctag ggtctgttgc caaggtcaac ccatcaccag gaactgtcac      1620
     tggggacgag tccatgttcc caagggcagc ccttctcttc tgctgtttaa ttccagactg      1680
     gtggtgggac ccaggtaacc ccctctccca cccccgccga cttctcccct ttccccagcc      1740
     tcgtgcctct gtccctcacc acggtgtgga cagtgccgca ccctcaacat aggccatgtg      1800
     gggagtggct gcccctgcct cagggtcatt ctcctgccat gcgagggcac tcgccttctg      1860
     ccttctggtt cctcacccct cagaccagcc aggaacctct cagagctgaa gcaggccctg      1920
     ggggcagaag tgccagatga cagtcagagg cgcaggagcc ctccctcccc acccccaccc      1980
     tgtaactcca gctgccactc catctccagc tgctctcaat ggcttccagg tgtgttgttc      2040
     ggggacagcc accgccttga gtctggccaa ggaggtgatt aaacagctca gcttctctca      2100
     aaaaaaaaaa aaaaaaa                                                     2117
//

If you have problems or comments...

PBIL Back to PBIL home page