(data stored in ACNUC32233 zone)

EMBL: AF026488

ID   AF026488; SV 1; linear; mRNA; STD; HUM; 1695 BP.
XX
AC   AF026488;
XX
DT   13-OCT-1997 (Rel. 52, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens beta III spectrin (SPTBN2) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1695
RX   DOI; 10.1073/pnas.95.24.14158.
RX   PUBMED; 9826670.
RA   Stankewich M.C., Tse W.T., Peters L.L., Ch'ng Y., John K.M., Stabach P.R.,
RA   Devarajan P., Morrow J.S., Lux S.E.;
RT   "A widely expressed betaIII spectrin associated with Golgi and cytoplasmic
RT   vesicles";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(24):14158-14163(1998).
XX
RN   [2]
RP   1-1695
RA   Tse W.T., Peters L.L., John K.M., Lux S.E.;
RT   "SPTBN2, a new, widely expressed beta III spectrin gene located on human
RT   chromosome 11q13 and mouse chromosome 19";
RL   Unpublished.
XX
RN   [3]
RP   1-1695
RA   Tse W.T., Peters L.L., John K.M., Lux S.E.;
RT   ;
RL   Submitted (24-SEP-1997) to the INSDC.
RL   Division of Hematology/Oncology, Children's Hospital, 300 Longwood Ave,
RL   Boston, MA 02115, USA
XX
DR   MD5; 5c54db757865e35c7178a71f4207cea8.
DR   Ensembl-Gn; ENSG00000173898; homo_sapiens.
DR   Ensembl-Tr; ENST00000309996; homo_sapiens.
DR   Ensembl-Tr; ENST00000529997; homo_sapiens.
DR   Ensembl-Tr; ENST00000533211; homo_sapiens.
DR   EuropePMC; PMC24343; 9826670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1695
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /map="11q13, near D11S913"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="55 year old adult"
FT                   /clone="184038"
FT                   /tissue_type="brain"
FT                   /note="contains ESTyo78c04.r1 (GenBank Accession Number
FT                   H30688); the clone is available from Genome Systems, Inc.,
FT                   St Louis, MO"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..689
FT                   /codon_start=3
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="alternatively spliced version that encodes a
FT                   different C-terminus"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAC79504.1"
FT                   /translation="SVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGER
FT                   QTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANR
FT                   SWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGL
FT                   QDGKEYLFQAKDEVSCPSCSSLSVPFQKLPAADSPSFPVLPLFPGLVLCGKTGCVRRPH
FT                   QAALPV"
FT   CDS_pept        join(<1..530,824..1057)
FT                   /codon_start=3
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="membrane skeletal protein; beta spectrin
FT                   nonerythroid form 2"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000062824.12"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="AAC79503.1"
FT                   /translation="SVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGER
FT                   QTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANR
FT                   SWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGL
FT                   QDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTRAMTMPPVS
FT                   PVGAEGPVVLRSKDGREREREKRFSFFKKNK"
FT   3'UTR           1058..1676
FT                   /gene="SPTBN2"
FT   regulatory      1657..1662
FT                   /gene="SPTBN2"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1695 BP; 349 A; 545 C; 467 G; 334 T; 0 other;
     ccagtgttaa tggagtctgc acagatggag agccctcaca gcccctgctg ggacaacaga        60
     gacttgagca cagcagcttc cccgaagggc cgggacctgg ctcaggggac gaagccaatg       120
     ggccccgggg agagaggcag acccggactc ggggcccggc cccatctgca atgccccaga       180
     gcaggtctac cgagtcagcc catgctgcca ccctgccgcc tcgaggccca gagccatctg       240
     cccaggagca gatggagggg atgctgtgcc gcaagcagga gatggaggcc ttcgggaaga       300
     aggctgccaa caggtcctgg cagaacgtgt actgtgtcct gcggcgtggg agcctcggct       360
     tttacaagga tgccaaggca gccagcgcgg gagtgccata ccacggagaa gtgcctgtca       420
     gcctggccag ggcccagggc agcgtcgcct ttgattaccg aaagcgcaaa catgtcttca       480
     agctgggctt acaggatgga aaagaatatt tattccaggc caaggatgag gtgagctgtc       540
     cttcgtgttc ctctctgtcc gtgccattcc agaagcttcc agctgcagac tccccttctt       600
     tccctgtcct ccctcttttt cctggtcttg tcctttgtgg taagactgga tgtgtgcgac       660
     ggccgcacca ggccgcactc cctgtctaag ccggccacat tctcctaata gcatgaaaca       720
     gtcagctcac tttctgcctc ctcctcttac acttccctgc tgtccactgc ggccaactca       780
     gcacagtgtc cttgaagctg attgagggtc tttccatcca caggcagaga tgagctcgtg       840
     gctacgggtg gtgaatgcag ccattgccac agcgtcttct gcctctggag agcctgaaga       900
     gccggtggtg cccagcacca cccggggcat gacccgggcc atgaccatgc ccccagtgtc       960
     acccgtcggg gctgaggggc ctgttgtgct ccgcagcaaa gacggcagag aacgagagcg      1020
     agaaaaacgc ttcagcttct ttaagaagaa caagtagttg ggggcaaggt cccaggccaa      1080
     ctccctccct ccgttcagga aactgccagg gacagtcgac agggaccgcc ctcttgtcag      1140
     gacaactgcc tgctgctagg gtctgttgcc aaggtcaacc catcaccagg aactgtcact      1200
     ggggacgagt ccatgttccc aagggcagcc cttctcttct gctgtttaat tccagactgg      1260
     tggtgggacc caggtaaccc cctctcccac ccccgccgac ttctcccctt tccccagcct      1320
     cgtgcctctg tccctcacca cggtgtggac agtgccgcac cctcaacata ggccatgtgg      1380
     ggagtggctg cccctgcctc agggtcattc tcctgccatg cgagggcact cgccttctgc      1440
     cttctggttc ctcacccctc agaccagcca ggaacctctc agagctgaag caggccctgg      1500
     gggcagaagt gccagatgac agtcagaggc gcaggagccc tccctcccca cccccaccct      1560
     gtaactccag ctgccactcc atctccagtt gctctcaatg gcttccaggt gtgttgttcg      1620
     gggacagcca ccgccttgag tctggccaag gaggtgatta aacagctcag cttctcaaaa      1680
     aaaaaaaaaa aaaaa                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page