(data stored in ACNUC7421 zone)

EMBL: AF026490

ID   AF026490; SV 1; linear; genomic DNA; STD; PRO; 1544 BP.
XX
AC   AF026490;
XX
DT   01-NOV-1997 (Rel. 53, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Edwardsiella ictaluri adenylosuccinate synthetase (purA) gene, complete
DE   cds.
XX
KW   .
XX
OS   Edwardsiella ictaluri
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Hafniaceae; Edwardsiella.
XX
RN   [1]
RP   1-1544
RX   PUBMED; 9353045.
RA   Lawrence M.L., Cooper R.K., Thune R.L.;
RT   "Attenuation, persistence, and vaccine potential of an Edwardsiella
RT   ictaluri purA mutant";
RL   Infect Immun 65(11):4642-4651(1997).
XX
RN   [2]
RP   1-1544
RA   Lawrence M.L., Cooper R.K., Thune R.L.;
RT   ;
RL   Submitted (18-SEP-1997) to the INSDC.
RL   Veterinary Science, Louisiana State University, 111 Dalrymple Bldg., Baton
RL   Rouge, LA 70803, USA
XX
DR   MD5; b85a95694a290ef9b286e9d8b9bcd59e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1544
FT                   /organism="Edwardsiella ictaluri"
FT                   /strain="93-146"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:67780"
FT   CDS_pept        187..1485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="GOA:O31047"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31047"
FT                   /protein_id="AAB86714.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVVSIIANGVVLAPDALLREMTELEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKASFAVKLK
FT                   EIMEYHNFQLVNYYHVDAVDYQSVLDEVMAVADLLTSMVVDVADLLNKAYRNGEYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGIGPRRVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDSVGEFLCEKGNEFGATTGRRRRTGWLDAVAVRRAVELNSLSGFCLTKLDVLDGLD
FT                   EVKICVGYRLPDGREVDVTPLAAEGWEGIEPIYEVLPGWKESTFGVKLRDGLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETIVLRHPFDA"
XX
SQ   Sequence 1544 BP; 318 A; 402 C; 480 G; 344 T; 0 other;
     tgatggttta ttgcgccgct atggcggagg tctagtggtt gctgggctgg ttatctacta        60
     catgttgcgt agtcgcctcg gcggctgata tgtcagacaa aatttgcgca atcgtgtgcg       120
     aaaaaagctg aaagctgaaa aatgaggtgg tagaatccat ttttaacaac gtggtgaata       180
     gctaaaatgg gcaagaacgt cgtcgtactg ggcacccaat ggggtgacga aggtaaaggt       240
     aaggtcgtag acctcttaac tgaacgggcc aagtatgttg tacgctatca gggcgggcac       300
     aacgcgggcc atacgctagt cattaacggt gaaaaaaccg ttctgcatct gattccctca       360
     ggtattctgc gcgaaaatgt cgtcagtatt attgccaacg gcgttgttct ggcgccggat       420
     gcgctgctgc gcgaaatgac cgagctggaa gcgcgcggtg taccggtgcg cgagcgtctg       480
     ctgctctctg aagcctgtcc gctgatcctg ccgtatcacg ttgcgctgga caatgcacgt       540
     gagaaagcac gcggcgccaa ggctatcggc accaccggtc gcggcattgg cccggcctat       600
     gaagacaaag tggcccgccg cggtctgcgc gtcggcgacc tgtttgataa agccagcttc       660
     gccgttaagc tgaaagagat tatggagtac cataacttcc agctggtgaa ctactaccac       720
     gtcgatgccg ttgattacca gagcgtgctg gatgaagtga tggcggttgc cgatctgctg       780
     accagcatgg tggttgacgt tgccgatcta ctgaacaagg cctatcgcaa cggcgaatat       840
     gtgatgttcg aaggtgccca gggcaccctg ctggatatcg accacggtac ctatccgtac       900
     gtgacctcct ccaacacgac cgctggtggc gtcgcgaccg gctccggtat cggcccgcgc       960
     cgcgtggact atgtgctggg tatcgtcaag gcgtactcta cccgcgtggg cgccggtccg      1020
     ttcccgactg agctgttcga tagcgtcggt gagttcctgt gcgagaaggg taacgagttt      1080
     ggtgccacca ccggtcgccg ccgccgtacc ggctggctgg acgccgttgc cgtgcgccgc      1140
     gccgtagagc tgaactcgct gtctggcttc tgcctgacca agctggatgt gctggacggc      1200
     ctggatgaag tgaaaatctg cgtaggctat cgcctgccgg atggccgcga agtcgatgta      1260
     acgccgttgg ctgctgaggg ctgggaaggc atagagccga tctacgaagt gctgccgggc      1320
     tggaaagaga gcaccttcgg cgtgaagttg cgtgacgggc tgccgcaggc ggcactgaac      1380
     tacatcaaac gtattgaaga agttaccggt gtgccggtcg atatcatctc taccggtccg      1440
     gaccgtgaag agaccatcgt gctgcgtcat ccgttcgatg cttaatgacc cgatgcgtta      1500
     ttcaacaaac cggccttatg gccggtttgt tgttttgagc gact                       1544
//

If you have problems or comments...

PBIL Back to PBIL home page