(data stored in SCRATCH zone)

EMBL: AF030559

ID   AF030559; SV 1; linear; mRNA; STD; MUS; 1792 BP.
XX
AC   AF030559;
XX
DT   17-NOV-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus ATP synthase beta-subunit (beta-F1 ATPase) mRNA, nuclear gene
DE   encoding mitochondrial protein, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1792
RX   DOI; 10.1042/0264-6021:3460033.
RX   PUBMED; 10657236.
RA   Andersson U., Antonicka H., Houstek J., Cannon B.;
RT   "A novel principle for conferring selectivity to poly(A)-binding proteins:
RT   interdependence of two ATP synthase beta-subunit mRNA-binding proteins";
RL   Biochem. J. 346(1):33-39(2000).
XX
RN   [2]
RP   1-1792
RA   Andersson U., Antonicka H., Houstek J., Cannon B.;
RT   ;
RL   Submitted (21-OCT-1997) to the INSDC.
RL   Dept. of Metabolic Research, Wenner-Gren Institute, Arrhenius Laboratories
RL   F3, S-106 91 Stockholm, Sweden
XX
DR   MD5; aa6e3d7e855e108688fa4cf6d5ecb2d3.
DR   Ensembl-Gn; ENSMUSG00000025393; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017822; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017785; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017786; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017609; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018241; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017170; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017579; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017685; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017680; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017708; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018281; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016955; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017229; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026459; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027443; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027409; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027387; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027894; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026794; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027125; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027239; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027363; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027221; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027918; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026715; mus_musculus_wsbeij.
DR   EuropePMC; PMC24812; 10611377.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1792
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        20..1609
FT                   /codon_start=1
FT                   /gene="beta-F1 ATPase"
FT                   /product="ATP synthase beta-subunit"
FT                   /note="catalytic subunit"
FT                   /db_xref="GOA:P56480"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="MGI:MGI:107801"
FT                   /db_xref="UniProtKB/Swiss-Prot:P56480"
FT                   /protein_id="AAB86421.1"
FT                   /translation="MLSLVGRVASASASGALRGLSPSAVLPQAQLLLRAAPAGVHPARD
FT                   YAAQASAAPKAGTATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRESRLVLEVAQHLG
FT                   ESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQF
FT                   APIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINN
FT                   VAKAHGGYSVFAGVGEKTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGAPTR
FT                   VALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMG
FT                   TMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVD
FT                   PLDSTSRIMDPNIVGNEHYDVARGVQKILQDYKFFQDIIAILGMDELSEEDKLTVSRAR
FT                   KIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAV
FT                   AKADKLAEEHGS"
XX
SQ   Sequence 1792 BP; 454 A; 426 C; 487 G; 425 T; 0 other;
     tgaattcagc gcccgctgaa tgttgagtct tgtggggcgt gtggcctcgg cctcggcctc        60
     cggggccttg cggggactca gcccttcggc ggttctgcca caggcgcagc ttctactgcg       120
     agctgctccc gccggggttc atcctgccag agactatgcg gcgcaggcgt ctgcggcccc       180
     gaaggcaggc actgccaccg ggcgaatcgt ggcagtcatc ggcgccgttg tggatgtcca       240
     gttcgatgag ggattaccac ccatcctaaa tgccctggaa gtgcaaggca gggagagcag       300
     actggttttg gaggtggccc agcatttggg ggagagcacg gtcagaacta ttgctatgga       360
     tggcactgaa ggcttggtta gaggccagaa agtactggat tcaggggcac caatcaaaat       420
     tcctgttggt cctgagacct tgggcagaat catgaatgtc attggagaac ctattgatga       480
     gagaggtcct atcaaaacca aacaatttgc tcctattcat gctgaggctc ctgagttcat       540
     agagatgagt gttgagcagg agattctggt gactgggata aaggttgtgg atctgctggc       600
     cccatacgcc aagggtggga aaatcggact ctttggaggt gctggcgttg gaaagacagt       660
     actgatcatg gagctaatca acaatgtcgc caaagcccat ggtggttact ctgtatttgc       720
     tggtgttggt gaaaagaccc gtgagggcaa tgatttatac catgaaatga ttgaatctgg       780
     tgttatcaat ctaaaagatg ccacttccaa ggtagcgttg gtatatggac agatgaacga       840
     accacctggc gctccaaccc gggtagctct gactggtttg accgttgctg aatacttcag       900
     agaccaggaa ggccaagatg tcctgctgtt tattgacaac attttccgct ttacccaggc       960
     tggttcagag gtgtctgcct tattgggcag aatcccttct gctgtaggct accagcccac      1020
     cctagccacc gacatgggca caatgcagga aaggatcacc accaccaaga agggatcgat      1080
     cacctcggtg caggctatct atgtgcctgc tgatgacctg actgaccctg cccctgcaac      1140
     cacctttgcc catttggatg ctaccactgt gttgtcccgg gctattgctg agttgggcat      1200
     ctatccagct gtggatccac tggactccac ctctcgaatt atggatccca acattgttgg      1260
     caatgagcat tatgacgtcg cccgaggagt gcaaaagatc ctgcaggact acaaattttt      1320
     ccaggacatc attgccatct tgggtatgga tgaactttct gaggaagata aattgactgt      1380
     gtcccgggca agaaagatac agcgcttctt gtctcagcca ttccaagttg ctgaggtctt      1440
     cacgggtcac atggggaagc tggtgccctt gaaggagacc attaaaggat tccagcagat      1500
     tttagcaggt gaatatgacc atctcccaga acaagccttt tacatggtgg gacccattga      1560
     agaagccgtg gcaaaggctg ataagctggc agaagagcac gggtcgtgag ggactccagc      1620
     caaaggcagc actgcaactg atctttccat atcaagcgag agctcaggtt tccttccatg      1680
     caggccacac aagagccttg attgaagatg tgatgttctc tctgaagagt atttaaagtt      1740
     ttcaataaag tatatacccc tcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa              1792
//

If you have problems or comments...

PBIL Back to PBIL home page