(data stored in ACNUC1829 zone)

EMBL: AF033620

ID   AF033620; SV 1; linear; genomic DNA; STD; MUS; 2650 BP.
XX
AC   AF033620;
XX
DT   10-JUL-1998 (Rel. 56, Created)
DT   10-JUL-1998 (Rel. 56, Last updated, Version 1)
XX
DE   Mus musculus platelet endothelial tetraspan antigen-3 (Peta3) gene,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2650
RX   DOI; 10.1016/S0167-4781(98)00034-7.
RX   PUBMED; 9602068.
RA   Fitter S., Seldin M.F., Ashman L.K.;
RT   "Characterisation of the mouse homologue of CD151 (PETA-3/SFA-1); genomic
RT   structure, chromosomal localisation and identification of 2 novel splice
RT   forms";
RL   Biochim. Biophys. Acta 1398(1):75-85(1998).
XX
RN   [2]
RP   1-2650
RA   Fitter S.;
RT   ;
RL   Submitted (08-NOV-1997) to the INSDC.
RL   Haematology, I.M.V.S, P.O Box 14 Rundle Mall, Adelaide, S.A 5000, Australia
XX
DR   MD5; cb764ec32a80ef9a0f4819c1a1972a4d.
DR   Ensembl-Gn; ENSMUSG00000025510; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033234; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033216; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033148; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032261; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032903; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033055; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033041; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031965; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032372; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106000; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177840; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087636; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087723; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087658; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087241; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088182; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087222; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088480; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086279; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2650
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="between Gas2 and D7Mit70/p"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   exon            <1..75
FT                   /gene="Peta3"
FT   mRNA            join(<1..75,434..524,645..836,1116..1190,1300..1404,
FT                   1489..1647,1730..2650)
FT                   /gene="Peta3"
FT   5'UTR           join(<1..75,434..440)
FT                   /gene="Peta3"
FT   exon            434..524
FT                   /gene="Peta3"
FT   CDS_pept        join(441..524,645..836,1116..1190,1300..1404,1489..1647,
FT                   1730..1876)
FT                   /codon_start=1
FT                   /gene="Peta3"
FT                   /product="platelet endothelial tetraspan antigen-3"
FT                   /note="TM4SF protein; PETA-3; CD151; SFA-1"
FT                   /db_xref="GOA:O35566"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1096360"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35566"
FT                   /protein_id="AAC25952.1"
FT                   /translation="MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALK
FT                   SDYISLLASSTYLATAYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLE
FT                   IIAGILAYVYYQQLNTELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQD
FT                   WQDSEWIRSGEADSRVVPDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRV
FT                   IGAVGIGIACVQVFGMIFTCCLYRSLKLEHY"
FT   exon            645..836
FT                   /gene="Peta3"
FT   exon            1116..1190
FT                   /gene="Peta3"
FT   exon            1300..1404
FT                   /gene="Peta3"
FT   exon            1489..1647
FT                   /gene="Peta3"
FT   exon            1730..2650
FT                   /gene="Peta3"
FT   3'UTR           1877..2650
FT                   /gene="Peta3"
XX
SQ   Sequence 2650 BP; 531 A; 728 C; 744 G; 647 T; 0 other;
     tcagctcaga gtcctcacaa actgtccctt agggtggcct gagctctctg ccatatctgg        60
     gaacgggtat gagtggtaag tacctagcag cctgattgtg ggactcaggg aatgcttggg       120
     ggtgccgatc aacaggaatg taccctgaag gtctgctggt gcttcccccc ctgttgccag       180
     caggagtgag tcagcagatg ttggggggtc ctccatgata acccaccatg tgtctggctg       240
     tgaggaggtt agttcaggaa gtgactcata aggttcctgg gaatgctcct ctgagggcag       300
     atagctggct gagctccaaa ctgcaatcat ccggggactg ctggatctcc tcctgtctcc       360
     gttggtagat agctttcttc ctacttggag gcctggtgct tcaggccatc tgacctcctc       420
     cccgttcctc taggcccagg atgggtgaat tcaatgagaa gaaggcaaca tgtggcacag       480
     tctgcctcaa gtacctgctc tttacctaca actgctgctt ctgggtgaga agagctaatt       540
     tctccctgca tccctagtcc ccatgttgga ggcctggcct ggggggctca gtcccagctt       600
     ccagacccag gccagatgtg gtgaccagta tatactttct gcagctggcc ggcctggctg       660
     tcatggcagt gggcatctgg acactggccc tcaagagtga ctacattagt ctgctggcct       720
     caagcactta cctagccacg gcctacatct tagtggtggc tggtgttgtt gtcatggtga       780
     ctggagtcct gggctgctgt gccactttca aggagcgacg gaacctgtta cgcttggtca       840
     gtggggcatg gtggcacacg gtggggctag gggtgccttg catggatttc tcagggggcc       900
     tctggtactg gttctgggga cttaactggt tgagtgtatt actgcaggct gtccctgttg       960
     gggcagacac gagcttcaga actatgaagg agctaggcag ccccagagtg tagctcctaa      1020
     ctgaattcct cttgcttggc ctcctgggtt gggggcttgg ctttgtggta ctctggcact      1080
     agcaaccccc cacttactgg gtccctgctc cctagtactt catcctgctc ctcatcatct      1140
     tcctcctgga gatcattgct ggcatcctgg cctatgtcta ttatcagcag gtaagggcct      1200
     ggacaggcca tggggtgtgc ctagaacatg gccctgtcag tcccattgga ggtcctggct      1260
     ccagctttgc ctttgcccag agtttgatcc tacccacagc tgaacacaga gctcaaggag      1320
     aatctgaagg acaccatggt caagagatac caccagtcag gccacgaggg tgtgagcagc      1380
     gctgtcgaca agctgcagca agaggtgggt gcccctagaa ctgcccgccc tctcggcatg      1440
     gtgccgtgtg ccggcaagcg ctgaggctca gccatgtgcc ccttgtagtt ccactgttgt      1500
     ggcagcaaca actctcaaga ctggcaagac agcgagtgga tccgctctgg tgaggcagac      1560
     agccgcgtgg ttcctgacag ctgctgtaag actatggtag ctggctgtgg taagcgggac      1620
     catgcctcca acatctataa agtggaggta ggtgggttct cagcaagggg cggggctagg      1680
     ccggactggt cttcaggcag cctggcccac cacccttctc tcccactagg gtggctgtat      1740
     cactaagctg gagaccttca ttcaggagca cctgcgggtc attggggcgg tgggcattgg      1800
     catcgcctgt gtgcaggtct tcggcatgat cttcacctgc tgcttgtacc gaagcctcaa      1860
     gctggaacac tactgaccac gatgatgtca ggccgggcgg ccagccttgc actactgacc      1920
     acgatgatgc caggctgggc ggccagcctt gcactatgtc ccagccccac tactgaacac      1980
     tactgactta gactgctgac tgccagaggt agctaccctc atgccatcgc catgaccccc      2040
     cctggcatgc cacctcaggg gcatgcacct tcaagtgcct ttcactgcac accaaagtcc      2100
     caaagctcga agcagcgtac ttgccccagc attaagaagg gggggggggt ggggggttca      2160
     aatgccagtg ttgggctagg cctggctagt agaatagggt ttagattatt tgacagaagt      2220
     gcctcttatg cagactgctt ccctttgggt agctgtgatc tgcagtaagt ctggggagaa      2280
     cctgagtaca ccactacacg ttgggtaaaa gcaggtgggg cctttctggt tggattaggc      2340
     acccttcatg cctgctacca ggaactctca gatctgcttg ccccaaacaa atggtgtaag      2400
     ctgagggaaa ctccaacccc acacttgatg ctctgtcctc tccacacagg cctcttgctc      2460
     ctaacagctc agccctggcc ttttctcact actgatagca tcatgtaaat gctccatgtt      2520
     cctgtacact gtctcctttt ggagcatctc tgaatggagc atggctgttt tcatctcact      2580
     gctgtattcc agatgctgcc cacaaatgct cctgctatgt aacaggtgct caataaatgt      2640
     aaatgtataa                                                             2650
//

If you have problems or comments...

PBIL Back to PBIL home page