(data stored in ACNUC16935 zone)

EMBL: AF035383

ID   AF035383; SV 1; linear; mRNA; STD; PLN; 412 BP.
XX
AC   AF035383;
XX
DT   29-MAY-1998 (Rel. 55, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Arabidopsis thaliana polyubiquitin (SEN3) mRNA, partial cds.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-412
RX   DOI; 10.1023/A:1005958300951.
RX   PUBMED; 9617812.
RA   Park J.H., Oh S.A., Kim Y.H., Woo H.R., Nam H.G.;
RT   "Differential expression of senescence-associated mRNAs during leaf
RT   senescence induced by different senescence-inducing factors in
RT   Arabidopsis";
RL   Plant Mol. Biol. 37(3):445-454(1998).
XX
RN   [2]
RP   1-412
RA   Park J.-H., Oh S.A., Kim Y.H., Woo H.R., Nam H.G.;
RT   ;
RL   Submitted (19-NOV-1997) to the INSDC.
RL   Life Science, Pohang University of Science and Technology, San31,
RL   Hyoja-Dong, Nam-Gu, Pohang, Kyungbuk 790-784, Republic of Korea
XX
DR   MD5; d8fbac8105926a12d2c1071a7828f4b9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..412
FT                   /organism="Arabidopsis thaliana"
FT                   /cultivar="ecotype Col-O"
FT                   /mol_type="mRNA"
FT                   /tissue_type="leaf"
FT                   /note="senescence-associated clone"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        <1..>412
FT                   /codon_start=2
FT                   /gene="SEN3"
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:O64955"
FT                   /protein_id="AAC39466.1"
FT                   /translation="QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
FT                   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
FT                   MQIFVKTLTGKTISLEVESSDTIDNVKAKIQDK"
XX
SQ   Sequence 412 BP; 114 A; 95 C; 107 G; 96 T; 0 other;
     gcagctagag gatggccgta cgttggctga ttacaatatc cagaaggaat ccaccctcca        60
     cttggtcctc aggctccgtg gtggtatgca gattttcgtt aaaaccctaa cgggaaagac       120
     gattactctt gaggtggaga gttctgacac catcgacaac gtcaaggcca agatccaaga       180
     caaagagggt attcctccgg accagcagag gctgatcttc gccggaaagc agttggagga       240
     tggcagaact cttgctgact acaatatcca gaaggagtcc acccttcatc ttgttctcag       300
     gctccgtggt ggtatgcaga ttttcgttaa gacgttgact gggaaaacta tctctttgga       360
     ggtggagagt tctgacacca ttgataacgt gaaagccaag atccaagaca aa               412
//

If you have problems or comments...

PBIL Back to PBIL home page