(data stored in ACNUC7820 zone)

EMBL: AF042360

ID   AF042360; SV 1; linear; mRNA; STD; MUS; 535 BP.
XX
AC   AF042360;
XX
DT   11-FEB-1998 (Rel. 54, Created)
DT   03-SEP-1998 (Rel. 56, Last updated, Version 2)
XX
DE   Mus musculus clone OR27-3 putative olfactory receptor mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-535
RA   Boolay S., Illing N.;
RT   "Olfactory and taste receptors cloned from immortalized cell lines from
RT   mouse olfactory epithelium";
RL   Unpublished.
XX
RN   [2]
RP   1-535
RA   Boolay S., Illing N.;
RT   ;
RL   Submitted (12-JAN-1998) to the INSDC.
RL   Biochemistry, University of Cape Town, Private Bag, Rondebosch,7700, Cape
RL   Town, South Africa
XX
DR   MD5; 19aef5a7865dfecb26106d122bdbf42c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..535
FT                   /organism="Mus musculus"
FT                   /strain="C3H"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /clone="OR27a"
FT                   /cell_line="immortalized olfactory neuroepithelial cells"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        9..>535
FT                   /codon_start=1
FT                   /product="putative olfactory receptor"
FT                   /db_xref="GOA:O55019"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031189"
FT                   /db_xref="UniProtKB/TrEMBL:O55019"
FT                   /protein_id="AAC33267.1"
FT                   /translation="MAYDRYVAICHPLYYTVIVNQQLCMLMVLLSWVVSILHAFLQSSI
FT                   VLQLTFCGDVKIPHFFCELNQLSQLTCSDSLSSHLIMHLVPVLLGAISFSSILYSYFKI
FT                   VSSICSISSVQGKYKASSTCVSHLSIVSLFYSTGLGVYVSSAVVQSSHSSARASVMYTV
FT                   VTPMLNPFIYLE"
XX
SQ   Sequence 535 BP; 118 A; 133 C; 98 G; 186 T; 0 other;
     agatctagat ggcgtacgat cggtatgtgg ctatctgtca cccattgtat tacacagtca        60
     ttgttaacca acaactctgt atgctgatgg ttctgctgtc ctgggttgtt agcatcctac       120
     atgccttctt acagagctca attgtactac agttgacctt ttgtggagat gtaaaaattc       180
     cccacttctt ctgtgagctt aaccagctgt ctcaactcac atgttcagac agcttatcaa       240
     gccacctcat aatgcatctt gtacctgttc tattgggagc catttccttc agtagtatcc       300
     tttactctta tttcaagata gtgtcctcca tatgttctat ctcctcagtt caagggaagt       360
     acaaggcatc ttctacgtgt gtctctcacc tttccattgt ctccttattt tatagtacag       420
     gccttggagt gtatgtcagt tctgctgtgg tccaaagctc tcactcttct gcaagagcct       480
     ctgtgatgta tactgtggtc accccgatgc tcaatccctt tatttatcta gagca            535
//

If you have problems or comments...

PBIL Back to PBIL home page