(data stored in ACNUC16935 zone)

EMBL: AF045474

ID   AF045474; SV 1; linear; mRNA; STD; INV; 953 BP.
XX
AC   AF045474;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Schistosoma mansoni polyubiquitin mRNA, partial cds.
XX
KW   .
XX
OS   Schistosoma mansoni
OC   Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Strigeidida;
OC   Schistosomatoidea; Schistosomatidae; Schistosoma.
XX
RN   [1]
RP   1-953
RX   DOI; 10.1016/0378-1119(94)00747-G.
RX   PUBMED; 7835692.
RA   Franco G.R., Adams M.D., Soares M.B., Simpson A.J., Venter J.C., Pena S.D.;
RT   "Identification of new Schistosoma mansoni genes by the EST strategy using
RT   a directional cDNA library";
RL   Gene 152(2):141-147(1995).
XX
RN   [2]
RP   1-953
RA   Guerra-Sa R., Franco G.R., Pena S.D.J., Rodrigues V.;
RT   "Sequencing and characterization of ubiquitin genes and demonstration of
RT   ubiquitin- protein conjugates in Schistosoma mansoni";
RL   Unpublished.
XX
RN   [3]
RP   1-953
RA   Guerra-Sa R., Franco G.R., Pena S.D.J., Rodrigues V.;
RT   ;
RL   Submitted (30-JAN-1998) to the INSDC.
RL   Parasitologia, Microbiologia e Imunologia, Faculdade de Medicina de
RL   Ribeirao Preto - USP, Avenida dos Bandeirantes, 3900, Ribeirao Preto, SP
RL   14049-900, Brazil
XX
DR   MD5; af4c55bcc0a7a50dbc35df8d3c084ac0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..953
FT                   /organism="Schistosoma mansoni"
FT                   /strain="NMRI"
FT                   /mol_type="mRNA"
FT                   /clone="SMPAA 03"
FT                   /db_xref="taxon:6183"
FT   CDS_pept        <1..888
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:O96413"
FT                   /protein_id="AAD02414.1"
FT                   /translation="GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
FT                   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP
FT                   PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPS
FT                   DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI
FT                   FVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ
FT                   KESTLHLVLRLRGG"
XX
SQ   Sequence 953 BP; 291 A; 173 C; 225 G; 264 T; 0 other;
     ggtaaaacga tcactttgga agttgagccg agtgacacca ttgagaatgt gaaggccaag        60
     atccaagata aagaagggat tccacctgat caacaacgtc tgatctttgc tggtaagcag       120
     ctagaagatg gtcgcacatt gtctgattac aatatccaga aagagtccac tcttcacttg       180
     gtgttgcgtc ttcgtggtgg tatgcagatt tttgtgaaga cattgactgg taaaacgatc       240
     actttggaag ttgagccgag tgacaccatt gagaatgtga aggccaagat ccaagataaa       300
     gaagggattc cacctgatca acaacgtctg atctttgctg gtaagcagct agaagatggt       360
     cgcacattgt ctgattacaa tatccagaaa gagtccactc ttcacttggt gttgcgtctt       420
     cgtggtggta tgcagatttt tgtgaagaca ttgactggta aaacgatcac tttggaagtt       480
     gagccgagtg acaccattga gaatgtgaag gccaagatcc aagataaaga agggattcca       540
     cctgatcaac aacgtctgat ctttgctggt aagcagctag aagatggtcg cacattgtct       600
     gattacaata tccagaaaga gtccactctt cacttggtgt tgcgtcttcg tggtggtatg       660
     cagatttttg tgaagacatt gactggtaaa acgatcactt tggaagttga gccgagtgac       720
     accattgaga atgtgaaggc caagatccaa gataaagaag ggattccacc tgatcaacaa       780
     cgtctgatct ttgctggtaa gcagctagaa gatggtcgca cattgtctga ttacaatatc       840
     cagaaagagt ccactcttca cttggtgttg cgtcttcgtg gtggttaact ttaattttgt       900
     tcatttaact taataaacgt ttaatttaag ttattaaaaa aaaaaaaaaa aaa              953
//

If you have problems or comments...

PBIL Back to PBIL home page