(data stored in ACNUC1829 zone)

EMBL: AF054838

ID   AF054838; SV 1; linear; mRNA; STD; HUM; 1076 BP.
XX
AC   AF054838;
XX
DT   06-APR-1998 (Rel. 55, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens tetraspan TM4SF (TSPAN-1) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1076
RX   DOI; 10.1016/S0167-4781(98)00087-6.
RX   PUBMED; 9714763.
RA   Todd S.C., Doctor V.S., Levy S.;
RT   "Sequences and expression of six new members of the tetraspanin/TM4SF
RT   family";
RL   Biochim. Biophys. Acta 1399(1):101-104(1998).
XX
RN   [2]
RP   1-1076
RA   Todd S.C., Doctor V.S., Levy S.;
RT   ;
RL   Submitted (19-MAR-1998) to the INSDC.
RL   Medicine, Stanford, 300 Pasteur, Stanford, CA 94305-5115, USA
XX
DR   MD5; 2544027ec912f126169bb58fb01e6a37.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1076
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..726
FT                   /codon_start=1
FT                   /gene="TSPAN-1"
FT                   /product="tetraspan TM4SF"
FT                   /note="tetraspanin; transmembrane 4 super family; Tspan-1"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000064590.12"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="AAC69714.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTEQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
XX
SQ   Sequence 1076 BP; 226 A; 278 C; 283 G; 289 T; 0 other;
     atgcagtgct tcagcttcat taagaccatg atgatcctct tcaatttgct catctttctg        60
     tgtggtgcag ccctgttggc agtgggcatc tgggtgtcaa tcgatggggc atcctttctg       120
     aagatcttcg ggccactgtc gtccagtgcc atgcagtttg tcaacgtggg ctacttcctc       180
     atcgcagccg gcgttgtggt ctttgctctt ggtttcctgg gctgctatgg tgctaagact       240
     gagagcaagt gtgccctcgt gacgttcttc ttcatcctcc tcctcatctt cattgctgag       300
     gttgcagctg ctgtggtcgc cttggtgtac accacaatgg ctgagcactt cctgacgttg       360
     ctggtagtgc ctgccatcaa gaaagattat ggttcccagg aagacttcac tcaagtgtgg       420
     aacaccacca tgaaagggct caagtgctgt ggcttcacca actatacgga ttttgaggac       480
     tcaccctact tcaaagagaa cagtgccttt cccccattct gttgcaatga caacgtcacc       540
     aacacagcca atgaaacctg caccgagcaa aaggctcacg accaaaaagt agagggttgc       600
     ttcaatcagc ttttgtatga catccgaact aatgcagtca ccgtgggtgg tgtggcagct       660
     ggaattgggg gcctcgagct ggctgccatg attgtgtcca tgtatctgta ctgcaatcta       720
     caataagtcc acttctgcct ctgccactac tgctgccaca tgggaactgt gaagaggcac       780
     cctggcaagc agcagtgatt gggggagggg acaggatcta acaatgtcac ttgggccaga       840
     atggacctgc cctttctgct ccagacttgg ggctagatag ggaccactcc ttttaggcga       900
     tgctgacttt ccttccattg gtgggtggat gggtgggggg cattccagag cctctaaggt       960
     agccagttct gttgcccatt cccccagtct attaaaccct tgatatgccc cctaggccta      1020
     gtggtgatcc cagtgctcta ctgggggatg agagaaaggc attttatagc ctgggc          1076
//

If you have problems or comments...

PBIL Back to PBIL home page