(data stored in ACNUC31108 zone)

EMBL: AF054841

ID   AF054841; SV 1; linear; mRNA; STD; HUM; 849 BP.
XX
AC   AF054841;
XX
DT   06-APR-1998 (Rel. 55, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens tetraspan TM4SF (TSPAN-4) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-849
RX   DOI; 10.1016/S0167-4781(98)00087-6.
RX   PUBMED; 9714763.
RA   Todd S.C., Doctor V.S., Levy S.;
RT   "Sequences and expression of six new members of the tetraspanin/TM4SF
RT   family";
RL   Biochim. Biophys. Acta 1399(1):101-104(1998).
XX
RN   [2]
RP   1-849
RA   Todd S.C., Doctor V.S., Levy S.;
RT   ;
RL   Submitted (19-MAR-1998) to the INSDC.
RL   Medicine, Stanford, 300 Pasteur, Stanford, CA 94305-5115, USA
XX
DR   MD5; ea0bdbe10d6b04fa1a7eaa601ca7e7d6.
DR   Ensembl-Gn; ENSG00000214063; homo_sapiens.
DR   Ensembl-Tr; ENST00000397397; homo_sapiens.
DR   Ensembl-Tr; ENST00000397404; homo_sapiens.
DR   Ensembl-Tr; ENST00000397406; homo_sapiens.
DR   Ensembl-Tr; ENST00000397408; homo_sapiens.
DR   Ensembl-Tr; ENST00000397411; homo_sapiens.
DR   Ensembl-Tr; ENST00000409543; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..849
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        119..835
FT                   /codon_start=1
FT                   /gene="TSPAN-4"
FT                   /product="tetraspan TM4SF"
FT                   /note="tetraspanin; transmembrane 4 super family; NAG-2;
FT                   Tspan-4"
FT                   /db_xref="GOA:O14817"
FT                   /db_xref="H-InvDB:HIT000064593.12"
FT                   /db_xref="HGNC:HGNC:11859"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O14817"
FT                   /protein_id="AAC69717.1"
FT                   /translation="MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLS
FT                   SSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILF
FT                   FAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
XX
SQ   Sequence 849 BP; 132 A; 284 C; 249 G; 184 T; 0 other;
     gagcttgggg cttccttggt cgcacccacc acctgcctgc ccactggtca gccttcaggg        60
     accctgagca ccgcctggtc tctttcctgt ggccagccca gaactgaagc gctgcggcat       120
     ggcgcgcgcc tgcctccagg ccgtcaagta cctcatgttc gccttcaacc tgctcttctg       180
     gctgggaggc tgtggcgtgc tgggtgtcgg catctggctg gccgccacac aggggagctt       240
     cgccacgctg tcctcttcct tcccgtccct gtcggctgcc aacctgctca tcatcaccgg       300
     cgcctttgtc atggccatcg gtttcgtggg ctgcctgggt gccatcaagg agaacaagtg       360
     cctcctgctc actttcttcc tgctgctgct gctggtgttc ctgctggagg ccaccatcgc       420
     catcctcttc ttcgcctaca cggacaagat tgacaggtat gcccagcaag acctgaagaa       480
     aggcttgcac ctgtacggca cgcagggcaa cgtgggcctc accaacgcct ggagcatcat       540
     ccagaccgac ttccgctgct gtggcgtctc caactacact gactggttcg aggtgtacaa       600
     cgccacgcgg gtacctgact cctgctgctt ggagttcagt gagagctgtg ggctgcacgc       660
     ccccggcacc tggtggaagg cgccgtgcta cgagacggtg aaggtgtggc ttcaggagaa       720
     cctgctggct gtgggcatct ttgggctgtg cacggcgctg gtgcagatcc tgggcctgac       780
     cttcgccatg accatgtact gccaagtggt caaggcagac acctactgcg cgtagccgcc       840
     caccgcccg                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page