(data stored in ACNUC15465 zone)

EMBL: AF055474

ID   AF055474; SV 1; linear; mRNA; STD; HUM; 526 BP.
XX
AC   AF055474;
XX
DT   03-SEP-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens GAGE-7B mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-526
RX   PUBMED; 10397259.
RA   De Backer O., Arden K.C., Boretti M., Vantomme V., De Smet C., Czekay S.,
RA   Viars C.S., De Plaen E., Brasseur F., Chomez P., Van den Eynde B., Boon T.,
RA   van der Bruggen P.;
RT   "Characterization of the GAGE genes that are expressed in various human
RT   cancers and in normal testis";
RL   Cancer Res. 59(13):3157-3165(1999).
XX
RN   [2]
RP   1-526
RA   De Backer O.R.Y.;
RT   ;
RL   Submitted (24-MAR-1998) to the INSDC.
RL   Ludwig Institute for Cancer Research, Brussels Branch, 74 av. Hippocrate,
RL   Brussels B-1200, Belgium
XX
DR   MD5; c902cfd926d83f0f17c028668229691e.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..526
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        55..408
FT                   /codon_start=1
FT                   /product="GAGE-7B"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000064659_06.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAC33677.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 526 BP; 168 A; 109 C; 143 G; 106 T; 0 other;
     tggttcctgc cgtccggact ctttttcctc tactgagatt catctgtgtg aaatatgagt        60
     tggcgaggaa gatcgaccta ttattggcct agaccaaggc gctatgtaca gcctcctgaa       120
     atgattgggc ctatgcggcc cgagcagttc agtgatgaag tggaaccagc aacacctgaa       180
     gaaggggaac cagcaactca acgtcaggat cctgcagctg ctcaggaggg agaggatgag       240
     ggagcatctg caggtcaagg gccgaagcct gaagctcata gccaggaaca gggtcaccca       300
     cagactgggt gtgagtgtga agatggtcct gatgggcagg agatggaccc gccaaatcca       360
     gaggaggtga aaacgcctga agaaggtgaa aagcaatcac agtgttaaaa gaaggcacgt       420
     tgaaatgatg caggctgctc ctatgttgga aatttgttca ttaaaattct cccaataaag       480
     ctttacagcc ttctgcaaag aaaaaaaaaa aaaaaaaaaa aaaaaa                      526
//

If you have problems or comments...

PBIL Back to PBIL home page