(data stored in ACNUC15465 zone)

EMBL: AF055475

ID   AF055475; SV 1; linear; genomic DNA; STD; HUM; 9531 BP.
XX
AC   AF055475;
XX
DT   03-SEP-1998 (Rel. 56, Created)
DT   02-MAY-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Homo sapiens GAGE-7B gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-9531
RX   PUBMED; 10397259.
RA   De Backer O., Arden K.C., Boretti M., Vantomme V., De Smet C., Czekay S.,
RA   Viars C.S., De Plaen E., Brasseur F., Chomez P., Van den Eynde B., Boon T.,
RA   van der Bruggen P.;
RT   "Characterization of the GAGE genes that are expressed in various human
RT   cancers and in normal testis";
RL   Cancer Res. 59(13):3157-3165(1999).
XX
RN   [2]
RP   1-9531
RA   De Backer O.R.Y.;
RT   ;
RL   Submitted (24-MAR-1998) to the INSDC.
RL   Ludwig Institute for Cancer Research, Brussels Branch, 74 av. Hippocrate,
RL   Brussels B-1200, Belgium
XX
DR   MD5; 286a36a9a888586a7d1076dacba5669f.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9531
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<2226..2309,2776..2896,5718..5843,8279..>8301)
FT                   /product="GAGE-8"
FT   CDS_pept        join(2226..2309,2776..2896,5718..5843,8279..8301)
FT                   /codon_start=1
FT                   /product="GAGE-7B"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAC33678.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 9531 BP; 2323 A; 2002 C; 2273 G; 2926 T; 7 other;
     gagctcgctg cagccttgac ctcctgggct caagcgctcc tcccacctca gcctcctgag        60
     tagctgtgag tataggtaca tgccaccatg cncagctaat ttttcgatgg tttttttgtt       120
     tgttttttgt agtgatgaga ttttctgatg ttgcttaggc tggtctcgaa gtcctgagct       180
     caggtgatct ggccagctca gcctcccaaa atactaggat tacaggcgtg anttggcctg       240
     gtctggtttt tcttatatag gggtcttatc tatataaaga ctaaagttaa tctgtgcctt       300
     tgtgcgggtg ggctaagagc atgatgactt ttatcattct attgatttaa agaaaactgt       360
     ccttgactta ccagtgtgta agtccatgaa agcataattc tgttgaaagc atatattgtt       420
     aatgggtgtt gggaaccgtg cactttccgc tgctgtggga gcatgtcctt ggaggtacct       480
     ttcatctgtt ttctcaactc caaacatctt aggaccatgg gttgtgactg gtaggactat       540
     gtatcttgct gctttcaaga cggagtatat tttcacgtgg tgtcactctg gctgtcctgt       600
     ttccctaata ctgtcacttc accctctgcg attctgatgc tacaaatgat agatatcgtt       660
     ttagcatttt cttacgggtc ctagcgattc tattcatttt tctttcagtc tctttctctg       720
     acttgttcac attgaacaat ttccttttgg gataggttgc tatttctgtt ttcgcaggtg       780
     gtttacctgt cttcccagcc agtcacagtg gtccttgtcc ccatggtggg tccggggcaa       840
     gagagggccc tgggttgggg gtggggttca gttgaagatg gggtgagttt tgaggggagc       900
     actacttgag tcccagaggc ataggaaaca gcagagggag gtgggattcc cttatcctca       960
     atgaggatgg gcatggaggg tttggggcgt ggcgctggga acggcagccc tccccagccc      1020
     acagccgcgc atgctccctg ntcccgcctc agtgcgcatg ttcactgggc gtcttctgcc      1080
     cggccccttc gcccacgtga agaacgccag ggagctgtga ggcagtgctg tgtggttcct      1140
     gccgtccgga ctctttttcc tctactgaga ttcatctggt aggtgtgcag gccagtcatc      1200
     ccgggggctg aagtgtgagt gagggtggag agggcctcgg gtgggtcagg cgggtccgtt      1260
     cctggtctgt ggcctccgag ggagaagggc cacgaggtta cgtacctcct tacccttcac      1320
     aggctgcgag gccaccggcg gcttcgtggt cgtgaagggg cctggacggg gaggaaggtg      1380
     ggccgtggag gggaggctgt caggggctca ggtgaagacg gggtgagtgc tgttgggggg      1440
     atggaagtcc cgaggtgccg ggatccccga cgacacaggg cagattccct gaatgggccc      1500
     ggcgggggcg aggcgggcgg tgaagaaggg gcctggcacc tgggaaggct gcggcctggc      1560
     gagcgccccc cccagcggtg tggagtgcgg agcgcccgag tgagaagcac tgcaaggtct      1620
     cacctccgcc atggaaggtc cgaaaacagt gggaaggagt gggcgaggca gtgcggtcca      1680
     accaaacttg ttgtgagggg gggtgaatgg ctctaggaag tgggagtgtg cccaaagcag      1740
     caatcacgag aattgtgatt cactagggtt ttcgtgggga gtgcacttgt gaaactaaac      1800
     ctcatcagaa atgacctctg tctgcggggc gcagtggcgc tcgcctacgt agtcccagtt      1860
     actggggaca ctgaggtggg aggatccctt gagcgggagg tcgaggctgc agtgagctgt      1920
     gatcacgccg ctgcactcca gcctgagcaa cacagcgata ccgcgtgtcc aaaagaaatt      1980
     tagaaaaaaa tgtcctctgc cttttgccac acgccttaag atgattgctc tgccagcctg      2040
     gccagcagaa gtggctttgt aggcactcag acagcgtaca cacgtatgct taactctggg      2100
     acttattttg agagtatttt caaaagtaaa acggcaagtt aacatttatc catggaagtg      2160
     atcgaatata gcagccctgt ggagcgcacg ttcccaatca cggttgtctg ttttcagtgt      2220
     gaaatatgag ttggcgagga agatcgacct attattggcc tagaccaagg cgctatgtac      2280
     agcctcctga aatgattggg cctatgcggg tgagtgctta aacgttaatt cgatgttttc      2340
     tattagtaga aattaatttt tgtgatagcg tcgttgcatt agtgtggaaa tgctgataaa      2400
     ggtctttcct gctcataaaa aatgaggatg gcatctcatg aaggaaacat tgattctgga      2460
     ggattttttt ttttcctctc gtgttcttca gcttttgccc atgacttctt tctccggctt      2520
     tgtttgttaa tgacagattg tacacatgta ttccaacaca gagtataata gcccccaaag      2580
     tcctcgtgcg tcacttttct cacagtaacc tccctgtggg tggagtaacc ttattgggca      2640
     tagagcatag agttggagaa atgtctttag gcttagttag gaccagaaat agctatgtat      2700
     tctgtgtata tatgtaaaat tttgtatcaa taacgaaact tattttttat ttgcacaccc      2760
     acacgtattc cccagcccga gcagttcagt gatgaagtgg aaccagcaac acctgaagaa      2820
     ggggaaccag caactcaacg tcaggatcct gcagctgctc aggagggaga ggatgaggga      2880
     gcatctgcag gtcaaggtga gggaaaggga agaagaacgt ctgctggtgt gtgcgtgtgt      2940
     gtgtgttcgt gtgtgtgtgt gcacgtgtgt gtgtgttagg cattgtcaca taggaggaag      3000
     aggaggaaag aaaacaatgg aaagaatgcc tgaaattgac tggaaaagcg aggaggctat      3060
     gtagtttgca gcttagctta ggcaaatccc tcactatgat aaaagttctc gactttatga      3120
     atgagagaat ggaggtgcca ggattgtgtg ttatccaaga acccttgact ggtgaataca      3180
     acatttgtac tgtgttctaa ggtttgtgtc ttcctatcat gtatgttgct ggaaagaagg      3240
     aagtgatttt gctgaaaatg cttaaaactc aaaaggcttt actgtaaggt agcttagtac      3300
     tgacccaaga atagacccag ttcagaggag caggagcagc tccaaaaacc gagtcgctga      3360
     atgttggccc ccgtttcctt tgattgatat ttttatatgg tacgtttgat aaaagctgga      3420
     taaatgagga tactgccata caggtagctg gtttagtgat ttttctcagc ggcctttagg      3480
     aggtgattaa atccttttat ggttagaaaa gcaaaaacgg aattatcctg agattaacgt      3540
     gagatggaaa taatttctcc gagataaaat gttttgaaag gaagcattta tgtaacggag      3600
     gtcatggatt attccaggga tgcactgtta aaagttccta gaatctgact gacaacaatg      3660
     cccattaatt gctgtccgcc cactccctta ttctcagtgc ggggacagta tattttctgt      3720
     gattcacaaa caatgttata tttggtgctt tgttcttcac ggggttcatt tatggaatat      3780
     tacctttagg accttcggac ctaaatataa ctttatttga acaaagtgaa gtttctcttt      3840
     accccgatag gtaatgggtg tcgtgactgt aagatttcca tagtcctcaa atccatccag      3900
     ctaatcaatc cttcagaaac tgacattgta attgtaactg aaatcctacc cacgtggtag      3960
     acttcagatt tctcagctga cacacactgc tgttggtact ctagggctga atataagcat      4020
     tatacatgtc ctgtggttta tccttagatt gtcatttagg agaaaggtct aaagctgggc      4080
     tgaatgccat gcactcatag tcccagctac ttgggaggcc gaggtgagag gattgcttga      4140
     gtcctggagt tcaagcccag cctgggaaac acagtgagac ctcattgcta ataaataaat      4200
     aaatgaataa ataaataaac acataaataa attcattaaa taaataaagt tttcatggta      4260
     taggaaaaca cagatgcaaa gtttttgtgc ctagtggctg gtaatgttgc aaacgtaact      4320
     ccttagtgaa ctgtaccact ttagttaaga tggtaaattt taggatatct gtatttttta      4380
     ccacaattgg aaattccttt cttcctaaag ttcagtgcag ttatcatata ttcttttaaa      4440
     tttttactgt atgtatcttc aagacataac attcatagaa aatttgcaca gaatagtaca      4500
     atgaactcat atactgttca tctggattca ccaattgtta gtagcctttc gcttcatagg      4560
     tttcacatct cttccctccg tctcttaccg tgctgcccac acactcacac acacacactc      4620
     acacacacat acggatatat gtttactgtt attaatgctg aattgtctcg ataaagtttc      4680
     agggattatg gtcctttacc ctatgtactt gagggtgtgt atatcgtcag aacaaagaga      4740
     aagtcatttc ttggatcatc actgcacaaa gataaaaatc aggaaattta acaatgagaa      4800
     aatggagtca tttaatcaca gagtgcatac tcaaattttc ccagttcccc agaaaatttc      4860
     ttttttcctt ttttttttct ttgttgagac ggagtctccc tctgtgggcc aggttggagg      4920
     gcagtagtgc gatctcggct cactgcaacc tacacctccc aggttctagg gattctcatg      4980
     cctcagcctc ccgtgtagct gggactacag gcgccggcca ctgcggtctt gaacttctgg      5040
     cctcacctgc tctgcccacc ttggcatccc aaaatgtttg gattgcaggc gtgagacccc      5100
     acgcccggcc cagataattt tattgatagg atttcttttt ctgatccaga gtccagttga      5160
     gaatcacacc ttgcatgtgc ctttcaggtg tttttagttt cctttaacct gtaatgtttc      5220
     cttaattttt cttgtcattc acgatacgga catttttgga gaggatagac cagttggttt      5280
     gcagaatatt ctgtagtttg ggctttttca tgtatttttt aaaagagttt tctcactcag      5340
     cgtttattgg tggctactca tgccatgtaa gagtctaagc gctaggagtg taagtgctgt      5400
     gagagacggg atttgagcct tgagtcattt aatacgagaa ggacaatcag aagtagaata      5460
     agagagaagt gcaaaggagg cagcaaagtt gtctgagggc agtcttcgga aaggaggagg      5520
     gtaatatttc gaacaccttg ttttcctgtt ttctgctaac ggactcctga aataatgttc      5580
     ctgggattct tatcaacaca tttattatta cgttagctaa agctctttat ataataatac      5640
     cgagagcatg aatatcattt tcttattcat attttatgtt ttactgctta aattgatacg      5700
     tattttttat ttttaagggc cgaagcctga agctcatagc caggaacagg gtcacccaca      5760
     gactgggtgt gagtgtgaag atggtcctga tgggcaggag atggacccgc caaatccaga      5820
     ggaggtgaaa acgcctgaag aaggtaggca atccattagg catgcacatt gtagggtgtc      5880
     tgtttccaca gtatcatatt gtaactctta ctatgttttt gagacggagt ctcgctctga      5940
     agaccaggct ggagtgcagt ggtgccatct cggctcactg gaaattctgt ctccagggtt      6000
     caagtgattc tcctgcctga gcctctggcg gagccgggct tacaggcatg ctccgccgcg      6060
     cccagctaat tgttgtattt ttagtagaga cagggtttcg ttatgttgca caggttgttc      6120
     ccgaactcct gacctcaggt gatccacctg cctcgaccat tgaaattgcc gggattacag      6180
     gcagagccac cgtgcccgac ccagcattat atttttaata acagagaggt aacaatactg      6240
     cgtctttagt aacagagttc ttatataaag gttatttgaa acgtagttca ggccccagca      6300
     cccggctgat agactgtcag atagggaaac aaagtgagtc aaagctatgt tgaattaaaa      6360
     gttttgagta taaatcctta aaccagtagc tcacaatttt cagatgcttt tgtaaaggtc      6420
     tgcttttaat caatacataa cacgtttgta acacccatca cttggtgtga aaaatgctga      6480
     agcactcatg cgggttctaa taccagctct tacagccttg gcgagattct gagtgagtcc      6540
     tttcccttct aaacctatct ttggttctta tgaaaatagt gagtttaagt cagagacttt      6600
     aaaaccattt tgcattccgt ttctttcata ctctgatcct gttgcataga atgcgtggga      6660
     cacagagatc atctcttcgc atggtttgtt aatcacaaat catgaaaccc tggcccgagt      6720
     catctgaaaa tctctgaatt gagatttcat tgtcagtaag acagtgagcg ggccctctgc      6780
     ttcatcctag tttttccgtg tggagagctg aatacgtagt ataagatctt gtgaaattgt      6840
     gaattctccc tcttcttggt ttgtttgttt gtttgcgaca gagtctcagt gtgtcaccca      6900
     ggctggagtg cagtgatgca atttcagctc actgcaactt ctggctccca gctaaagccg      6960
     tcctcccacc tcagcctccc gagtggctgg aactacatgc acaagccacc gtgcctgact      7020
     acattttttt gttttcattt ttgtagagat gaggtctcac tgtgttgccc aggcagggtt      7080
     tctctggctt ttaatgaaca attgcttctt ttttttcctt ttatttattt attatacttt      7140
     aagttttagg gtacatgtga cgttgtgcag gttagttaca tacgtataca tgtgccatgc      7200
     tgtgcgctgc acccactatc tcatcatcta gcattaggta catctcccag tgctatccct      7260
     cccccctccc cccacccgac aacagtcccc agggtgtgat attccccttc ctctgtccat      7320
     gtgatctcat tgttcagttc ccacctatga gtgagaatat gcggtgtttg gttttttgtt      7380
     cttgcgatag tttactgaga atgatgattt cnagtttcat ccatgtccct acaaaggaca      7440
     tgaactcttc attttttagg gctgcatagt attccatagt gtatatgtgc cacattttct      7500
     taatccagtc tatcgttgtt ggacatttgg gttggttcca agtctttgct atcgtgaata      7560
     atgccgcaat aaacatacgt gtgcacgtgt ctttatagca gcatgattta tagtcctttg      7620
     ggtatatacc cagtaatggg atggctgggt caaatggtac aattgcttct taaatctttc      7680
     cccacggaaa ccttgagtga ctgaaataaa tatcaaatgg cgagagaccg tttagttcgt      7740
     atcatctgtg gcatgtaggt cagtgatgct cagcatgggt gtgagtaaga tgcctgtgct      7800
     atgcatgctc cctgccccac tgtcagtctt catgagccac tatttctaat aagactgtag      7860
     acacacatac gatataatca tctctaatca tatcaaatgt tacatgtaag tttcagcttt      7920
     agagacatga attgataaga tttaaagttg aaagaccatg actctagtac ttcctgagta      7980
     atcaactgaa gtatgcttta cacatgtgtt ttccaaattg ctgactgtta attgtaagtg      8040
     cttgtgactt gaaaggaagc acatgatgtt cagggaggaa attcctttta aattctgcag      8100
     gtctacgctc aaagtttatg cagaggttca attgcgtgta agacacggga tcacccatag      8160
     ggttctgttt ttagtccatt taataaaacc caaactgtag tgtgctttgt atgcctttag      8220
     ggtcatctga ataatctgtt gctaagtcat gttcccaatc gttgtgtttc tgttacaggt      8280
     gaaaagcaat cacagtgtta aaagaaggca cgttgaaatg atgcaggctg ctcctatgtt      8340
     ggaaatttgt tcattaaaat tctcccaata aagctttaca gccttctgca aagaagtctt      8400
     gcgcatcttt tgtgaagttt atttctagct ttttgatgct gtgaaatatg tatcattctt      8460
     tgaaatcgtg tattgtaact ctctgagctg gtatgtagag acatcgttct tttttttttt      8520
     ctttctttct ttgtcctctt ttgagacgga gtcttgctct gtcgcccagg ctggagtgca      8580
     gtggcgcgat ctctgctcac tgcaaccccg cctcccggat tcaagcaatt gtctgcctca      8640
     gcctcccgag tagctgggat tataggcacc caccagcacg ccctggctaa gttttgtgtt      8700
     tttactagag atggtttcgc atcttggccg gggtgctctt gaactcctga cctcgtgatt      8760
     cacctgcctt ggcctcccaa agtgctggga ttacaggcat gcacgcctcc gcgcccggtg      8820
     gagacataat tcttacatat tggttttcta tccagcggcc ttgtgaaata tgcttgtgaa      8880
     ttctaaagtt tacttctagg tcgttttcag tcttcaatat acagaaacat atcatcctgg      8940
     aataagagca gttttgtttc cgccattttt ttttgttttt ccttttgtac tttttttgta      9000
     gagacggggt tttgccatgt ttcccgggct gttgttgnnn ttttgagtgc aagtgatgca      9060
     cccacgtcac ctcccacagt gctgggatta ctggcgtggg ccaggggcca cccgtggcgg      9120
     gccccgtcgt tgccattgta aagagtttta tttccttttc tgattttatg gcattgcgca      9180
     gacccacccg ttacaatggt gacagtggac atccttgtct tatccctgat gagaaaccga      9240
     aaaatttcaa catttcgcca tcctattcac tctccttttt ttgtagacgg actttatcag      9300
     agtgagtcat tgcattctgt tccaaatttg ctgagagtat tcatttgaat atatgttgat      9360
     tttcatcaaa cagtgcatct atttcgatta ccacagcgtt ttttcccatt catgggttaa      9420
     tatagtgaat tcgattgata aatttgtacg tttttaggtt cgattattaa aacttgagac      9480
     agcgtctcac tctgtcaccg aggctggagt gcggtggtgt tatcagagct c               9531
//

If you have problems or comments...

PBIL Back to PBIL home page