(data stored in ACNUC15465 zone)

EMBL: AF058988

ID   AF058988; SV 1; linear; mRNA; STD; HUM; 524 BP.
XX
AC   AF058988;
XX
DT   13-JUL-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens melanoma antigen related GAGE-7 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-524
RX   DOI; 10.1074/jbc.273.28.17618.
RX   PUBMED; 9651357.
RA   Chen M.E., Lin S.-H., Chung L.W.K., Sikes R.A.;
RT   "Isolation and characterization of PAGE-1 and GAGE-7. New genes expressed
RT   in the LNCaP prostate cancer progression model that share homology with
RT   melanoma-associated antigens";
RL   J Biol Chem 273(28):17618-17625(1998).
XX
RN   [2]
RP   1-524
RA   Chen M.E., Lin S.-H., Chung L.W.K., Sikes R.A.;
RT   ;
RL   Submitted (07-APR-1998) to the INSDC.
RL   Urology, University of Virginia, Box 422, Charlottesville, VA 22908, USA
XX
DR   MD5; 7c38219c0b38b0da17c34295b316ff07.
DR   Ensembl-Gn; ENSG00000215269; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236362; homo_sapiens.
DR   Ensembl-Tr; ENST00000440137; homo_sapiens.
DR   Ensembl-Tr; ENST00000445148; homo_sapiens.
DR   Ensembl-Tr; ENST00000639028; homo_sapiens.
DR   EuropePMC; PMC2244258; 12463799.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..524
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="LNCaP; C4-2"
FT                   /note="isolated from prostate cancer cell lines by
FT                   differential display PCR; expression pattern correlates
FT                   with progression from androgen sensitive to androgen
FT                   insensitive in the human prostate cancer progression model
FT                   LNCaP to C4-2"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        80..433
FT                   /codon_start=1
FT                   /product="melanoma antigen related GAGE-7"
FT                   /note="similar to GAGE family of melanoma antigens"
FT                   /db_xref="GOA:O76087"
FT                   /db_xref="H-InvDB:HIT000064816_06.4"
FT                   /db_xref="HGNC:HGNC:4104"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:O76087"
FT                   /protein_id="AAC25989.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
XX
SQ   Sequence 524 BP; 146 A; 113 C; 152 G; 111 T; 2 other;
     cagggagctg tgaggcagts ctgtgyggtt cctgccgtcc ggactctttt tcctctactg        60
     agattcatct gtgtgaaata tgagttggcg aggaagatcg acctattatt ggcctagacc       120
     aaggcgctat gtacagcctc ctgaaatgat tgggcctatg cggcccgagc agttcagtga       180
     tgaagtggaa ccagcaacac ctgaagaagg ggaaccagca actcaacgtc aggatcctgc       240
     agctgctcag gagggagagg atgagggagc atctgcaggt caagggccga agcctgaagc       300
     tcatagccag gaacagggtc acccacagac tgggtgtgag tgtgaagatg gtcctgatgg       360
     gcaggagatg gacccgccaa atccagagga ggtgaaaacg cctgaagaag gtgaaaagca       420
     atcacagtgt taaaagaagg cacgttgaaa tgatgcaggc tgctcctatt ttggaaattt       480
     gttcattaaa attctcccaa taaagcttta cagccttctg caaa                        524
//

If you have problems or comments...

PBIL Back to PBIL home page