(data stored in ACNUC8465 zone)

EMBL: AF060943

ID   AF060943; SV 1; linear; mRNA; STD; MUS; 1578 BP.
XX
AC   AF060943;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus MAP kinase kinase 7 alpha 2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1578
RX   PUBMED; 9891090.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases";
RL   Mol. Cell. Biol. 19(2):1569-1581(1999).
XX
RN   [2]
RP   1-1578
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (23-APR-1998) to the INSDC.
RL   Program in Molecular Medicine, HHMI & UMASS Medical School, 373 Plantation
RL   Street, Worcester, MA 01605, USA
XX
DR   MD5; bf6c130662b2b0d433232d2381402834.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC116085; 9891090.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1578
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        281..1423
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 7 alpha 2"
FT                   /function="activates JNK group of MAP kinases"
FT                   /note="MKK7alpha2; MKK7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAD15819.1"
FT                   /translation="MLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEIN
FT                   DLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCP
FT                   YIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEK
FT                   HGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPT
FT                   KPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQ
FT                   SFVKDCLTKDHRKRPKYNKLLEHSFIIKHYEILEVDVASWFKDVMAKTESPRTSGVLSQ
FT                   HHLPFFSGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR"
XX
SQ   Sequence 1578 BP; 393 A; 454 C; 387 G; 344 T; 0 other;
     ggaaaggcag cctcctgtag gtgaaaattc tgttcactac ctggccacct ggcctgactg        60
     accttcacag cttgatcatc ttcctgaaga ggcattcagg attccctcca tccctacccc       120
     ttctggacaa agtcttccac gtttccttcc tgggagtttc ttccaggaac tggagatacc       180
     cagagccctg caactcccac tggccaacga tgggggcagc cgctcaccat cctcagagag       240
     ctccccacag caccctacac cccccacccg gccccgccac atgctggggc tcccatcaac       300
     cttgttcaca ccgcgcagta tggagagcat cgagattgac cagaagctgc aggagatcat       360
     gaagcagaca gggtacctga ctatcggggg ccagcgttat caggcagaaa tcaatgactt       420
     ggagaacttg ggtgagatgg gcagtggtac ctgtggtcag gtgtggaaga tgcggttccg       480
     gaagacaggc cacatcattg ctgttaagca aatgcggcgc tctgggaaca aggaagagaa       540
     taagcgcatt ttgatggacc tggatgtagt actcaagagc catgactgcc cttacatcgt       600
     tcagtgcttt ggcaccttca tcaccaacac agacgtcttt attgccatgg agctcatggg       660
     cacatgtgca gagaagctga agaaacgaat gcagggcccc attccagagc gaatcctggg       720
     caagatgact gtggcgattg tgaaagcact gtactatctg aaggagaagc atggcgtcat       780
     ccatcgcgat gtcaaaccct ccaacatcct gctagatgag cggggccaga tcaagctctg       840
     tgactttggc atcagtggcc gccttgttga ctccaaagcc aaaacacgga gtgctggctg       900
     tgctgcctat atggctcccg agcgcatcga ccctccagat cccaccaagc ctgactatga       960
     catccgagct gatgtgtgga gcctgggcat ctcactggtg gagctggcaa caggacagtt      1020
     cccctataag aactgcaaga cggactttga ggtcctcacc aaagtcctac aggaagagcc      1080
     cccactcctg cctggtcaca tgggcttctc aggggacttc cagtcatttg tcaaagactg      1140
     ccttactaaa gatcacagga agagaccaaa gtataataag ctacttgaac acagcttcat      1200
     catcaagcac tatgagatac tcgaggtgga tgtcgcgtcc tggtttaagg atgtcatggc      1260
     gaagaccgag tccccaagga ctagtggagt cctgagtcag caccatctgc ccttcttcag      1320
     tgggagtctg gaggagtctc ccacttcccc accttctccc aagtccttcc ctctgtcacc      1380
     agccatccct caggcccagg cagagtgggt ctcgggcagg tagggacctg gagtggcctg      1440
     gtcccaccct ctgacctcct cctcaggcca ccagtgttgc cctcttccct ttttaaaaca      1500
     aaataccctt gtttgtaaat ccttagacgc ttgagaataa aacccttccc ttttcttccg      1560
     aaaaaaaaaa aaaaaaaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page