(data stored in ACNUC8465 zone)

EMBL: AF060944

ID   AF060944; SV 1; linear; mRNA; STD; MUS; 1643 BP.
XX
AC   AF060944;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus MAP kinase kinase 7 beta 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1643
RX   PUBMED; 9891090.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases";
RL   Mol. Cell. Biol. 19(2):1569-1581(1999).
XX
RN   [2]
RP   1-1643
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (23-APR-1998) to the INSDC.
RL   Program in Molecular Medicine, HHMI & UMASS Medical School, 373 Plantation
RL   Street, Worcester, MA 01605, USA
XX
DR   MD5; 73ef39f6857c8458f2a139e62f8c8727.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC116085; 9891090.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1643
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        82..1341
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 7 beta 1"
FT                   /function="activates JNK group of MAP kinases"
FT                   /note="MKK7beta1; MKK7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAD15820.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQL
FT                   PLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
FT                   YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRI
FT                   LMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKM
FT                   TVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCA
FT                   AYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEP
FT                   PLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMA
FT                   KTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1643 BP; 413 A; 481 C; 456 G; 293 T; 0 other;
     agcgcaggcg cagtgcggtg tttgtctacc ccggactgac gggtggcctg gcggtgagcg        60
     gcggcagcgg cggcggggaa gatggcggcg tcctccctgg agcagaagct gtcccgcctg       120
     gaagccaagc tgaagcagga gaaccgtgag gcccgcagga ggatcgacct caacttggat       180
     atcagcccac agcggcccag gcccaccctg caactcccac tggccaacga tgggggcagc       240
     cgctcaccat cctcagagag ctccccacag caccctacac cccccacccg gccccgccac       300
     atgctggggc tcccatcaac cttgttcaca ccgcgcagta tggagagcat cgagattgac       360
     cagaagctgc aggagatcat gaagcagaca gggtacctga ctatcggggg ccagcgttat       420
     caggcagaaa tcaatgactt ggagaacttg ggtgagatgg gcagtggtac ctgtggtcag       480
     gtgtggaaga tgcggttccg gaagacaggc cacatcattg ctgttaagca aatgcggcgc       540
     tctgggaaca aggaagagaa taagcgcatt ttgatggacc tggatgtagt actcaagagc       600
     catgactgcc cttacatcgt tcagtgcttt ggcaccttca tcaccaacac agacgtcttt       660
     attgccatgg agctcatggg cacatgtgca gagaagctga agaaacgaat gcagggcccc       720
     attccagagc gaatcctggg caagatgact gtggcgattg tgaaagcact gtactatctg       780
     aaggagaagc atggcgtcat ccatcgcgat gtcaaaccct ccaacatcct gctagatgag       840
     cggggccaga tcaagctctg tgactttggc atcagtggcc gccttgttga ctccaaagcc       900
     aaaacacgga gtgctggctg tgctgcctat atggctcccg agcgcatcga ccctccagat       960
     cccaccaagc ctgactatga catccgagct gatgtgtgga gcctgggcat ctcactggtg      1020
     gagctggcaa caggacagtt cccctataag aactgcaaga cggactttga ggtcctcacc      1080
     aaagtcctac aggaagagcc cccactcctg cctggtcaca tgggcttctc aggggacttc      1140
     cagtcatttg tcaaagactg ccttactaaa gatcacagga agagaccaaa gtataataag      1200
     ctacttgaac acagcttcat caagcactat gagatactcg aggtggatgt cgcgtcctgg      1260
     tttaaggatg tcatggcgaa gaccgagtcc ccaaggacta gtggagtcct gagtcagcac      1320
     catctgccct tcttcaggta gcctcatggc agcggccagc cccgcagggg ccccgggcca      1380
     cggccaccga cccccccccc aacctggcca acccagctgc ccatcagggg acctgggacc      1440
     tggacgactg ccaaggactg aggacagaaa gtagggggtt cccatccagc tctgactccc      1500
     tgcctaccag ctgtggacaa aagggcatgc tggttcctaa tccctcccac tctggggtca      1560
     gccagcagtg tgagccccat cccaccccga cagacactgt gaacggaaga cagcaggcca      1620
     aaaaaaaaaa aaaaaaaaaa aaa                                              1643
//

If you have problems or comments...

PBIL Back to PBIL home page