(data stored in ACNUC8465 zone)

EMBL: AF060946

ID   AF060946; SV 1; linear; mRNA; STD; MUS; 1682 BP.
XX
AC   AF060946;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus MAP kinase kinase 7 gamma 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1682
RX   PUBMED; 9891090.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases";
RL   Mol. Cell. Biol. 19(2):1569-1581(1999).
XX
RN   [2]
RP   1-1682
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (23-APR-1998) to the INSDC.
RL   Program in Molecular Medicine, HHMI & UMASS Medical School, 373 Plantation
RL   Street, Worcester, MA 01605, USA
XX
DR   MD5; ee3ba10eb678e0135341f9773759814a.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC116085; 9891090.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1682
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        82..1389
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 7 gamma 1"
FT                   /function="activates JNK group of MAP kinases"
FT                   /note="MKK7gamma1; MKK7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAD15822.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVI
FT                   TLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSME
FT                   SIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIA
FT                   VKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKL
FT                   KKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGIS
FT                   GRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKN
FT                   CKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHY
FT                   EILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR"
XX
SQ   Sequence 1682 BP; 416 A; 497 C; 464 G; 305 T; 0 other;
     agcgcaggcg cagtgcggtg tttgtctacc ccggactgac gggtggcctg gcggtgagcg        60
     gcggcagcgg cggcggggaa gatggcggcg tcctccctgg agcagaagct gtcccgcctg       120
     gaagccaagc tgaagcagga gaaccgtgag gcccgcagga ggatcgacct caacttggat       180
     atcagcccac agcggcccag gcccattatt gtgatcactc taagccctgc tcctgccccg       240
     tcccagcgag cagccctgca actcccactg gccaacgatg ggggcagccg ctcaccatcc       300
     tcagagagct ccccacagca ccctacaccc cccacccggc cccgccacat gctggggctc       360
     ccatcaacct tgttcacacc gcgcagtatg gagagcatcg agattgacca gaagctgcag       420
     gagatcatga agcagacagg gtacctgact atcgggggcc agcgttatca ggcagaaatc       480
     aatgacttgg agaacttggg tgagatgggc agtggtacct gtggtcaggt gtggaagatg       540
     cggttccgga agacaggcca catcattgct gttaagcaaa tgcggcgctc tgggaacaag       600
     gaagagaata agcgcatttt gatggacctg gatgtagtac tcaagagcca tgactgccct       660
     tacatcgttc agtgctttgg caccttcatc accaacacag acgtctttat tgccatggag       720
     ctcatgggca catgtgcaga gaagctgaag aaacgaatgc agggccccat tccagagcga       780
     atcctgggca agatgactgt ggcgattgtg aaagcactgt actatctgaa ggagaagcat       840
     ggcgtcatcc atcgcgatgt caaaccctcc aacatcctgc tagatgagcg gggccagatc       900
     aagctctgtg actttggcat cagtggccgc cttgttgact ccaaagccaa aacacggagt       960
     gctggctgtg ctgcctatat ggctcccgag cgcatcgacc ctccagatcc caccaagcct      1020
     gactatgaca tccgagctga tgtgtggagc ctgggcatct cactggtgga gctggcaaca      1080
     ggacagttcc cctataagaa ctgcaagacg gactttgagg tcctcaccaa agtcctacag      1140
     gaagagcccc cactcctgcc tggtcacatg ggcttctcag gggacttcca gtcatttgtc      1200
     aaagactgcc ttactaaaga tcacaggaag agaccaaagt ataataagct acttgaacac      1260
     agcttcatca agcactatga gatactcgag gtggatgtcg cgtcctggtt taaggatgtc      1320
     atggcgaaga ccgagtcccc aaggactagt ggagtcctga gtcagcacca tctgcccttc      1380
     ttcaggtagc ctcatggcag cggccagccc cgcaggggcc ccgggccacg gccaccgacc      1440
     ccccccccaa cctggccaac ccagctgccc atcaggggac ctgggacctg gacgactgcc      1500
     aaggactgag gacagaaagt agggggttcc catccagctc tgactccctg cctaccagct      1560
     gtggacaaaa gggcatgctg gttcctaatc cctcccactc tggggtcagc cagcagtgtg      1620
     agccccatcc caccccgaca gacactgtga acggaagaca gcaaaaaaaa aaaaaaaaaa      1680
     aa                                                                     1682
//

If you have problems or comments...

PBIL Back to PBIL home page