(data stored in ACNUC8465 zone)

EMBL: AF060947

ID   AF060947; SV 1; linear; mRNA; STD; MUS; 1646 BP.
XX
AC   AF060947;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus MAP kinase kinase 7 gamma 2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1646
RX   PUBMED; 9891090.
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   "The MKK7 gene encodes a group of c-Jun NH2-terminal kinase kinases";
RL   Mol. Cell. Biol. 19(2):1569-1581(1999).
XX
RN   [2]
RP   1-1646
RA   Tournier C., Whitmarsh A.J., Cavanagh J., Barrett T., Davis R.J.;
RT   ;
RL   Submitted (23-APR-1998) to the INSDC.
RL   Program in Molecular Medicine, HHMI & UMASS Medical School, 373 Plantation
RL   Street, Worcester, MA 01605, USA
XX
DR   MD5; b079fda39f45f26c01175822c81700ae.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC116085; 9891090.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1646
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A2"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        82..1491
FT                   /codon_start=1
FT                   /product="MAP kinase kinase 7 gamma 2"
FT                   /function="activates JNK group of MAP kinases"
FT                   /note="MKK7gamma2; MKK7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="AAD15823.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVI
FT                   TLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSME
FT                   SIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIA
FT                   VKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKL
FT                   KKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGIS
FT                   GRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKN
FT                   CKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIIKH
FT                   YEILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAI
FT                   PQAQAEWVSGR"
XX
SQ   Sequence 1646 BP; 400 A; 477 C; 436 G; 333 T; 0 other;
     agcgcaggcg cagtgcggtg tttgtctacc ccggactgac gggtggcctg gcggtgagcg        60
     gcggcagcgg cggcggggaa gatggcggcg tcctccctgg agcagaagct gtcccgcctg       120
     gaagccaagc tgaagcagga gaaccgtgag gcccgcagga ggatcgacct caacttggat       180
     atcagcccac agcggcccag gcccattatt gtgatcactc taagccctgc tcctgccccg       240
     tcccagcgag cagccctgca actcccactg gccaacgatg ggggcagccg ctcaccatcc       300
     tcagagagct ccccacagca ccctacaccc cccacccggc cccgccacat gctggggctc       360
     ccatcaacct tgttcacacc gcgcagtatg gagagcatcg agattgacca gaagctgcag       420
     gagatcatga agcagacagg gtacctgact atcgggggcc agcgttatca ggcagaaatc       480
     aatgacttgg agaacttggg tgagatgggc agtggtacct gtggtcaggt gtggaagatg       540
     cggttccgga agacaggcca catcattgct gttaagcaaa tgcggcgctc tgggaacaag       600
     gaagagaata agcgcatttt gatggacctg gatgtagtac tcaagagcca tgactgccct       660
     tacatcgttc agtgctttgg caccttcatc accaacacag acgtctttat tgccatggag       720
     ctcatgggca catgtgcaga gaagctgaag aaacgaatgc agggccccat tccagagcga       780
     atcctgggca agatgactgt ggcgattgtg aaagcactgt actatctgaa ggagaagcat       840
     ggcgtcatcc atcgcgatgt caaaccctcc aacatcctgc tagatgagcg gggccagatc       900
     aagctctgtg actttggcat cagtggccgc cttgttgact ccaaagccaa aacacggagt       960
     gctggctgtg ctgcctatat ggctcccgag cgcatcgacc ctccagatcc caccaagcct      1020
     gactatgaca tccgagctga tgtgtggagc ctgggcatct cactggtgga gctggcaaca      1080
     ggacagttcc cctataagaa ctgcaagacg gactttgagg tcctcaccaa agtcctacag      1140
     gaagagcccc cactcctgcc tggtcacatg ggcttctcag gggacttcca gtcatttgtc      1200
     aaagactgcc ttactaaaga tcacaggaag agaccaaagt ataataagct acttgaacac      1260
     agcttcatca tcaagcacta tgagatactc gaggtggatg tcgcgtcctg gtttaaggat      1320
     gtcatggcga agaccgagtc cccaaggact agtggagtcc tgagtcagca ccatctgccc      1380
     ttcttcagtg ggagtctgga ggagtctccc acttccccac cttctcccaa gtccttccct      1440
     ctgtcaccag ccatccctca ggcccaggca gagtgggtct cgggcaggta gggacctgga      1500
     gtggcctggt cccaccctct gacctcctcc tcaggccacc agtgttgccc tcttcccttt      1560
     ttaaaacaaa atacccttgt ttgtaaatcc ttagacgctt gagaataaaa cccttccctt      1620
     ttcttccgaa aaaaaaaaaa aaaaaa                                           1646
//

If you have problems or comments...

PBIL Back to PBIL home page