(data stored in ACNUC3659 zone)

EMBL: AF063851

ID   AF063851; SV 1; linear; mRNA; STD; ROD; 953 BP.
XX
AC   AF063851;
XX
DT   20-MAY-1998 (Rel. 55, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Rattus norvegicus vascular chymase (VCH) mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-953
RX   DOI; 10.1172/JCI9997.
RX   PUBMED; 11254670.
RA   Guo C., Ju H., Leung D., Massaeli H., Shi M., Rabinovitch M.;
RT   "A novel vascular smooth muscle chymase is upregulated in hypertensive
RT   rats";
RL   J. Clin. Invest. 107(6):703-715(2001).
XX
RN   [2]
RP   1-953
RA   Guo C.;
RT   ;
RL   Submitted (06-MAY-1998) to the INSDC.
RL   Division of Cardiovascular Research, The Hospital for Sick Children, 555
RL   University Avenue, Toronto, ON M5G 1X8, Canada
XX
DR   MD5; 157f272d6b9fd7bcc08748d45e3a8482.
DR   Ensembl-Gn; ENSRNOG00000020625; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000027931; rattus_norvegicus.
DR   EuropePMC; PMC208939; 11254670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..953
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /cell_type="smooth muscle cells"
FT                   /tissue_type="pulmonary artery"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        34..777
FT                   /codon_start=1
FT                   /gene="VCH"
FT                   /product="vascular chymase"
FT                   /db_xref="GOA:O70500"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:O70500"
FT                   /protein_id="AAC16657.1"
FT                   /translation="MQALLFLMALLLPSGAGAEEIIGGVESIPHSRPYMAHLDIITERG
FT                   LKDSCGGFLITRQFVLTAAHCRGREITVTLGAHDVSKREYTQQKIKVEKQFIHKNYNFL
FT                   PNLHDIMLLKLEKQVELTPAVDVVPLPSPSDFIHPGTLCWTAGWGRTGVKDPTSDTLRE
FT                   VALRIMDEEACKIYRHYDNNFQVCVGLSTRLQTAYTGDSGGPLLCAGVVHGIVSYGHPD
FT                   ATPPAVFTRIAPYVPWINTVLRESS"
XX
SQ   Sequence 953 BP; 250 A; 237 C; 220 G; 246 T; 0 other;
     gagaagctca ccccaggctg caccactggc aaaatgcagg ccctactatt cctgatggct        60
     cttctcttgc cttctggagc tggagctgag gagattattg gtggtgtgga gtctattcca       120
     cactcccgcc cttacatggc ccatctggac atcatcactg agagaggttt aaaggacagc       180
     tgtggtgggt ttctcataac ccgccaattt gtgctgactg ctgcacactg cagaggaaga       240
     gaaatcacag tcacccttgg agcccatgac gtgagcaagc gagaatacac acagcagaag       300
     ataaaagtag aaaaacaatt cattcataaa aattacaact tccttcccaa tcttcatgac       360
     atcatgttac tgaagcttga aaaacaagtt gagttgactc ctgctgtgga tgtagttccc       420
     ctgcctagtc cttctgactt tattcaccct gggacattgt gttggactgc tggatggggg       480
     cgaactggag tgaaagatcc tacctcagat acactgagag aggttgcact gagaatcatg       540
     gatgaagagg cctgtaaaat ctatagacat tatgacaaca acttccaggt ctgcgtgggc       600
     ctttccacaa ggttacaaac agcatacact ggagactctg gtgggccgct actgtgtgct       660
     ggtgtggtcc atggtattgt atcttatggg catccagatg caacgccccc tgcagtcttc       720
     acccgaatcg ccccctatgt gccctggatt aatacagtct taagggaaag tagctgaaaa       780
     gcttgacctg cctgcgacag actctccaag cctgaggtct tatagtatcc tttgggttca       840
     acatagtttg tccccaacct gtccccagct ctctctttga ggctctcaaa gatacacaag       900
     tctgtgatga tggattgttc cctgtaaagc acctcaataa agacataatt tcc              953
//

If you have problems or comments...

PBIL Back to PBIL home page