(data stored in ACNUC1829 zone)

EMBL: AF065388

ID   AF065388; SV 1; linear; mRNA; STD; HUM; 1278 BP.
XX
AC   AF065388;
XX
DT   26-MAY-1998 (Rel. 55, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens tetraspan NET-1 mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1278
RX   DOI; 10.1016/S0167-4838(00)00022-4.
RX   PUBMED; 10719184.
RA   Serru V., Dessen P., Boucheix C., Rubinstein E.;
RT   "Sequence and expression of seven new tetraspans";
RL   Biochim. Biophys. Acta 1478(1):159-163(2000).
XX
RN   [2]
RP   1-1278
RA   Rubinstein E., Serru V., Boucheix C.;
RT   ;
RL   Submitted (14-MAY-1998) to the INSDC.
RL   INSERM U268, 14 av Paul Vaillant Couturier, Villejuif 94807, France
XX
DR   MD5; 5f742b07d42a506be339adec8c4c3328.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
DR   EuropePMC; PMC1236915; 16143040.
DR   EuropePMC; PMC2682244; 19437569.
DR   EuropePMC; PMC316542; 10783169.
DR   EuropePMC; PMC5770608; 29422958.
DR   EuropePMC; PMC5790528; 29423111.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1278
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="IMAGE ID 511239"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        122..847
FT                   /codon_start=1
FT                   /product="tetraspan NET-1"
FT                   /note="similar to Tspan-1; TM4SF"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000065520.12"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="AAC17119.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
XX
SQ   Sequence 1278 BP; 280 A; 335 C; 329 G; 334 T; 0 other;
     gccaggcgtc cctctgcctg cccactcagt ggcaacaccc gggagctgtt ttgtcctttg        60
     tggagcctca gcagttccct ctttcagaac tcactgccaa gagccctgaa caggagccac       120
     catgcagtgc ttcagcttca ttaagaccat gatgatcctc ttcaatttgc tcatctttct       180
     gtgtggtgca gccctgttgg cagtgggcat ctgggtgtca atcgatgggg catcctttct       240
     gaagatcttc gggccactgt cgtccagtgc catgcagttt gtcaacgtgg gctacttcct       300
     catcgcagcc ggcgttgtgg tctttgctct tggtttcctg ggctgctatg gtgctaagac       360
     tgagagcaag tgtgccctcg tgacgttctt cttcatcctc ctcctcatct tcattgctga       420
     ggttgcagct gctgtggtcg ccttggtgta caccacaatg gctgagcact tcctgacgtt       480
     gctggtagtg cctgccatca agaaagatta tggttcccag gaagacttca ctcaagtgtg       540
     gaacaccacc atgaaagggc tcaagtgctg tggcttcacc aactatacgg attttgagga       600
     ctcaccctac ttcaaagaga acagtgcctt tcccccattc tgttgcaatg acaacgtcac       660
     caacacagcc aatgaaacct gcaccaagca aaaggctcac gaccaaaaag tagagggttg       720
     cttcaatcag cttttgtatg acatccgaac taatgcagtc accgtgggtg gtgtggcagc       780
     tggaattggg ggcctcgagc tggctgccat gattgtgtcc atgtatctgt actgcaatct       840
     acaataagtc cacttctgcc tctgccacta ctgctgccac atgggaactg tgaagaggca       900
     ccctggcaag cagcagtgat tgggggaggg gacaggatct aacaatgtca cttgggccag       960
     aatggacctg ccctttctgc tccagacttg gggctagata gggaccactc cttttaggcg      1020
     atgcctgact ttccttccat tggtgggtgg atgggtgggg ggcattccag agcctctaag      1080
     gtagccagtt ctgttgccca ttcccccagt ctattaaacc cttgatatgc cccctaggcc      1140
     tagtggtgat cccagtgctc tactggggga tgagagaaag gcattttata gcctgggcat      1200
     aagtgaaatc agcagagcct ctgggtggat gtgtagaagg cacttcaaaa tgcataaacc      1260
     tgttacaatg ttaaaaaa                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page