(data stored in ACNUC23405 zone)

EMBL: AF066860

ID   AF066860; SV 1; linear; mRNA; STD; VRT; 1100 BP.
XX
AC   AF066860;
XX
DT   22-OCT-1998 (Rel. 57, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Gallus gallus homeodomain protein (MNR2) mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1100
RX   DOI; 10.1016/S0092-8674(00)81783-3.
RX   PUBMED; 9778248.
RA   Tanabe Y., William C., Jessell T.M.;
RT   "Specification of motor neuron identity by the MNR2 homeodomain protein";
RL   Cell 95(1):67-80(1998).
XX
RN   [2]
RP   1-1100
RA   Tanabe Y., William C., Jessell T.M.;
RT   ;
RL   Submitted (19-MAY-1998) to the INSDC.
RL   HHMI, Columbia University, 701 West 168th Street, New York, NY 10032, USA
XX
DR   MD5; 6691b4078450f162a3ce2b096af43190.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1100
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        1..903
FT                   /codon_start=1
FT                   /gene="MNR2"
FT                   /product="homeodomain protein"
FT                   /db_xref="GOA:Q9YHY8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YHY8"
FT                   /protein_id="AAC64924.1"
FT                   /translation="MHKPMEKSQNFRIEALLAEKPPRSASPPGLSPAGSPGPAGRTDTP
FT                   SPRAPQAATPLGPAGFVPKPGLLHLPGPGLGTLPALYPPAVYPLPALGGQHAAFAYTAF
FT                   PQLPPPGAEHLKAAVAGSFPLEQWIRAGMLVPRLSDFHATPQSALMGKSRRPRTAFTSQ
FT                   QLLELENQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSRKAKEQGMAVE
FT                   PEKPRGLGKADESLLPSQPQGQAGDSPEFVGCSPGTGFLCRSAELGYDPDSSCSGGEED
FT                   EEEEDDGMDTAERKMGSVL"
XX
SQ   Sequence 1100 BP; 186 A; 376 C; 352 G; 186 T; 0 other;
     atgcacaaac ccatggagaa gtcccaaaac ttccgcatcg aggcgctcct ggctgagaag        60
     ccgccgcgga gcgcctctcc tccggggctc agccccgcgg gcagccccgg ccccgccggc       120
     cgtaccgaca ccccctcgcc tcgggctccc caggccgcca cccccctcgg cccggcgggc       180
     ttcgtcccca aacccggctt gctgcacctc cccggccccg ggctgggcac cctgccggcc       240
     ctctacccgc ctgccgtgta cccgctgccg gccttggggg gccagcacgc cgctttcgcc       300
     tacaccgcct tcccccagct gccgccgccc ggcgccgagc acctgaaggc ggcggtggcc       360
     ggttccttcc cgctggagca gtggatccga gccgggatgc tcgtgccgag gctctccgac       420
     ttccacgcca ccccacagtc cgccttgatg ggaaagtcgc gccggccccg caccgccttc       480
     accagccagc agctgctgga gctggagaac cagttcaagc tcaacaagta tctgtccagg       540
     cccaagcgct tcgaggtggc cacgtcgctg atgctcactg agacgcaggt gaagatctgg       600
     ttccagaacc gccgcatgaa gtggaagcgg agccgcaaag ccaaggagca ggggatggca       660
     gtggagcccg agaagccacg ggggcttggc aaagctgatg agagtctgct gcccagccag       720
     ccccagggac aggctggtga cagccccgag tttgtggggt gcagccccgg aacgggcttc       780
     ctgtgccgca gcgccgagct gggctatgac ccggactcct cctgttcagg gggagaggag       840
     gatgaggaag aggaggacga tgggatggac actgcggaga ggaagatggg ctctgtgttg       900
     tgaagaggtt cccgggtgag gagttggacc agtctcggct ggcagacaca gactgtgccc       960
     atgtgcagcg tgggggctga ggggagcctg ccccccccct cctttaactt atgtgtgttt      1020
     ggagtctatt taatgtgtaa ttattcctgt gtgtatcttg gggtttcccc acatccctcc      1080
     cctataaagc tgttatccgg                                                  1100
//

If you have problems or comments...

PBIL Back to PBIL home page