(data stored in ACNUC23405 zone)

EMBL: AF066861

ID   AF066861; SV 1; linear; mRNA; STD; VRT; 1481 BP.
XX
AC   AF066861;
XX
DT   22-OCT-1998 (Rel. 57, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Gallus gallus homeodomain protein (HB9) mRNA, complete cds.
XX
KW   .
XX
OS   Gallus gallus (chicken)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
OC   Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae;
OC   Phasianinae; Gallus.
XX
RN   [1]
RP   1-1481
RX   DOI; 10.1016/S0092-8674(00)81783-3.
RX   PUBMED; 9778248.
RA   Tanabe Y., William C., Jessell T.M.;
RT   "Specification of motor neuron identity by the MNR2 homeodomain protein";
RL   Cell 95(1):67-80(1998).
XX
RN   [2]
RP   1-1481
RA   Tanabe Y., William C., Jessell T.M.;
RT   ;
RL   Submitted (19-MAY-1998) to the INSDC.
RL   HHMI, Columbia University, 701 West 168th Street, New York, NY 10032, USA
XX
DR   MD5; faa18f236f17060e95e8949f505a3739.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1481
FT                   /organism="Gallus gallus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9031"
FT   CDS_pept        1..1050
FT                   /codon_start=1
FT                   /gene="HB9"
FT                   /product="homeodomain protein"
FT                   /db_xref="GOA:Q9YHY7"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:Q9YHY7"
FT                   /protein_id="AAC64925.1"
FT                   /translation="MEKSKNFRIDALLAVDPPKAAAQSAPLALVTGGSGGGSPPSSSSS
FT                   SSSSSSSSSELPADCPRTDSPSPPRLLPAHCALLPKAAFLGGGGPGGGHPQHHALGLHP
FT                   AGPGGPGLYGHPVYGYPALGGQHPALSYSYSQVQGAHPAHPSADPIKLSAGTFQLDQWL
FT                   RASTAGMILPKMPDFGSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFE
FT                   VATSLMLTETQVKIWFQNRRMKWKRQKKAKEQAAQEAENEKGGGGGEDKSGPRELLLPG
FT                   PEKGGGRRLRELPDSEPEDEEEEEEEEEEAEAGRCCPYHSSDCSEADEEDSQSGGRPGA
FT                   PPPPPAQPQ"
XX
SQ   Sequence 1481 BP; 296 A; 501 C; 456 G; 228 T; 0 other;
     atggaaaaat ccaaaaattt ccgcatcgac gcgctgctgg ctgtcgatcc ccccaaggcg        60
     gcggcgcaga gcgctccgct ggccctggtc accggcggct ccggcggcgg cagccctccg       120
     tcttcgtcgt cctcctcgtc gtcgtcgtcc tcctcttctt ccgagctccc cgccgactgc       180
     ccgcgcaccg acagcccctc tccgcctcgc ctgctgcccg cgcactgcgc gctgctgccc       240
     aaagccgcct tcctgggcgg ggggggaccc gggggcggcc acccgcagca ccacgccctg       300
     gggctgcacc ccgcggggcc gggcgggccg ggcctctacg ggcacccggt gtacggctac       360
     ccggcgttgg gcgggcagca cccggcgctc tcctattcct attcgcaagt gcagggagcg       420
     caccccgcgc atccctccgc cgaccccatc aagctgagcg ccggcacctt tcagctggac       480
     cagtggctgc gggcgagcac ggccggcatg atcctgccca aaatgcccga cttcggctct       540
     caggcgcagt ccaacctgct ggggaagtgc cggcggccgc gcaccgcctt caccagccag       600
     cagctgctgg agctggagca ccagttcaaa ctcaacaagt acctctcccg gcccaagcgc       660
     ttcgaggtgg ccacgtcgct gatgctcacc gagacgcagg tgaagatttg gttccagaac       720
     cgccgcatga aatggaagcg ccagaaaaag gcgaaggagc aggcggcgca ggaggcagag       780
     aacgagaaag gaggaggagg aggagaggac aaaagcgggc cgagggaact gctgctgccc       840
     ggcccggaga aaggcggcgg gaggcggctg agggagctgc ccgacagcga gcccgaggac       900
     gaggaggagg aagaagagga ggaagaggag gccgaggccg ggcggtgctg cccctaccac       960
     tcctccgact gctccgaggc ggacgaggag gactcgcagt ccggaggacg gcccggagcc      1020
     cccccgccac cccccgcaca gccgcagtga gcccacggcc gccccgtcgg ggccgccccc      1080
     ggcaacggag cctcctggcc ccgctctcca tcccgctctc ccatccctcc ctgctcggag      1140
     ggggacgcgg aaagggatct cccgtctgcc gagcgggagg gaggattcac acagtgttat      1200
     tattgactga gaagcggcca cgacttgagc ccccctcccc gccccgccct atcggaaccg      1260
     tttccttctt accatatatc gggaaaagtg tttatgtcat gaacgttaaa actgctgcag      1320
     atctcaatac tgtctttatt ttgtatatcc tatttataaa aaaggcaaaa tgaattcctc      1380
     tacttatgca tgctaaatta ttacccagcc ccttccgcct gaggtggggg ggaggaatat      1440
     aaataaagag cgttttgtac tgtgaaaaaa aaaaaaaaaa a                          1481
//

If you have problems or comments...

PBIL Back to PBIL home page