(data stored in ACNUC8465 zone)

EMBL: AH006187

ID   AH006187; SV 2; linear; genomic DNA; STD; HUM; 3786 BP.
XX
AC   AH006187; AF070080-AF070090;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 17 mitogen-activated protein kinase kinase 1 (MKK4)
DE   gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3786
RX   PUBMED; 9331070.
RA   Teng D.H., Perry W.L.III., Hogan J.K., Baumgard M., Bell R., Berry S.,
RA   Davis T., Frank D., Frye C., Hattier T., Hu R., Jammulapati S., Janecki T.,
RA   Leavitt A., Mitchell J.T., Pero R., Sexton D., Schroeder M., Su P.H.,
RA   Swedlund B., Kyriakis J.M., Avruch J., Bartel P., Wong A.K.C., Oliphant A.,
RA   Thomas A., Skolnick M.H., Tavtigian S.V.;
RT   "Human mitogen-activated protein kinase kinase 4 as a candidate tumor
RT   suppressor";
RL   Cancer Res. 57(19):4177-4182(1997).
XX
RN   [2]
RP   1-3786
RX   PUBMED; 9622070.
RA   Su G.H., Hilgers W., Shekher M.C., Tang D.J., Yeo C.J., Hruban R.H.,
RA   Kern S.E.;
RT   "Alterations in pancreatic, biliary, and breast carcinomas support MKK4 as
RT   a genetically targeted tumor suppressor gene";
RL   Cancer Res. 58(11):2339-2342(1998).
XX
RN   [3]
RP   1-3786
RA   Su G.H., Kern S.E.;
RT   ;
RL   Submitted (05-JUN-1998) to the INSDC.
RL   Oncology, Johns Hopkins, 720 Rutland Ave., 632 Ross Bldg., Baltimore, MD
RL   21205-2196, USA
XX
DR   MD5; 0502ab5f5ca5f7be5e0c7df1523b5734.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:3249639, gi:3249640, gi:3249641, gi:3249642, gi:3249643,
CC   gi:3249644, gi:3249645, gi:3249646, gi:3249647, gi:3249648,
CC   gi:3249649, gi:3249650.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3786
FT                   /organism="Homo sapiens"
FT                   /chromosome="17"
FT                   /map="17p13"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>3786
FT                   /gene="MKK4"
FT   mRNA            join(<1..229,418..520,795..969,1233..1352,1604..1723,
FT                   1911..1962,2216..2343,2584..2661,2945..3093,3313..3358,
FT                   3589..>3786)
FT                   /gene="MKK4"
FT                   /product="mitogen-activated protein kinase kinase 1"
FT   exon            <1..229
FT                   /gene="MKK4"
FT                   /number=1
FT   5'UTR           <1..114
FT                   /gene="MKK4"
FT   CDS_pept        join(115..229,418..520,795..969,1233..1352,1604..1723,
FT                   1911..1962,2216..2343,2584..2661,2945..3093,3313..3358,
FT                   3589..3702)
FT                   /codon_start=1
FT                   /gene="MKK4"
FT                   /product="mitogen-activated protein kinase kinase 1"
FT                   /note="tumor-suppressor"
FT                   /protein_id="AAC24130.1"
FT                   /translation="MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALK
FT                   LNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKD
FT                   LGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQ
FT                   FYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKEN
FT                   LKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASR
FT                   QGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSF
FT                   INFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
FT                   "
FT   gap             277..376
FT                   /estimated_length=unknown
FT   exon            418..520
FT                   /gene="MKK4"
FT                   /number=2
FT   gap             625..724
FT                   /estimated_length=unknown
FT   exon            795..969
FT                   /gene="MKK4"
FT                   /number=3
FT   gap             1060..1159
FT                   /estimated_length=unknown
FT   exon            1233..1352
FT                   /gene="MKK4"
FT                   /number=4
FT   gap             1435..1534
FT                   /estimated_length=unknown
FT   exon            1604..1723
FT                   /gene="MKK4"
FT                   /number=5
FT   gap             1781..1880
FT                   /estimated_length=unknown
FT   exon            1911..1962
FT                   /gene="MKK4"
FT                   /number=6
FT   gap             2089..2188
FT                   /estimated_length=unknown
FT   exon            2216..2343
FT                   /gene="MKK4"
FT                   /number=7
FT   gap             2444..2543
FT                   /estimated_length=unknown
FT   exon            2584..2661
FT                   /gene="MKK4"
FT                   /number=8
FT   gap             2771..2870
FT                   /estimated_length=unknown
FT   exon            2945..3093
FT                   /gene="MKK4"
FT                   /number=9
FT   gap             3174..3273
FT                   /estimated_length=unknown
FT   exon            3313..3358
FT                   /gene="MKK4"
FT                   /number=10
FT   gap             3450..3549
FT                   /estimated_length=unknown
FT   exon            3589..>3786
FT                   /gene="MKK4"
FT                   /number=11
FT   3'UTR           3703..>3786
FT                   /gene="MKK4"
XX
SQ   Sequence 3786 BP; 791 A; 530 C; 615 G; 849 T; 1001 other;
     ggcgtgtcgg aggcggggcc aaggcggggg yaagcctcgc ccctcggccg tgcgagaggc        60
     cgagcttgct gcattgcagc cgccgcggcg ccgctcggct cttcactccc aacaatggcg       120
     gctccgagcc cgagcggcgg cggcggctcc gggggcggca gcggcagcgg cacccccggc       180
     cccgtagggt ccccggcgcc aggccacccg gccgtcagca gcatgcaggg taaggaacgc       240
     ggccgcgccg agatcccagc ccctagcgcg gcaaccnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnngtag tacttgaaac ttttactttt tatttgttat ttctcaggta       420
     aacgcaaagc actgaagttg aattttgcaa atccaccttt caaatctaca gcaaggttta       480
     ctctgaatcc caatcctaca ggagttcaaa acccacacat gtgagtattc ttggtaatca       540
     aaggctcaac tcaagcaaag attttaaagt tactgtattt tatgaatttt tccaattatg       600
     agatgtcagt ataatttctc tgacnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnatcagt actaaaagaa aaaagttaaa acctatttaa aatgtggaaa aattgcttcc       780
     caatatttta acagagagag actgagaaca cacagcattg agtcatcagg aaaactgaag       840
     atctcccctg aacaacactg ggatttcact gcagaggact tgaaagacct tggagaaatt       900
     ggacgaggag cttatggttc tgtcaacaaa atggtccaca aaccaagtgg gcaaataatg       960
     gcagttaaag taggtgatgc catgattatt tttggtactt taatccatta ggtgaaattt      1020
     catggtgcag taataccact gttgttgtgt tcctactttn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnt gagactaaaa attattggtg tttttgacaa aattattgtg      1200
     tttttttgac atcttttgtc attcttttcc agagaattcg gtcaacagtg gatgaaaaag      1260
     aacaaaaaca acttcttatg gatttggatg tagtaatgcg gagtagtgat tgcccataca      1320
     ttgttcagtt ttatggtgca ctcttcagag aggtaggaat aaactgggtt ttagctgact      1380
     aatgaatatc taattgggac aaatgaagat ggcaggattc gattgtatgt taaannnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnntttcca ttttaagtaa ggcaaggtga      1560
     tatttaagat gtataagaat aacagatatt tgttatttta tagggtgact gttggatctg      1620
     tatggaactc atgtctacct cgtttgataa gttttacaaa tatgtatata gtgtattaga      1680
     tgatgttatt ccagaagaaa ttttaggcaa aatcacttta gcagtagtct gtctttaaat      1740
     attcattgtg tatatagtta tatagagatg ctgctggagt nnnnnnnnnn nnnnnnnnnn      1800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn tgttatccca tctctccttt ttctccctag actgtgaaag      1920
     cactaaacca cttaaaagaa aacttgaaaa ttattcacag aggtgggtat ggattggtat      1980
     tttttgtaat agaaattaac ttttttctcc taattggtga aacggttatt gaaaattaca      2040
     gtgtcactgt ataaactttc ctaaaatatt tgtattttta gcaaaaaann nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnta tactgatgat atctatgtct tgcagatatc      2220
     aaaccttcca atattcttct ggacagaagt ggaaatatta agctctgtga cttcggcatc      2280
     agtggacagc ttgtggactc tattgccaag acaagagatg ctggctgtag gccatacatg      2340
     gcagtaagtg ttaagtccag gccttcttgc ttgatagtca ttgcacagag agcctgtgct      2400
     cttttgtgct ggccattagt catacggttt taccatgaaa ctgnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnngtaaggc aattaataac ttacacttgt ctttatgttc      2580
     cagcctgaaa gaatagaccc aagcgcatca cgacaaggat atgatgtccg ctctgatgtc      2640
     tggagtttgg ggatcacatt ggtatgttta tgctgattca accttgccac agtagcgtaa      2700
     caataagaaa tttagaagtg aaagaaaact taatcagact tccccgttcg ttaagaacta      2760
     taatcacaga nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ttttgtggcc      2880
     cttccagtgg ggagtagtaa atgatgcctg gtgtattttg ctctttcctc tttgttctct      2940
     ttagtatgag ttggccacag gccgatttcc ttatccaaag tggaatagtg tatttgatca      3000
     actaacacaa gtcgtgaaag gagatcctcc gcagctgagt aattctgagg aaagggaatt      3060
     ctccccgagt ttcatcaact ttgtcaactt gtggtgagta cctgatttat gaatggtcga      3120
     acacgcatgg cgagaatagt gagatttact tggtcttagc agcattggta cttnnnnnnn      3180
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnaatctac attttaataa tgttattttt      3300
     atgttatttt agccttacga aggatgaatc caaaaggcca aagtataaag agcttctggt      3360
     gagtgtggga ctgtggggat tgtaggtaca tcctaacccc ggaactctct aacatgctgg      3420
     ttcactaagc agcagtgggc ctctctgtan nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3540
     nnnnnnnnnt acaaactttt gacttttttg ttttcaattt tcttgcagaa acatcccttt      3600
     attttgatgt atgaagaacg tgccgttgag gtcgcatgct atgtttgtaa aatcctggat      3660
     caaatgccag ctactcccag ctctcccatg tatgtcgatt gatatcgctg ctacatcaga      3720
     ctctagaaaa aagggctgag aggaagcaag acgtaaagaa ttttcatccc gtatcacagt      3780
     gttttt                                                                 3786
//

If you have problems or comments...

PBIL Back to PBIL home page