(data stored in ACNUC23390 zone)

EMBL: AF072382

ID   AF072382; SV 1; linear; mRNA; STD; VRT; 1272 BP.
XX
AC   AF072382;
XX
DT   30-JUN-1998 (Rel. 56, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Xenopus laevis motor neuron marker xHB9 mRNA, partial cds.
XX
KW   .
XX
OS   Xenopus laevis (African clawed frog)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia;
OC   Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus.
XX
RN   [1]
RP   1-1272
RX   DOI; 10.1006/dbio.1997.8625.
RX   PUBMED; 9242418.
RA   Saha M.S., Miles R.R., Grainger R.M.;
RT   "Dorsal-ventral patterning during neural induction in Xenopus: assessment
RT   of spinal cord regionalization with xHB9, a marker for the motor neuron
RT   region";
RL   Dev. Biol. 187(2):209-223(1997).
XX
RN   [2]
RP   1-1272
RA   Saha M.S., Miles R.R., Grainger R.M.;
RT   ;
RL   Submitted (12-JUN-1998) to the INSDC.
RL   Biology, College of William and Mary, Millington Hall, Williamsburg, VA
RL   23187, USA
XX
DR   MD5; bb46da7ec600715a5af7055af2631478.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1272
FT                   /organism="Xenopus laevis"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:8355"
FT   CDS_pept        <1..787
FT                   /codon_start=2
FT                   /product="motor neuron marker xHB9"
FT                   /db_xref="GOA:O93368"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/TrEMBL:O93368"
FT                   /protein_id="AAC24873.1"
FT                   /translation="VMSLHPQVVPGIPPQALYGHPMYSYSAAAALGQHPALSYPYSHIQ
FT                   GTHHAHPMDPIKISAGTFQLDQWLRASTAGMMLPKMSDFNSQAQSNLLGKCRRPRTAFT
FT                   SQQLLELEHQFKVNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQ
FT                   DSAEKQQRGGKGSCEEKCSDELQGEKKPYHLHSRGEPIKCNGRLQPRDYTDSEEEEEDR
FT                   EEEEEEGHRGEGKRFYHHSSDCTSEEEEEDNSHNKQNGH"
XX
SQ   Sequence 1272 BP; 363 A; 334 C; 324 G; 251 T; 0 other;
     cgtgatgtct ttgcaccccc aagttgttcc agggatcccc cctcaggccc tgtatggaca        60
     cccaatgtac agctactcag cagcagcggc cctggggcag cacccagctc tgtcctaccc       120
     ctactcccac atacagggca cccaccatgc ccaccctatg gaccccatca agatcagcgc       180
     tggcaccttc caactggacc agtggctcag agcctccact gctggaatga tgttgcccaa       240
     aatgtcagac tttaactccc aggcccaatc caacttgctg ggaaagtgca gaagaccaag       300
     gacagcattt accagtcagc agctcttgga actggagcac caattcaagg tgaacaagta       360
     cctctccagg ccgaaacgct ttgaagtggc cacttccctg atgttgactg agacgcaggt       420
     gaagatctgg ttccagaaca ggcgcatgaa gtggaagagg agtaagaaag ccaaggagca       480
     ggcggcgcag gactcagcag agaaacagca gaggggaggc aagggcagct gtgaggagaa       540
     gtgctcggat gagctgcagg gagagaagaa accctaccat ctacactcca ggggggagcc       600
     aataaaatgc aatggccgcc tgcagcccag agactataca gacagcgaag aggaggagga       660
     ggacagggaa gaggaggaag aggaagggca cagaggggag gggaagcggt tttaccatca       720
     ttcttctgac tgcacatctg aggaggagga ggaggacaac agtcacaata agcagaacgg       780
     ccactgagac acatcattgt cctcccccta aagagaactg tgttacacga gacatgtcat       840
     cattgtcctc cccctaaaga gaactgtgtt acacgagaca tgtcatcatt gtgttgtgct       900
     ggtgcgaccc ttcatgcttg ggagccgacc ccaggcactc aatctggata atcactgtcc       960
     attccagcac ctcggagagc tccctgtcca gcactgcctg ttgcccccta cactgactct      1020
     tcctgcaggg gggcacatgt tcccgggcag ggtcatggaa gttacacaga ctactgggag      1080
     tcccccactt cgtgttcacc aggaaacttg tggacacctg aaggccacac tatatgctgt      1140
     ctttattttt gtacattgta tttataagag aaatagctct acatatgcat gataaattat      1200
     tatttagctc cctccatcat aacgatggga tgtaaaataa atgaataata cgtttaaaaa      1260
     aaaaaaaaaa aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page