(data stored in ACNUC4482 zone)

EMBL: AF074015

ID   AF074015; SV 1; linear; mRNA; STD; HUM; 3884 BP.
XX
AC   AF074015;
XX
DT   17-AUG-1998 (Rel. 56, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens integrin subunit alpha 10 precursor, mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3884
RX   DOI; 10.1074/jbc.273.32.20383.
RX   PUBMED; 9685391.
RA   Camper L., Hellman U., Lundgren-Akerlund E.;
RT   "Isolation, cloning, and sequence analysis of the integrin subunit alpha10,
RT   a beta1-associated collagen binding integrin expressed on chondrocytes";
RL   J Biol Chem 273(32):20383-20389(1998).
XX
RN   [2]
RP   1-3884
RA   Camper L., Hellman U., Lundgren-Akerlund E.;
RT   ;
RL   Submitted (24-JUN-1998) to the INSDC.
RL   Cell and Molecular Biology, Cell and Matrix Biology, P.O BOX 94, Lund S-221
RL   00, Sweden
XX
DR   MD5; f2f422c4fd6856d3d80eb3d7aa109a6a.
DR   Ensembl-Gn; ENSG00000143127; homo_sapiens.
DR   Ensembl-Tr; ENST00000369304; homo_sapiens.
DR   Ensembl-Tr; ENST00000539363; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3884
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="chondrocyte"
FT                   /db_xref="taxon:9606"
FT   sig_peptide     22..87
FT   misc_feature    22..3315
FT                   /note="Region: extracellular"
FT   CDS_pept        22..3525
FT                   /codon_start=1
FT                   /product="integrin subunit alpha 10 precursor"
FT                   /db_xref="GOA:O75578"
FT                   /db_xref="H-InvDB:HIT000065979.13"
FT                   /db_xref="HGNC:HGNC:6135"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75578"
FT                   /protein_id="AAC31952.1"
FT                   /translation="MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSV
FT                   LQHVGGGQRWMLVGAPWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAV
FT                   NMHLGMSLLETDGDGGFMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCP
FT                   TYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDF
FT                   RTKEEVVRAAKNLSRREGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHD
FT                   GEELPAALKACEAGRVTRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDE
FT                   AALTDIVDALGDRIFGLEGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGS
FT                   VLWLEGGHRLFPPRMALEDEFPPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRG
FT                   KVIAFQLKKDGAVRVAQSLQGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNK
FT                   ETGRVYVYLVGQQSLLTLQGTLQPEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDG
FT                   HQGALYLYHGTQSGVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQG
FT                   AAILLSSRPIVHLTPSLEVTPQAISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDH
FT                   QFYMRFTASLDEWTAGARAAFDGSGQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPV
FT                   ALTVTFALDNTTKPGPVLNEGSPTSIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRK
FT                   APFVVRGGRRKVLVSTTLENRKENAYNTSLSIIFSRNLHLASLTPQRESPIKVECAAPS
FT                   AHARLCSVGHPVFQTGAKVTFLLEFEFSCSSLLSQVFGKLTASSDSLERNGTLQENTAQ
FT                   TSAYIQYEPHLLFSSESTLHRYEVHPYGTLPVGPGPEFKTTLRVQNLGCYVVSGLIISA
FT                   LLPAVAHGGNYFLSLSQVITNNASCIVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVV
FT                   RCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFKSLTVVSTFELGTEEGSVLQLTEASRWS
FT                   ESLLEVVQTRPILISLWILIGSVLGGLLLLALLVFCLWKLGFFAHKKIPEEEKREEKLE
FT                   Q"
FT   mat_peptide     88..3522
FT                   /product="integrin subunit alpha 10"
FT   misc_feature    247..249
FT                   /note="glycosylation site"
FT   misc_feature    439..1032
FT                   /note="Region: I-domain"
FT   misc_feature    655..657
FT                   /note="glycosylation site"
FT   misc_feature    961..963
FT                   /note="glycosylation site"
FT   misc_feature    1045..1047
FT                   /note="glycosylation site"
FT   misc_feature    2152..2154
FT                   /note="glycosylation site"
FT   misc_feature    2242..2244
FT                   /note="glycosylation site"
FT   misc_feature    2470..2472
FT                   /note="glycosylation site"
FT   misc_feature    2716..2718
FT                   /note="glycosylation site"
FT   misc_feature    3007..3009
FT                   /note="glycosylation site"
FT   misc_feature    3070..3072
FT                   /note="glycosylation site"
FT   misc_feature    3316..3390
FT                   /note="Region: transmembrane"
FT   misc_feature    3391..3456
FT                   /note="Region: cytoplasmic"
XX
SQ   Sequence 3884 BP; 858 A; 1031 C; 1078 G; 917 T; 0 other;
     caggtcagaa accgatcagg catggaactc cccttcgtca ctcacctgtt cttgcccctg        60
     gtgttcctga caggtctctg ctcccccttt aacctggatg aacatcaccc acgcctattc       120
     ccagggccac cagaagctga atttggatac agtgtcttac aacatgttgg gggtggacag       180
     cgatggatgc tggtgggcgc cccctgggat gggccttcag gcgaccggag gggggacgtt       240
     tatcgctgcc ctgtaggggg ggcccacaat gccccatgtg ccaagggcca cttaggtgac       300
     taccaactgg gaaattcatc tcatcctgct gtgaatatgc acctggggat gtctctgtta       360
     gagacagatg gtgatggggg attcatggcc tgtgcccctc tctggtctcg tgcttgtggc       420
     agctctgtct tcagttctgg gatatgtgcc cgtgtggatg cttcattcca gcctcaggga       480
     agcctggcac ccactgccca acgctgccca acatacatgg atgttgtcat tgtcttggat       540
     ggctccaaca gcatctaccc ctggtctgaa gttcagacct tcctacgaag actggtaggg       600
     aaactgttta ttgacccaga acagatacag gtgggactgg tacagtatgg ggagagccct       660
     gtacatgagt ggtccctggg agatttccga acgaaggaag aagtggtgag agcagcaaag       720
     aacctcagtc ggcgggaggg acgagaaaca aagactgccc aagcaataat ggtggcctgc       780
     acagaagggt tcagtcagtc ccatgggggc cgacccgagg ctgccaggct actggtggtt       840
     gtcactgatg gagagtccca tgatggagag gagcttcctg cagcactaaa ggcctgtgag       900
     gctggaagag tgacacgcta tgggattgca gtccttggtc actacctccg gcggcagcga       960
     gatcccagct ctttcctgag agaaattaga actattgcca gtgatccaga tgagcgattc      1020
     ttcttcaatg tcacagatga ggctgctctg actgacattg tggatgcact aggagatcgg      1080
     atttttggcc ttgaagggtc ccatgcagaa aacgaaagct cctttgggct ggaaatgtct      1140
     cagattggtt tctccactca tcggctaaag gatgggattc tttttgggat ggtgggggcc      1200
     tatgactggg gaggctctgt gctatggctt gaaggaggcc accgcctttt ccccccacga      1260
     atggcactgg aagacgagtt cccccctgca ctgcagaacc atgcagccta cctgggttac      1320
     tctgtttctt ccatgctttt gcggggtgga cgccgcctgt ttctctctgg ggctcctcga      1380
     tttagacatc gaggaaaagt catcgccttc cagcttaaga aagatggggc tgtgagggtt      1440
     gcccagagcc tccaggggga gcagattggt tcatactttg gcagtgagct ctgcccattg      1500
     gatacagata gggatggaac aactgatgtc ttacttgtgg ctgcccccat gttcctggga      1560
     ccccagaaca aggaaacagg acgtgtttat gtgtatctgg taggccagca gtccttgctg      1620
     accctccaag gaacacttca gccagaaccc ccccaggatg ctcggtttgg ctttgccatg      1680
     ggagctcttc ctgatctgaa ccaagatggt tttgctgatg tggctgtggg ggcgcctctg      1740
     gaagatgggc accagggagc actgtacctg taccatggaa cccagagtgg agtcaggccc      1800
     catcctgccc agaggattgc tgctgcctcc atgccacatg ccctcagcta ctttggccga      1860
     agtgtggatg gtcggctaga tctggatgga gatgatctgg tcgatgtggc tgtgggtgcc      1920
     cagggggcag ccatcctgct cagctcccgg cccattgtcc atctgacccc atcactggag      1980
     gtgaccccac aggccatcag tgtggttcag agggactgta ggcggcgagg ccaagaagca      2040
     gtctgtctga ctgcagccct ttgcttccaa gtgacctccc gtactcctgg tcgctgggat      2100
     caccaattct acatgaggtt caccgcatca ctggatgaat ggactgctgg ggcacgtgca      2160
     gcatttgatg gctctggcca gaggttgtcc cctcggaggc tccggctcag tgtggggaat      2220
     gtcacttgtg agcagctaca cttccatgtg ctggatacat cagattacct ccggccagtg      2280
     gccttgactg tgacctttgc cttggacaat actacaaagc cagggcctgt gctgaatgag      2340
     ggctcaccca cctctataca aaagctggtc cccttctcaa aggattgtgg ccctgacaat      2400
     gaatgtgtca cagacctggt gcttcaagtg aatatggaca tcagaggctc caggaaggcc      2460
     ccatttgtgg ttcgaggtgg ccggcggaaa gtgctggtat ctacaactct ggagaacaga      2520
     aaggaaaatg cttacaatac gagcctgagt atcatcttct ctagaaacct ccacctggcc      2580
     agtctcactc ctcagagaga gagcccaata aaggtggaat gtgccgcccc ttctgctcat      2640
     gcccggctct gcagtgtggg gcatcctgtc ttccagactg gagccaaggt gacctttctg      2700
     ctagagtttg agtttagctg ctcctctctc ctgagccagg tctttgggaa gctgactgcc      2760
     agcagtgaca gcctggagag aaatggcacc cttcaagaaa acacagccca gacctcagcc      2820
     tacatccaat atgagcccca cctcctgttc tctagtgagt ctaccctgca ccgctatgag      2880
     gttcacccat atgggaccct cccagtgggt cctggcccag aattcaaaac cactctcagg      2940
     gttcagaacc taggctgcta tgtggtcagt ggcctcatca tctcagccct ccttccagct      3000
     gtggcccatg ggggcaatta cttcctatca ctgtctcaag tcatcactaa caatgcaagc      3060
     tgcatagtgc agaacctgac tgaaccccca ggcccacctg tgcatccaga ggagcttcaa      3120
     cacacaaaca gactgaatgg gagcaatact cagtgtcagg tggtgaggtg ccaccttggg      3180
     cagctggcaa aggggactga ggtctctgtt ggactattga ggctggttca caatgaattt      3240
     ttccgaagag ccaagttcaa gtccctgacg gtggtcagca cctttgagct gggaaccgaa      3300
     gagggcagtg tcctacagct gactgaagcc tcccgttgga gtgagagcct cttggaggtg      3360
     gttcagaccc ggcctatcct catctccctg tggatcctca taggcagtgt cctgggaggg      3420
     ttgctcctgc ttgctctcct tgtcttctgc ctgtggaagc ttggcttctt tgcccataag      3480
     aaaatccctg aggaagaaaa aagagaagag aagttggagc aatgaatgta gaataagggt      3540
     ctagaaagtc ctccctggca gctttcttca agagacttgc ataaaagcag aggtttgggg      3600
     gctcagatgg gacaagaagc cgcctctgga ctatctcccc agaccagcag cctgacttga      3660
     cttttgagtc ctagggatgc tgctggctag agatgaggct ttacctcaga caagaagagc      3720
     tggcaccaaa actagccatg ctcccaccct ctgcttccct cctcctcgtg atcctggttc      3780
     catagccaac actggggctt ttgtttgggg tccttttatc cccaggaatc aataattttt      3840
     ttgcctagga aaaaaaaaag cggccgcgaa ttcgatatca agct                       3884
//

If you have problems or comments...

PBIL Back to PBIL home page