(data stored in ACNUC32233 zone)

EMBL: AF079569

ID   AF079569; SV 1; linear; mRNA; STD; HUM; 228 BP.
XX
AC   AF079569;
XX
DT   23-NOV-1998 (Rel. 57, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Homo sapiens beta III spectrin (SPTBN2) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-228
RX   DOI; 10.1073/pnas.95.24.14158.
RX   PUBMED; 9826670.
RA   Stankewich M.C., Tse W.T., Peters L.L., Ch'ng Y., John K.M., Stabach P.R.,
RA   Devarajan P., Morrow J.S., Lux S.E.;
RT   "A widely expressed betaIII spectrin associated with Golgi and cytoplasmic
RT   vesicles";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(24):14158-14163(1998).
XX
RN   [2]
RP   1-228
RA   Stabach P.R., Morrow J.S.;
RT   ;
RL   Submitted (22-JUL-1998) to the INSDC.
RL   Pathology, Yale Medical School, 310 Cedar Street, New Haven, CT 06510, USA
XX
DR   MD5; ba8ddae32ff24ac0d84e6b9c8de94043.
DR   Ensembl-Gn; ENSG00000173898; homo_sapiens.
DR   Ensembl-Tr; ENST00000309996; homo_sapiens.
DR   Ensembl-Tr; ENST00000529997; homo_sapiens.
DR   Ensembl-Tr; ENST00000533211; homo_sapiens.
DR   EuropePMC; PMC24343; 9826670.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..228
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        127..>228
FT                   /codon_start=1
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="cytoskeletal protein; Golgi and cytosolic vesicle
FT                   associated"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000066429.12"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="AAC80006.1"
FT                   /translation="MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWD"
XX
SQ   Sequence 228 BP; 62 A; 57 C; 71 G; 38 T; 0 other;
     gggaacggag gctggatctc ggaaacctcg tcggcagtgt cattagagga aggatcgcgt        60
     gtctcgggga tacggatttt ggaggaaaag cagaatagga caaggagcag gaagccgcct       120
     accaccatga gcagcacgct gtcacccaca gactttgaca gcttggaaat ccagggccag       180
     tacagtgaca tcaacaaccg ctgggacctt cctgactcgg actgggac                    228
//

If you have problems or comments...

PBIL Back to PBIL home page