(data stored in SCRATCH3701 zone)

EMBL: AF084042

ID   AF084042; SV 1; linear; genomic DNA; STD; PRO; 8419 BP.
XX
AC   AF084042;
XX
DT   08-JUN-2002 (Rel. 72, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Listeria monocytogenes RecF (recF) gene, partial cds; DNA gyrase subunit B
DE   (gyrB), DNA gyrase subunit A (gyrA), putative cardiolipin synthase (cls),
DE   putative spermidine acetyltransferase (speG), and putative mevalonate
DE   kinase (mvaK1) genes, complete cds; and putative diphosphomevalonate
DE   decarboxylase (mvaD) gene, partial cds.
XX
KW   .
XX
OS   Listeria monocytogenes
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
XX
RN   [1]
RP   1-8419
RX   DOI; 10.1093/jac/dkf065.
RX   PUBMED; 12039883.
RA   Lampidis R., Kostrewa D., Hof H.;
RT   "Molecular characterization of the genes encoding DNA gyrase and
RT   topoisomerase IV of Listeria monocytogenes";
RL   J. Antimicrob. Chemother. 49(6):917-924(2002).
XX
RN   [2]
RP   1-8419
RA   Lampidis R.;
RT   ;
RL   Submitted (13-AUG-1998) to the INSDC.
RL   Institut fuer Medizinische Mikrobiologie und Hygiene, Universitaet
RL   Heidelberg, Fakultaet fuer Klinische Medizin Mannheim, Klinikum Mannheim
RL   gGmbH, Theodor-Kutzer-Ufer 1-3, Mannheim 68167, Germany
XX
DR   MD5; 96307f0e02a21787df5b053d684516ea.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8419
FT                   /organism="Listeria monocytogenes"
FT                   /strain="EGD"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1639"
FT   CDS_pept        <1..321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /product="RecF"
FT                   /db_xref="GOA:Q8KYB4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KYB4"
FT                   /protein_id="AAM48482.1"
FT                   /translation="HRDDSLFYINGQNVQDFGSQGQQRTTALSIKLAEIDLIHEETGEY
FT                   PVLLLDDVLSELDDYRQSHLLGAIEGKVQTFVTTTSTSGIDHETLKQATTFYVEKGTVK
FT                   KS"
FT   CDS_pept        370..2310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="GOA:Q7BSI8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI8"
FT                   /protein_id="AAM48481.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
FT   CDS_pept        2405..4933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="GOA:Q7BSI9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI9"
FT                   /protein_id="AAM48483.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
FT   CDS_pept        5068..6582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /product="putative cardiolipin synthase"
FT                   /note="putative Cls; ORF1"
FT                   /db_xref="GOA:Q8KYB3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KYB3"
FT                   /protein_id="AAM48484.1"
FT                   /translation="MRKLIQFLFIAVVLFLVEYVLINQAAILFLVTSGIIQLCGVIIAI
FT                   RLLLFDQRNTSSKVAWVAVIFILPVLGTISYLVFGRNPATRKFSTAQVKEKTKLINAIH
FT                   AIPNNTNEKLPRLSKRIAHLTSIEPIKGNKIEILTNGEETFPVLLDALRKAENHIHIQY
FT                   YIFKTDAISTEIRDILVEKAKSGVEVRFMFDGLGSSKLGKAFLAPLKEAGVSIHAFDPI
FT                   ASPWIVRTANLRNHRKIVVIDGQIGFTGGLNIGEEYRSNTPDFRVWRDTHIKITGQAVI
FT                   ELQESFLNDWVYMENQAGAADGFISESGSKQYFSPVDMGDEWAQVIYGGPYDKEKWVRD
FT                   SMLDLIDSAKESVWIVSPYFVPDEESLAVIRRVAMSGVDVRVIIPGKGDRGTSFHGSNA
FT                   YVKTMIEAGAKMYAYADDSFVHAKAMLVDGTRAAIGTANFDVRSFRLNHELMVFLYDES
FT                   EAMHHLKRDFKKDFEDSRLFTMKDMENKPLLTRIKEVLSSLLSPIL"
FT   CDS_pept        6598..7116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /product="putative spermidine acetyltransferase"
FT                   /note="putative SpeG; ORF2"
FT                   /db_xref="GOA:Q8KYB2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KYB2"
FT                   /protein_id="AAM48485.1"
FT                   /translation="MSGDLKLRPLEREDLKFVHRLNNDAKIMSYWFEEPYEAFVELQEL
FT                   YDKHIHDQSERRFILELDGQMVGLVELMEIDYIHRRAEFQIIIDPKFQGHGYAVSATKL
FT                   AMKYAFHVLNMRKLYLVVDKVNEKAIHVYEKVGFIREGELIDEFFVDGTYHDAIRMCIF
FT                   QHQYREMDI"
FT   CDS_pept        7258..8226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /product="putative mevalonate kinase"
FT                   /note="putative MvaK1; ORF3"
FT                   /db_xref="GOA:Q7BSJ0"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSJ0"
FT                   /protein_id="AAM48486.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
FT   CDS_pept        8183..>8419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaD"
FT                   /product="putative diphosphomevalonate decarboxylase"
FT                   /note="putative MvaD; ORF4"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q8KYB1"
FT                   /protein_id="AAM48487.1"
FT                   /translation="MKATAIAHTNVALIKYWGKRDEHLILPANSSLSFTVDKFYTKTTV
FT                   EWDEKLTQDTFILNNEQKTDAKVARFIDKMREEF"
XX
SQ   Sequence 8419 BP; 2746 A; 1430 C; 1834 G; 2409 T; 0 other;
     catcgggatg attctctgtt ttatattaat gggcaaaatg tgcaagattt tggttcgcaa        60
     ggccagcaac ggacaacggc actttctata aaattagcag aaattgacct aatccatgaa       120
     gaaactggtg aatatccggt ccttcttctc gatgatgtgc ttagtgaact cgacgattac       180
     cgtcaatcgc atttgctcgg agccattgaa ggaaaagtac aaacctttgt aacgacaaca       240
     agtacgagcg gaatcgacca tgaaacgctc aaacaagcaa caactttcta tgtagaaaaa       300
     ggtacagtaa aaaaatccta atctaggtta atataatttg atgaaaaaga aagtgcggtg       360
     gaataattaa tgtcagaaga aaatattaca aatgtacaag aaaatgcttc agattataac       420
     gaagatcaaa tacaagtact ggaaggccta gaggcagtaa gaaaaagacc cggtatgtac       480
     attggttcaa ctagccaacg cgggctccat caccttgtat gggaaattgt tgataatgca       540
     attgatgaag cacttgctgg tttttgtaca gaaattgaaa ttacaattga agctgataac       600
     agcattactg ttcgcgataa cggacgtgga attcctacag ggattaatga aaaaatcggt       660
     cgtccaacag tagaagtaat ctttaccgtt ctgcatgctg gtggtaaatt tggcggcggc       720
     ggatataaag tatctggcgg acttcacgga gttggtgcat cggtagttaa tgccctttcc       780
     acatctcttg aagtatacgt tcaccgtgaa ggtcaaaaat attaccaacg ctttgaacgt       840
     ggtgatgtag taatggatat ggaagaacaa ggcgaaacgg attatcgtgg aacaattgtt       900
     cactttacac cagatccaca aattttcaca gaaacaacgg aattcgattt tgatacgctt       960
     cgtacgcgta cacgcgaact tgctttcttg aatcgtggtt taacgatttc aattgaagat      1020
     aagcgcgaag aacacaaagt tcgtaaagat ttccactatg aaggcggaat tcgttcttac      1080
     gtggagcatt taaataaagc aaaagacgtt atccatgagc caccaattta tttggaaggt      1140
     gaacgcgatg atattatggt tgagatttcc atgcaatata atactggatt ctcaagcaac      1200
     atcatttcat tcgcaaataa cattcatacg tatgaaggcg gaactcacga atctggcttt      1260
     aaaacggcgt taacacgtgt tattaatgac tacgcgcgtc gtaataaatt gtttaaagat      1320
     agtgatgaca atctttctgg tgaagatgtt cgtgaaggtt taacggcgat tatttctatc      1380
     aaacacccag atccacagtt tgaaggacaa accaaaacaa aacttggaaa ttcagaagcc      1440
     cgttcaatca cggataagct attttctgag gctttaaata aatttatgat ggaaaaccca      1500
     gatgttgcta aaaaaatcgt tgagaagggc gttgtggctt ctcgtgcacg tctggctgct      1560
     aagcgcgcgc gtgaagttgc tcgtaaaagc agtgggctag aaatttctag cttgccaggt      1620
     aaattagctg actgttcttc ccgtaatcct gaaatcagcg aactttacat cgttgagggt      1680
     gactcagctg gtggttcagc taaacaaggt cgtgaccgtt tattccaagc gattttgccg      1740
     attcgtggta aaattttgaa cgtggaaaaa gcacgtttag accgtattct agctaacgaa      1800
     gaaattcgaa ctatttttac agcgatgggt actggttttg gtggcgattt tgacgtttct      1860
     aaatctcgtt accacaaatt aattattatg actgatgccg atgttgatgg tgcacatatt      1920
     cgtacactac ttcttacact attttatcgt tatatgcgtc cactgcttga tgctggttat      1980
     atctatattg cgcaaccacc gctttaccaa attaagcatg gtaaacaaat agaatatgta      2040
     tacagcgacg gacagttaga agactatctg gcttcccttg acggagacac taaatacagc      2100
     attcaacgat ataaaggtct tggagaaatg aacccagaac aactttggga tacaacaatg      2160
     aatccggaac accgtacact acttcaagtc aatatcaaag acgctattga tgccgatgaa      2220
     acttttgaaa tgttgatggg tgaccgcgtg gaacctcgtc gtaaattcat cgaagacaac      2280
     gcgcaatacg ttaaaaactt ggatgtttaa taaatatttc ccgggtaata attgggttat      2340
     taattgtttt taaaaggttt gaactagatt cagccttact tttgaaaggg aggtttctct      2400
     aacaatggca gaaacaccaa atcaacgaat aacagagata aacttaaata aagaaatgcg      2460
     gacatcattc ctagactatg cgatgagtgt aattgttgcc cgtgccctac ctgatgttcg      2520
     tgacgggtta aaaccagttc accgtcgtat tctatatgcg atgaatgact taggtatgac      2580
     ttctgataaa gcctataaaa aatcggctcg tatcgttggt gaagtaattg gtaagtatca      2640
     cccccacggc gatacagcgg tttattttac aatggttcgt atggcgcaag attttagtta      2700
     tcgtaatatg ctagttgatg gacatggtaa ctttggttcg gttgatggcg atatggcagc      2760
     agcgatgcgt tatacagaag ctcgtatgtc aaaaatttcg atggaactac tgcgcgatat      2820
     taataaagac acaattgatt acgctgataa ctacgatggt tctgaacgtg agccagttat      2880
     tttaccagcg cgtttcccta acttattagt caatggttcg tcaggtatcg cggttggtat      2940
     ggcaacaaat attcctaccc accatcttgg tgaagtaatt gacggcgttt tagcacttag      3000
     tcacgatcca gaaattacta ttcgtgattt aatggaatat attccaggcc ctgacttccc      3060
     aactgctggg atgattatgg gacgtagcgg aatccgtcgc gcttacgaaa gtggccgtgg      3120
     ttcgattact gttcgtggtc gtgtcgatat tgaagaaaag aaaaatggta aagaaactat      3180
     cgttattacc gaaattcctt accaagtgaa taaagcacgc ctagttgaac gtattgccga      3240
     actagctcgt gagaagaaaa tcgacggcat cacttcccta aatgatgagt ctgaccgttc      3300
     aggaatgcgg attgttattg aggttcgtcg tgatattagc gccagtgtta tcgtgaataa      3360
     tttattcaaa atgacagcac ttcaaactac ttttggtatt aatatgcttg cacttgtcga      3420
     taaccatcca aaagtgctta atttaaaaga aattctttat tattatttgg aacatcaaaa      3480
     agtagttatt cgtcgacgta cagaatttga gcttcgtaaa gcagaagcac gcgcacatat      3540
     tttagaaggt ttacgaatcg ctcttgataa cattgacgcg attattaaat taattcgtgg      3600
     atcaaaaact tccgatgttg ctaaagaagg cttgatgaca caattcaacc tttctgacaa      3660
     acaagcgcaa gccattctgg acatgcgttt gcaacgttta acaggtttag aacgcgaaaa      3720
     aattgaagaa gaataccaaa acttagtagc attaattaat gatttaaaag ctattttagc      3780
     tgatgatgag cgtattcttg aaattattcg tgaagaatta gaagaaatca aagttaaata      3840
     tgcggataaa cgtcgtacag aaatcttggc tggtgattta gtaagccttg aagatgaaga      3900
     cttaatccct gaagaagaag tagcaattac gctaactaaa cgtggttata ttaaacgttt      3960
     accactgtcg acttatcgta gtcagcgtcg aggtggtcgt ggtattcaag gtatgtcaac      4020
     acatgaagat gacttcgtag aacacctagt tgcaacgagc acgcatgata cgttactatt      4080
     cttcactaac actggtaaag tttaccgttc gaaaggttat gaagtacctg aatacggtcg      4140
     taccgccaaa ggtatcccaa taatcaactt acttggaatc gaaagccaag aacaagtgaa      4200
     cgccgtgata aatctatccg aattcaccga tgatagctac ctattcttca cgacgaaaca      4260
     tggtgtcgtg aagcgtacaa ccctttctca atttgcgaaa atccgtcaaa gtggccttcg      4320
     tgctgtagaa cttcgtgaaa acgatgaact catttctgtt caaatgacag atggtagcaa      4380
     aaacatgatt atcgcaacga aacatggtca atctatctac ttcccagaag aaaatatccg      4440
     tgtaatgggc cgtacagctg ctggtgttcg tggtattaga cttcgtgaag acgatgaagt      4500
     tatcggcatg gaagtactgg aggacgatga aaaagtactc gttgtaacgg aaaaaggtta      4560
     tggtaaacaa acgccagcct cccaatatcc gcttcgtaat cgtggtggta tgggtgttaa      4620
     aaccgttaca atcacagaga aaaatggtaa cttagtagca atgaaaactg ttactggtga      4680
     agaggactta atgctaatga cagtaagtgg cgtattaatt cgtttcgaaa ttgatacagt      4740
     atcacaaact ggtcgtagcg caatgggtgt taaactaatt cgtcttgatg aagatgaaaa      4800
     agtagccact gttgcaaaag taccaaaaga agaagatgaa gttgagcttg aggaagaaat      4860
     cgacgaaaca ttaatcacgc aagttcctga tgaaagtttt gaagatgctc ctggaagcga      4920
     catagaagaa taaaatcaag ctggaaatga ctctaatttg cgaattagaa cgattttcca      4980
     gctttttttc agtataaaaa agcgcttttt ggatgtattt tatgtataat atccttaata      5040
     cgtctaaaaa agggaagagt tgaaaaaatg cgcaaactga ttcaatttct gtttatagca      5100
     gtagttttat ttttagtgga atatgtttta atcaatcaag cagctatatt attcttagta      5160
     acaagtggga ttatccaact atgcggggtt attatcgcca ttcgactact cctatttgac      5220
     caacggaata ctagctcaaa agtcgcctgg gttgcggtta tttttatttt gcctgtactc      5280
     ggaacgatta gttaccttgt gttcggtaga aatccagcaa ctagaaaatt cagcacagct      5340
     caagtaaagg aaaaaacaaa attaattaat gcgattcatg caattccaaa caacactaat      5400
     gaaaaattgc cacgactatc aaaaagaata gcgcatttaa cgtccataga gccaatcaag      5460
     gggaataaaa tcgaaatatt aacaaatggt gaggaaactt ttccagtgct cctagacgcg      5520
     cttagaaagg ctgaaaacca cattcacatt caatattaca ttttcaaaac ggatgcgatt      5580
     tctactgaaa ttcgtgatat tttggtggaa aaggcgaaat ctggtgttga ggttagattt      5640
     atgtttgatg gtctcggatc aagcaaactg ggtaaagcct ttttagctcc tttgaaagag      5700
     gctggagtta gtattcacgc atttgatcca attgcctccc cctggattgt aagaacagcc      5760
     aatttaagaa atcaccgtaa aatcgtggtg attgatggcc aaattggctt tacaggtggg      5820
     cttaatattg gggaagaata tcgttccaat acacctgatt ttcgtgtttg gcgcgataca      5880
     cacataaaaa taacaggcca agctgtaatc gaactccaag aatccttcct aaacgattgg      5940
     gtatacatgg aaaatcaagc tggcgccgct gacgggttta ttagcgaatc tggttcaaaa      6000
     caatattttt ctccagtcga tatgggtgat gaatgggctc aagttattta cggcggacca      6060
     tatgataaag aaaaatgggt tcgggattcg atgcttgatt tgattgattc cgctaaagaa      6120
     tcagtttgga ttgtatcacc ctatttcgtt ccagatgagg agtcgcttgc ggttattcgc      6180
     cgggttgcga tgagtggtgt tgacgtgcgg gttattattc ctggtaaagg cgatcgcggg      6240
     acttcattcc acggaagtaa tgcttatgta aaaacaatga ttgaagcagg cgcgaaaatg      6300
     tatgcttatg ccgatgactc ttttgttcat gccaaagcaa tgcttgtgga cggaacacgt      6360
     gcggctattg gaactgccaa ttttgacgtg cgtagtttta gattgaatca tgaattaatg      6420
     gtattcttat atgatgaaag cgaggctatg catcatttaa aacgtgactt caaaaaagat      6480
     tttgaagata gccgactatt tacgatgaaa gatatggaaa acaaaccatt attgactcgt      6540
     ataaaagaag ttctatccag tttactatca ccaattttat aatttaggag tggaaaaatg      6600
     agtggagatt taaaacttag accgcttgaa cgagaagatt taaaatttgt tcaccggtta      6660
     aataatgatg cgaaaataat gtcttattgg tttgaagagc catatgaggc gttcgtcgag      6720
     cttcaggagc tatatgataa acacattcac gaccagtcag aacgccgttt tattttagag      6780
     ttagatggac aaatggttgg attagtcgag ttaatggaaa ttgattatat tcacagaaga      6840
     gccgaatttc aaattattat tgatcctaag tttcagggac acggttatgc tgtttctgcc      6900
     acaaaactag caatgaaata tgcttttcac gtactaaata tgcgtaaatt atatttagtt      6960
     gtcgataaag taaacgaaaa agcaattcat gtttatgaaa aagttggctt tattcgtgaa      7020
     ggcgagctaa ttgatgagtt tttcgttgat gggacttatc atgatgctat tagaatgtgt      7080
     attttccaac atcaataccg agaaatggat atttaaaaag tgattggcgc gggaaaagtt      7140
     gcgccagtca ttgttttggg tcaaaaaaag ttctataata aggttttagt gaaaaaatta      7200
     tggtatcatg aagtattaaa gtttgtatta ttttgatgga gaaaggattg gcgtgcattg      7260
     gctacaggca ttgggacagc taaaatgata ttatgcggag aacatgcagt tgtatacgga      7320
     gaaccggcaa tttcagtccc atttacacaa gcagtagtaa cgacaaatgt agaaacttct      7380
     ataaaaacca aattttcttc agcatttttt tcaggtgatt tagatgatat gcctgatttc      7440
     ttagcaggaa tcaaagcatt agtcgtagat gttttaaatg aaattggaaa tggtgaatgt      7500
     gtttcgattc atgtggtttc aggtgttcca atcggccgag gattaggttc aagtgctgct      7560
     gtagcaacaa gtattgcgcg tggcttatat aaatacttta atcaagaatt agactcgaaa      7620
     aaattattag ccattgtgaa tgctgcagaa aaaattgctc atggcaatgc tagtggtgtt      7680
     gatgctatca cggttgtgag tgaaaaacca gtatggtatg agcgagatcg aaaactagaa      7740
     attatgcatt ttccaaaaaa aattacgttc gtagtagcgg atactggagt tccgagtgaa      7800
     accagagacg cggtgaagga tgttcaagtt ttatataaag aaaatcaagt agaaattggt      7860
     aaaataattc atcaactcgg cgatatttcc cgggaaataa agacacattt agaaggcgat      7920
     gcagatactg tgaagatagg agctgcaatg aataaggcac aatcttattt agaaactttg      7980
     acagttagtg acagtagttt agagaaatta attaaagtag ctagaagtaa tggcgcggac      8040
     ggggcaaaac ttactggtgg cggtagaggt ggatgcatta ttgctgtagc gaaaaatcaa      8100
     gaaatcgctg aacaaataac gaaggcgctt cataatgctg gagctgcaca agaatggatt      8160
     tttacgattg gagaaggtag ttatgaaagc gacagccatc gcacacacga atgtggcgct      8220
     aattaaatac tggggaaaac gcgatgaaca cttgattcta cctgcaaaca gtagtttatc      8280
     cttcacggta gataaatttt atacaaagac aacggtagaa tgggacgaaa aattaaccca      8340
     agatacattt attttaaata atgaacaaaa aacggatgca aaagtagctc gttttataga      8400
     taaaatgcgg gaggaattc                                                   8419
//

If you have problems or comments...

PBIL Back to PBIL home page