(data stored in ACNUC7421 zone)

EMBL: AF093503

ID   AF093503; SV 1; linear; genomic DNA; STD; PRO; 8308 BP.
XX
AC   AF093503;
XX
DT   16-OCT-1998 (Rel. 57, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Salmonella typhimurium ferrichrome uptake protein FhuB (fhuB) gene, partial
DE   cds; fimbrial operon, complete sequence; glutamate 1-semialdehyde
DE   aminotransferase (hemL) gene, partial cds; and unknown gene.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   1-8308
RX   PUBMED; 10482505.
RA   Emmerth M., Goebel W., Miller S.I., Hueck C.J.;
RT   "Genomic subtraction identifies Salmonella typhimurium prophages, F-related
RT   plasmid sequences, and a novel fimbrial operon, stf, which are absent in
RT   Salmonella typhi";
RL   J. Bacteriol. 181(18):5652-5661(1999).
XX
RN   [2]
RP   1-8308
RA   Emmerth M., Hueck C.J.;
RT   ;
RL   Submitted (21-SEP-1998) to the INSDC.
RL   Lehrstuhl fuer Mikrobiologie, University of Wuerzburg, Am Hubland,
RL   Wuerzburg 97074, Germany
XX
DR   MD5; 40e5294c4d518864ac1b45478e87c176.
DR   EuropePMC; PMC94084; 10482505.
DR   EuropePMC; PMC96859; 10496884.
DR   StrainInfo; 5592; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8308
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /map="5 centisomes"
FT                   /strain="ATCC14028s"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:90371"
FT   CDS_pept        <1..662
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /product="ferrichrome uptake protein FhuB"
FT                   /note="similar to Escherichia coli FhuB"
FT                   /db_xref="GOA:O87656"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87656"
FT                   /protein_id="AAC64151.1"
FT                   /translation="VPGKPSGWYCLAESXGXRRHWLIIMIAAGRGGFSPQRMLLAGMAL
FT                   STAFTMLLMMLQASGDPRMPKVLTWLSGSTYNATGGQVTRTAIVMVILLAIVPLCRRWL
FT                   TILPLGGDAARAVGMALTPSRIALLALAACLTATATMTIGPLSFVGLMAPHIARMLGFR
FT                   RTMPHMVISALAGGVLLVFADWCGRMALFPYQIPAGLLSSFIGAPYFIYLLRKQSR"
FT   CDS_pept        1602..2162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfA"
FT                   /product="major fimbrial subunit StfA"
FT                   /db_xref="GOA:O87657"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:O87657"
FT                   /protein_id="AAC64152.1"
FT                   /translation="MNTAVKAAVAAALVMGVSSFANAAGSNTGTVTFTGTIEDSPCSIV
FT                   VGDEHQTVNLGHIGTGSLMGGKESSKVDFHIGLENCAFTTEKEASTVFSAIGNESSANP
FT                   GSVALMRIGGGEMAGSSIVIGNHLGSAIKLGDAYSENLTMNGSVAAAKQTLNFKAWVKG
FT                   DSAATTIDTGEFSSTVNFTISYL"
FT   CDS_pept        2248..4905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfC"
FT                   /product="outer membrane usher protein StfC"
FT                   /db_xref="GOA:O87658"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:O87658"
FT                   /protein_id="AAC64153.1"
FT                   /translation="MAHYKKFRLSTLAAVVGIVLAVGPENSYAEAPIQFNTRFLDVKDD
FT                   ASLDLSRFSRKGYIMPGSYHLQVLVNQSQIVQDNVITYSVDNNDPDNTYPCLSPELVSL
FT                   LGLKPEIADKMIWINAGQCLQPDQLEGMETQTDLSQSTLTVIIPQAYLEYSDEEWDPPS
FT                   RWDEGIPGVLFDYNVNSQWRHAEHDDGDEYDISGNGTVGANLGAWRLRADWQANYRHEN
FT                   DSEDKDNFGSSSEQNWDWNRYYAWRAIPQLRAQLTLGEGSLESDIFDGFNYVGGSLITD
FT                   DQMLPPNLRGYAPDISGVARTNAKVTVTQRGRVIYESQVPAGPFRIQDINETVSGDLHV
FT                   KIEEQSGQVQEYDVSTASIPFLTRPGQVRYKLAAGRPQDWDHNMEGGFFTSAEASWGIA
FT                   NGWSLYGGAIGEQDYQALALGLGRDLALLGAFSVDVTHSRATLPEGSAYGDGTIQGNSF
FT                   RASYAKDFDDIDSRLTFAGYRFSEENYMTMDEFIDTHNDDNDRQRTGHDKEMYTLTYSQ
FT                   NFSAINVNAYINYTHRTYWNQPNQDSYNLTLSHYFDVGEVRGISLSVNGFRNEYDNERD
FT                   DGVYVSLSIPWGNNRTLSYNGSFSDDNNSNQVGYYERIDDRNNYQINAGRADNGATLDG
FT                   YYRYQASYADIDVSANYQEGDYTSGGLNIQGGATLTAKGGALHRTSVNGGSRLLVDVGD
FT                   EANVPISGYSTPVYTNAFGKAVIVDVNDYYRNQVKIDITQLPEDAEAILSIAQATLTEG
FT                   AIGYRRMEVLSGKKAMASIRLRDGGTPPFGAEVYNSRQQQLGIVGEDGSVYLIGINPGE
FT                   RLQVTWEGKTQCEATLPDPLPGDLFSGLLLPCIGDASSPEATQPEEKPLLQLHTQRRTS
FT                   STQPEALSSRYPTH"
FT   CDS_pept        4923..5675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfD"
FT                   /product="periplasmic fimbrial chaperone StfD"
FT                   /db_xref="GOA:O87659"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:O87659"
FT                   /protein_id="AAC64154.1"
FT                   /translation="MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISV
FT                   DLKNANSKLPYLAQSWVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQ
FT                   DRETLFYYNVREIPPQSDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQG
FT                   NGYQVSNTTGYYVVLSNASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYV
FT                   NDYGARLPLIFNCTDNSCAVDEAKSRKS"
FT   CDS_pept        5694..6206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfE"
FT                   /product="minor fimbrial subunit StfE"
FT                   /db_xref="GOA:O87660"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:O87660"
FT                   /protein_id="AAC64155.1"
FT                   /translation="MRQWRLRLGTVTCAAMLSAVSMPLAAGSKTVNMTLTIVVNAAPPC
FT                   TVTGGEVEFGNVLTTKVDGVNYRQAVGYRLSCNGRVSDYLKLQIQGNAVTINGESVLQT
FT                   DVDGLGIRLQTATDGALISPGNTQWLSFQYSGGSGPAIEAIPVKNNGVTLTGGAFNAGA
FT                   TLVVDYQ"
FT   CDS_pept        6203..6679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfF"
FT                   /product="minor fimbrial subunit StfF"
FT                   /db_xref="GOA:O87661"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:O87661"
FT                   /protein_id="AAC64156.1"
FT                   /translation="MKKIVLTMLMGGSLAAQAADNLKFHGTLISPPNCTINNDQTIDVK
FT                   FGNLLINKIDGTRYAQNVPYEITCDSTVRDETMAMTLTLSGSVSDFNPAAVNTSVAGLG
FT                   IELRQNDQPFTLGSTITVNEQSIPVLKAIPVKKSGASLKEGGFDATATLQVDYQ"
FT   CDS_pept        6679..7200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfG"
FT                   /product="minor fimbrial subunit StfG"
FT                   /db_xref="GOA:O87662"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:O87662"
FT                   /protein_id="AAC64157.1"
FT                   /translation="MAKRQALLHGAACILCGALILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GTGIAEVDFSSLDSSDFTPDGQSARKPLVFELTDCDSALSNGVQVTFTGTEATGMRGIL
FT                   AIDSYSGASGIGIGIETLSGVPVGMNDKEGAIFTLVTGKNTLNLNAWVQRLPGRGPDSG
FT                   KVLCKCASHI"
FT   CDS_pept        7210..8049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown"
FT                   /note="ORF1"
FT                   /db_xref="InterPro:IPR021407"
FT                   /db_xref="UniProtKB/Swiss-Prot:O87663"
FT                   /protein_id="AAC64158.1"
FT                   /translation="MKIIRTLFLLLIAVYGSSVVAKPMLKATFSSTTMYYGIGPNSDKS
FT                   IVAEVTIATPEGVYYGSWNLSGHRKGETLTADSWSGPEPAPKVVLKDFDNTVSRSACKN
FT                   LPSNWXGCGSFTLEITVQSDDYGCPWLASSHIVATTFITNETYSPPDTRSSVCPKVPVD
FT                   TFDISWDANVSKQKTTLMLDATGGTVNRTLHTYLMEGGKLCDGSKFDNRGAYCRFVSSG
FT                   ITLNVLGCDQSSVTTSAVDHPITDVELHDINVAVNTRNIGSGQFTSTCSFQYIIDEL"
FT   CDS_pept        complement(8157..>8308)
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /product="glutamate 1-semialdehyde aminotransferase"
FT                   /note="GSA"
FT                   /db_xref="GOA:P0CL07"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CL07"
FT                   /protein_id="AAC64159.1"
FT                   /translation="RFKXFFHLMLEXGVYLAPSAFEAGFMSVAHSMDDINNTIDAARRV
FT                   FAKL"
XX
SQ   Sequence 8308 BP; 2013 A; 2030 C; 2241 G; 2017 T; 7 other;
     aagtgccggg aaagccttcg ggttggtact gccttgccga aagcntgggc ncgcggcgnc        60
     actggctgat tattatgata gccgccgggc gcggcggttt ctcgccgcaa cggatgttgc       120
     tggcggggat ggcgctcagc accgcgttta ccatgctgct aatgatgctc caggcgagcg       180
     gcgacccgcg gatgccgaaa gtattgacct ggctctcagg atctacctat aacgccactg       240
     gcgggcaggt tacgcgaacc gcgatcgtga tggtgatttt gctggccatt gtgccgttgt       300
     gtcgccgctg gttaacgatt ttgcccctgg gcggcgatgc cgcgcgtgcg gtgggcatgg       360
     cgcttacgcc gtcgcgtatc gcgctgctgg cgctggcggc ttgtttgacg gcaaccgcga       420
     cgatgaccat tgggccgctg agtttcgttg gactgatggc gccgcatatt gcgcggatgc       480
     tcggttttcg ccggacgatg ccgcatatgg tcatctcggc gctggcaggg ggcgttttac       540
     tggtctttgc cgactggtgc ggcaggatgg cgctatttcc gtatcagatc ccggcgggac       600
     tgctttcaag ctttattggc gcgccgtact ttatctattt gctacgtaaa cagagtcggt       660
     aaaaaaaagc tgtgccacat ttatgtcggg tggcagccat gctcaacccg acctacaaat       720
     tacacaatat caatatgttg tggcaatatt ttgtaggcct aaaaatagct gaacgctatc       780
     aggtgcgaga gctgtcctgt cacgttttat cgagggaact ctgcttttat tttcagcaag       840
     aagcaggtgt tatttttgta tcgataagtc atgagctatt tcagtggcgc gccgctgtct       900
     cgtgaacagg gtgactcatt tcaacatatc caggcccgaa acggttgatg ataaattgcg       960
     gcatgatcta tccaataata agaattaccg gtttcggtat taagcctttt taaatattaa      1020
     gatgcggatg ccgcatcttt aatgcatctc gtaaatcaat tttaatttaa taataaattt      1080
     tcattataaa acttcgataa taaaatatta tttttttatc gaagtaataa aaaacaactc      1140
     tattaaaata aattaattgc cacgagtaaa caaaaaaaat gtaatttagc attttttgtt      1200
     ttttttaatg aaatttatac caaaaataaa tgttacgcgt cattgctata tattcagtac      1260
     tgtaattctg atcttttttt attcatttta catgtttatt gtttttttgg ctctcccgtc      1320
     ttgcttgctt tgtttgtttt ttgaacggta aaaatattta ttatttaatt ctgataatcc      1380
     tttaaataaa aaacgcttgt ctttgggttt ttaatggaaa atacttcacc gcgcctaagg      1440
     gatgttattt attaacgtgt tgtttgcttc ttttgaatgt tgcatcggca atttcataac      1500
     tcgtcatata atatatatct actaatataa acatggggta ttgagtataa ctctgtgtga      1560
     atagcgtaaa aatactcacc aacttttaat aaggatgaaa aatgaataca gcagtaaaag      1620
     ctgcggttgc tgccgcactg gttatgggtg tttccagctt tgccaatgct gcgggcagta      1680
     atactggtac ggtgactttt accggtacta ttgaagattc accgtgttca atcgtggttg      1740
     gcgacgaaca ccagaccgtt aacctgggcc atatcggtac cggttctctg atgggcggta      1800
     aagaatcttc aaaagtcgat ttccatatcg gtctggaaaa ctgcgcattc accactgaga      1860
     aagaagcgtc taccgttttc tctgccatcg gtaacgaatc cagcgctaat ccgggcagcg      1920
     ttgcgctgat gcgtatcggc ggcggcgaaa tggcgggttc cagcattgtt atcggcaacc      1980
     acctgggttc cgcgatcaaa ttgggcgacg cttacagcga aaacctgacg atgaacggca      2040
     gcgttgcggc ggcgaaacag actcttaact tcaaagcctg ggtgaaaggc gattctgctg      2100
     ccaccactat cgataccggc gaattcagca gcaccgtaaa cttcacgatc agctatctgt      2160
     aagtgaaata tcatcctgcg gcagtctgcc gcaggatgat gctcaaagta aaaaaataga      2220
     ttatatattt cagggataga ttgtctgatg gctcactata aaaaatttcg tctgagcacg      2280
     cttgcggccg tggtgggtat tgttctggct gtcggtccgg aaaatagcta cgcggaagcg      2340
     cccattcaat ttaatacccg atttcttgat gttaaagatg atgccagcct ggatctctcc      2400
     cgtttttccc gtaaaggcta cattatgccg gggagctatc atctccaggt gctggtcaat      2460
     cagagtcaaa ttgtccagga taatgttatt acgtattccg ttgataataa cgatcctgat      2520
     aacacctatc cctgtttatc gcctgaactg gtctcgctgc tggggttaaa acctgaaata      2580
     gcagataaaa tgatctggat aaatgccggt cagtgtctgc aaccagatca actggaaggg      2640
     atggaaaccc aaacggattt aagccagtca acgctgacgg tgattattcc gcaggcgtat      2700
     ctggaataca gcgatgaaga gtgggatcca ccttcccgct gggatgaagg gattcccggc      2760
     gtattatttg actacaacgt taacagccag tggcgacatg ctgaacatga tgacggcgat      2820
     gaatatgaca tcagcggcaa cggcacggtg ggtgccaacc tcggcgcgtg gcgtttgcgc      2880
     gcggactggc aggctaacta tcgtcacgaa aatgacagcg aagataaaga caactttggc      2940
     tccagttccg aacagaactg ggactggaac cgctattacg cctggcgggc gatcccgcag      3000
     ctccgggcgc agctaacgct gggcgaagga tcgctggaat ccgatatttt cgacggcttt      3060
     aactatgttg gcggcagcct tatcaccgac gatcagatgt taccgcctaa tctgcgcggc      3120
     tacgccccgg atatatcagg cgtggcgcgc accaacgcca aagtcaccgt gacccagcgc      3180
     gggcgggtga tttatgagtc gcaggtcccg gctgggccgt ttcgcattca ggatattaat      3240
     gaaacggtat ccggcgatct acacgtcaaa attgaagaac aaagcggtca ggtgcaggaa      3300
     tatgacgtca gcaccgcctc cattccgttt ctgacccgtc ccggccaggt gcgctacaag      3360
     ttggcagccg ggcgaccgca ggactgggat cacaatatgg aaggcggctt tttcacctca      3420
     gccgaagcct cctgggggat cgctaacggc tggtcgctgt acggcggtgc catcggtgag      3480
     caggattatc aggcgctggc gttaggactg gggcgcgatc tggcgctgct gggcgcgttt      3540
     tccgtcgatg tcacccattc ccgtgcgacg ctgccagagg gtagcgccta cggcgacggc      3600
     accattcagg gtaactcgtt ccgtgccagc tacgctaaag attttgatga tatagacagc      3660
     cgtctgacgt ttgctggtta tcgcttttcc gaagaaaact acatgacgat ggacgagttt      3720
     atcgatacgc ataatgacga taacgatcgt cagcgcaccg gccacgataa agagatgtat      3780
     accctgacgt acagccagaa cttttcggca ataaacgtca acgcctatat caactacacc      3840
     catcgcacct actggaatca acctaaccag gacagctata acctgacgct gtcgcactat      3900
     ttcgatgtcg gtgaggtgcg cgggatcagt ctgtcggtga acggttttcg caacgaatat      3960
     gacaatgagc gtgatgacgg cgtgtacgtc tcgctcagta ttccgtgggg caacaaccgc      4020
     acgctgagct acaacggctc ctttagcgat gacaacaaca gcaatcaggt cggctattac      4080
     gagcgcattg acgatcgcaa taactaccag atcaacgctg gtcgcgcgga taacggtgcg      4140
     actctcgacg gctactaccg ttatcaagcg agctatgccg acattgacgt cagtgcgaac      4200
     tatcaggaag gcgactatac ctccggcgga ctgaacatcc agggcggcgc gacgctgact      4260
     gctaaaggcg gggcgttgca ccgcaccagc gtcaacggcg gctcgcggct gctggtggat      4320
     gtcggcgatg aagcgaacgt acccatctcc ggctacagca cgccggtata taccaacgcg      4380
     tttggtaaag ccgtcattgt cgacgtcaac gactactacc gcaaccaggt gaaaatcgac      4440
     attacccagt tgccggaaga cgcggaagca atcctctcca tcgctcaggc gaccctgacg      4500
     gaaggggcga tcggttatcg ccgcatggag gtgctcagcg gtaaaaaagc catggccagt      4560
     atccgcctgc gcgatggcgg cacgccgccc ttcggcgcag aggtttacaa cagtcgccag      4620
     caacagttag ggatcgtagg tgaagacggc agcgtttatc tgatcggcat taaccccggc      4680
     gagcggttgc aggtgacatg ggaaggtaaa acgcagtgtg aagcgacgtt gcccgatccg      4740
     ctgccgggcg atctgtttag cggcctgttg ctgccgtgca tcggcgacgc ttcatcacct      4800
     gaggcaacgc agcccgaaga gaaaccatta ctccagcttc atacgcagcg gcggacgtct      4860
     tcgacgcaac ccgaagcgct ctcttctcgt tatccaacac attgattcag gaaaccgcat      4920
     tcatgatgtc attaaaacgt tataacctgg ccgctgtttt gctgcttttg ctgggcggct      4980
     acggtagcgc ccaggccgcc atcgcgcccg atcgcacccg cctggtgttt cgcggcgaag      5040
     ataaatcgat aagcgtcgat ctgaaaaacg ccaacagcaa actgccctat ctggcgcagt      5100
     cctgggtgga agatgagaag ggcgtcaaaa tcacctcgcc tttaatcgtc gtcccaccgg      5160
     tccagcgcat tgagccgtcg gcaatcggac aggtcaaaat tcaggggatg ccggcgctgg      5220
     cgtcgctccc ccaggatcgg gaaacccttt tttattacaa cgtgcgcgaa attccgccgc      5280
     aaagcgacaa gcccaatacg ctgcaaatcg ccctgcaaac gcgcatcaaa gttttttacc      5340
     gcccgcaggc gctatcgaaa atcgatatgc agcatccctg gcaatacaag atcacccttc      5400
     agcgtcaggg caatggctat caggtgagca acacaaccgg ctactacgtg gtgttaagca      5460
     acgccagcaa ccgcatggac ggcacaccag ccagaggctt tagcccttta gtgattgcac      5520
     caaaaagcaa cgtgacgctg ggaggggacg ccagtgaatt aggtcactcg cctgtgctga      5580
     cttacgtcaa cgattatggc gcgcggttac cgctgatttt taactgtact gacaacagtt      5640
     gtgcggtaga tgaagcaaaa agcagaaagt cgtaaccgac aaggagacgc aagatgaggc      5700
     aatggcggtt acggctgggc acggtaacgt gtgcggccat gctgagtgcg gtcagtatgc      5760
     cgctggcagc gggaagtaag acggtcaaca tgacgctgac gatagtcgtt aatgccgcgc      5820
     cgccctgtac tgtgaccggc ggtgaggtgg aatttggcaa tgtgttgacg acgaaagtgg      5880
     atggggtgaa ttaccggcag gcggtgggct atcgcctgag ctgtaacggc agagtgagcg      5940
     attacctgaa gttacagatt caggggaatg cggtgactat caatggcgag tcggtattgc      6000
     aaaccgatgt cgatggattg ggtatccgtc tgcaaaccgc cacggatggc gcgctgattt      6060
     cacccggcaa tacgcaatgg ttgtcatttc aatacagcgg cggcagcggt ccggccattg      6120
     aggcgattcc cgtcaaaaat aatggcgtaa cgttaacagg tggcgcgttt aacgcaggcg      6180
     ccacgttggt ggtggattac caatgaaaaa aatagttttg acgatgttaa tggggggcag      6240
     ccttgccgca caggcagccg ataatcttaa gtttcacggc acattaattt caccgccgaa      6300
     ttgtacgatt aacaatgatc agacgatcga cgttaagttc ggtaacctgc tgattaataa      6360
     aatagatggt acgcgttatg cgcagaatgt tccgtatgag atcacctgtg attcaacggt      6420
     gcgcgatgag acgatggcga tgaccctgac gctaagcggt tccgtgagtg attttaatcc      6480
     ggcggcggta aacaccagcg tggcggggct ggggattgaa ctcaggcaga acgaccaacc      6540
     ctttacgttg gggtccacca ttacggtgaa tgaacaatcg atacctgttc tgaaagccat      6600
     accggttaaa aagagcggtg cttcgctgaa agaaggcggc ttcgatgcga cggcaacatt      6660
     acaggtggat tatcagtaat ggctaaaaga caggcgttat tacacggcgc ggcctgcatc      6720
     ctctgtgggg cgctgatatt gccggtctca gcggcagata acctgcattt ttccggtagc      6780
     ctggtggcca gtccttgcac gctcacgatg caggggacgg ggattgccga agtcgatttt      6840
     tcgtcgcttg acagttctga tttcactccc gacggccagt ctgctcgtaa gcctttggtg      6900
     tttgaactca cggattgcga ttcggcgctg agtaacgggg tgcaggtgac tttcactgga      6960
     accgaagcga ccggaatgcg cggtatcctg gccatcgata gctattcagg cgcttccggg      7020
     atcgggattg gtattgaaac gctatccggc gttcccgtgg gcatgaacga taaagagggt      7080
     gcgatattta cgctggtgac ggggaaaaat acgctaaacc tgaatgcctg ggtacaacgt      7140
     cttcccggcc gaggacctga ttccgggaag gttctctgca agtgcgctag ccacatttga      7200
     gtatttataa tgaaaataat acggacttta tttttgctgc tgattgccgt ttatggcagt      7260
     tcggtagtgg ccaaacccat gctgaaagcg acgttttcaa gcaccacgat gtattatggt      7320
     attggcccta atagcgacaa atctattgtg gcggaggtga cgatagcgac tccggaggga      7380
     gtgtactatg gctcctggaa cctttcggga catcgtaaag gagaaacgct aaccgcagac      7440
     tcctggtctg ggccagaacc tgcgccgaag gttgtattga aggattttga taacactgtt      7500
     tcgcgatctg cgtgcaagaa tcttccctcg aactggangg ggtgtggttc ttttaccctg      7560
     gagattacgg tacaaagcga tgattatggt tgcccctggc tggcgtcnag ccatatcgtt      7620
     gctaccactt ttatcactaa cgaaacgtat tccccgccgg atacgcgcag ttcagtttgc      7680
     ccgaaagttc ccgttgatac ttttgatatc tcctgggatg cgaacgtttc gaaacagaaa      7740
     acaaccctca tgcttgatgc caccggtggc acggtgaatc gcacgttaca tacctatttg      7800
     atggaggggg gaaaactgtg cgatggcagc aaatttgaca accgtggcgc ttattgccgt      7860
     tttgtctcat cgggtattac gctcaatgtg ctgggctgcg accagtcgag cgtcacgacc      7920
     agcgccgttg atcatccgat aaccgatgtt gagcttcatg acattaatgt agcggtgaac      7980
     acccgcaaca ttggctccgg gcagttcacg tcgacctgta gcttccagta tattattgat      8040
     gagctttagg ggggctgggt gtttggcgaa gattcacgct aacctggtat gaaccaaaaa      8100
     aaaaccgggt ggcggcttcg ccttacccgg cctacgttgt ttctggacgt tctcttttac      8160
     agtttcgcaa acacccgacg cgcggcgtca atagtattat taatgtcgtc catgctgtgt      8220
     gcgaccgaca taaagcccgc ctcaaacgcc gatggcgcca gatatacgcc ttnctccagc      8280
     atcaggtgga agaaacnctt aaagcgtt                                         8308
//

If you have problems or comments...

PBIL Back to PBIL home page