(data stored in ACNUC15260 zone)

EMBL: AF102519

ID   AF102519; SV 1; linear; mRNA; STD; MUS; 669 BP.
XX
AC   AF102519;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   10-FEB-1999 (Rel. 58, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor B6 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-669
RX   DOI; 10.1016/S0092-8674(00)81716-X.
RX   PUBMED; 9875846.
RA   Krautwurst D., Yau K.W., Reed R.R.;
RT   "Identification of ligands for olfactory receptors by functional expression
RT   of a receptor library";
RL   Cell 95(7):917-926(1998).
XX
RN   [2]
RP   1-669
RA   Krautwurst D., Yau K.-W., Reed R.R.;
RT   ;
RL   Submitted (29-OCT-1998) to the INSDC.
RL   Molecular Biology & Genetics, HHMI, Johns Hopkins Medical Institutes, 725
RL   N. Wolfe Street, 818 PCTB, Baltimore, MD 21205, USA
XX
DR   MD5; 3ac051b7181d45fc9a33a20f835cda76.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..669
FT                   /organism="Mus musculus"
FT                   /strain="BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>669
FT                   /codon_start=1
FT                   /product="olfactory receptor B6"
FT                   /note="ORI-B6; encodes transmembrane regions II-VII"
FT                   /db_xref="GOA:Q9Z1V4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333826"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z1V4"
FT                   /protein_id="AAD13311.1"
FT                   /translation="CNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFFLAWSA
FT                   SSELLLLTAMAYDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGLMTRLS
FT                   FCGPKVITHFFCEIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCIIASIL
FT                   RMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSIVSPTL
FT                   N"
XX
SQ   Sequence 669 BP; 126 A; 194 C; 148 G; 201 T; 0 other;
     tgcaacctgg ctaccacgga tattttgtgc acctcctctg tgattcctaa ggccttggtt        60
     ggcctagtgt ctgaggaaaa cactatctcc ttcaaggaat gtatgtctca gctcttcttc       120
     cttgcatggt cagcatcttc tgagctgctg ctgctcacgg ccatggccta tgaccgctat       180
     gtggccatct gctgtcccct gcactacagc tctaggatga gcccacagat gtgtggggcc       240
     ctggccatgg gtgtatggtc catcagtgct gtgaatgcat ctgtgcacac tggcctgatg       300
     acacggctgt cattctgtgg acccaaggtc atcacccact tcttctgtga gattccccca       360
     ctcctcctgc tctcctgtag tcctacatat gtaaatacca ttatgactct tttgggagat       420
     tccttttttg gaggcgtcaa ttttgtgctt accttgctat cctatggctg catcattgcc       480
     agcatcctgc gcatgcgttc tgctgagggc aagaggaagg ccttttctac ctgctcatcc       540
     cacctcattg tggtctctgt gtactactca tctgtgttct gtgcctatgt cagccctgct       600
     tccagctaca gtccagaaag aagcaaagtt acctcagtgt tatactcgat cgtcagccca       660
     accctcaac                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page