(data stored in ACNUC15260 zone)

EMBL: AF102540

ID   AF102540; SV 1; linear; mRNA; STD; MUS; 669 BP.
XX
AC   AF102540;
XX
DT   11-DEC-1998 (Rel. 58, Created)
DT   10-FEB-1999 (Rel. 58, Last updated, Version 2)
XX
DE   Mus musculus olfactory receptor H7 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-669
RX   DOI; 10.1016/S0092-8674(00)81716-X.
RX   PUBMED; 9875846.
RA   Krautwurst D., Yau K.W., Reed R.R.;
RT   "Identification of ligands for olfactory receptors by functional expression
RT   of a receptor library";
RL   Cell 95(7):917-926(1998).
XX
RN   [2]
RP   1-669
RA   Krautwurst D., Yau K.-W., Reed R.R.;
RT   ;
RL   Submitted (29-OCT-1998) to the INSDC.
RL   Molecular Biology & Genetics, HHMI, Johns Hopkins Medical Institutes, 725
RL   N. Wolfe Street, 818 PCTB, Baltimore, MD 21205, USA
XX
DR   MD5; 0d1b75a58c9d969b2869dff3160e6344.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..669
FT                   /organism="Mus musculus"
FT                   /strain="BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="olfactory epithelium"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>669
FT                   /codon_start=1
FT                   /product="olfactory receptor H7"
FT                   /note="ORI-H7"
FT                   /db_xref="GOA:Q9Z1T8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333885"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z1T8"
FT                   /protein_id="AAD13332.1"
FT                   /translation="CNLATMDIVCTPSVIPKALIGLVSEENTISFKGCMAQLFFLLWSL
FT                   SSELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGLMTRLS
FT                   FCGPKVITHFFCEIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCIIASVL
FT                   RMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSILSPTL
FT                   N"
XX
SQ   Sequence 669 BP; 122 A; 202 C; 150 G; 195 T; 0 other;
     tgcaacctgg ccaccatgga cattgtgtgc accccctctg tgattcctaa ggccctgatt        60
     ggcctagtgt ctgaagaaaa caccatctcc ttcaaaggat gcatggctca gctcttcttt       120
     cttctgtggt ccttgtcttc ggagctgctg ctgctcacgg tcatggccta tgaccgctat       180
     gtggccatct gctttcccct gcactacagc tctagaatga gcccacagct ctgtggggcc       240
     ctggccgtgg gtgtatggtc catctgtgct gtgaatgcat ctgtgcacac tggcctgatg       300
     acacggctgt cattctgtgg ccccaaggtc atcacccact tcttctgtga gattccccca       360
     ctcctcctgc tttcctgtag tcccacatac attaatagcg ttatgacact tgtggcagat       420
     gccttttatg ggtgcatcaa ctttgtgcta accttgttat cctatggctg catcattgcc       480
     agtgttctgc gcatgcgttc tgctgagggc aagaggaagg ccttttctac ctgttcatcc       540
     cacctcatcg tggtctcagt gtactactca tctgtgttct gtgcctatgt cagtcctgcc       600
     tccagctaca gcccagaaag aagcaaagtt acctccgtgc tgtactcgat cctcagccca       660
     accctgaac                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page