(data stored in ACNUC23390 zone)

EMBL: AH007909

ID   AH007909; SV 2; linear; genomic DNA; STD; HUM; 3465 BP.
XX
AC   AH007909; AF107452-AF107453;
XX
DT   31-JUL-2011 (Rel. 109, Created)
DT   31-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens homeotic protein HB9 gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3465
RX   DOI; 10.1006/geno.1999.5796.
RX   PUBMED; 10329000.
RA   Heus H.C., Hing A., van Baren M.J., Joosse M., Breedveld G., Wang J.C.,
RA   Burgess A., Donnis-Keller H., Berglund C., Zguricas J., Scherer S.W.,
RA   Rommens J.M., Oostra B.A., Heutink P.;
RT   "A physical and transcriptional map of the preaxial polydactyly locus on
RT   chromosome 7q36";
RL   Genomics 57(3):342-351(1999).
XX
RN   [2]
RP   1-3465
RA   Heus H.C., Hing A., van Baren M.J., Joosse M., Breedveld G., Wang J.C.,
RA   Burgess A., Donnis-Keller H., Berglund C., Zguricas J., Scherer S.W.,
RA   Rommens J.M., Oostra B.A., Heutink P.;
RT   ;
RL   Submitted (03-NOV-1998) to the INSDC.
RL   Clinical Genetics, Erasmus University Rotterdam, Postbus 1738, Rotterdam
RL   3000 DR, Netherlands
XX
DR   MD5; c82a94db65c98369f8ab642831c87971.
DR   Ensembl-Gn; ENSG00000130675; homo_sapiens.
DR   Ensembl-Tr; ENST00000252971; homo_sapiens.
DR   Ensembl-Tr; ENST00000543409; homo_sapiens.
XX
CC   On or before Jul 29, 2011 this sequence version replaced
CC   gi:5281125, gi:5281126, gi:5281127.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3465
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<501..1197,1573..1733,2333..>2540)
FT                   /product="homeotic protein HB9"
FT   CDS_pept        join(501..1197,1573..1733,2333..>2540)
FT                   /codon_start=1
FT                   /product="homeotic protein HB9"
FT                   /db_xref="GOA:P50219"
FT                   /db_xref="HGNC:HGNC:4979"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50219"
FT                   /protein_id="AAD41467.1"
FT                   /translation="MEKSKNFRIDALLAVDPPRAASAQSAPLALVTSLAAAASGTGGGG
FT                   GGGGASGGTSGSCSPASSEPPAAPADRLRAESPSPPRLLAAHCALLPKPGFLGAGGGGG
FT                   GTGGGHGGPHHHAHPGARAAAAAAAAAAAAAAGGLALGLHPGGAQGGAGLPAQAALYGH
FT                   PVYGYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAGTFQLDQWLRASTAG
FT                   MILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLM
FT                   LTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKGGGGGAGKGGAEEPGAEELLGPPA
FT                   PGDKGSGXRLRDLRD"
FT   exon            <501..1197
FT                   /number=1
FT   gap             1387..1486
FT                   /estimated_length=unknown
FT   exon            1573..1733
FT                   /number=2
FT   exon            2333..>2540
FT                   /number=3
XX
SQ   Sequence 3465 BP; 568 A; 1147 C; 1153 G; 496 T; 101 other;
     cagcgccgcg caacagcccg ggctgcttag gacctcgcgg cgcgggggcg gggcggcggg        60
     cggccgggac ggtgacaggt gcgcccctcg gccaatggcg gagcccgcgg ccctccccgg       120
     gcccccgctg cgcgcgccaa tcggaagccg cgctgagctt caagtgcgcg gaggggcgcg       180
     ggtccccacc acggcggcag cggcctcggc gcggtcgcct gagggctgca gcgcaaagaa       240
     ccgggctccc gggcccggac gcggggaagc actcgcgtgg gagtttgtgc gagcgcggcc       300
     cggggcgggg cccgcacgga ggaggcgccg ggaccatggt caccctcggc tgagtttccg       360
     gcggcgactt tgattattgg caaataacca ccataacaat accgagcccc cgggcttgca       420
     ccgcacgcac tgactccgcg agcccgcaca cggccgcgtc gcccgccacc gggccctgag       480
     cgccagcccc aaacgagccg atggaaaaat ccaaaaattt ccgcatcgac gccctgctgg       540
     cggtggaccc cccacgagcc gcctctgcgc agagcgcgcc gctggccttg gtcacgtcgc       600
     tcgccgccgc cgcatctggc accggaggtg gcggcggcgg cggcggggcg agcggcggga       660
     ctagcggcag ctgcagcccc gcgtcctcgg agccgccggc tgcgcccgcc gaccgcctgc       720
     gcgccgagag cccgtcgccg ccgcgcctgc tggccgcgca ctgcgcgctg ctgcccaagc       780
     cgggcttcct gggcgcgggc ggcggcggcg gcggcacggg cggcgggcac ggggggcccc       840
     accaccacgc gcatccgggc gcacgggccg ctgccgccgc cgccgccgcc gccgccgccg       900
     ccgccgctgg gggcctggcg ctggggctgc accctggggg cgcgcagggc ggcgcgggcc       960
     tcccggcgca ggcggcgctc tacggccacc cggtctacgg ctactccgcg gcggcggcgg      1020
     cggctgcgct ggcgggccag cacccggcgc tctcctactc gtacccgcag gtgcaaggcg      1080
     cgcaccccgc gcaccccgcc gaccccatca agctgggcgc cggcaccttc cagctggacc      1140
     agtggctgcg cgcgtccacc gcgggcatga tcctgcctaa gatgcccgac ttcaactgtg      1200
     agtaccctgc ggcccccgtg gatgcgcgtg gcgggagggc ctcgcgcatc ctccaccggc      1260
     accgcctgcc cctctctgcg cttggctccc agcgagcggg ggaagagctg cgaagccgcc      1320
     tcggctctgc ccggggcctg cgaggactcg cccggacccc caggcatgag acgggcagcg      1380
     aattatnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnttga gtgtagtggt      1500
     acaagcagca acgggagggg ctggggcgag gaccggagcc ggctgtgggc ctcactgccc      1560
     tttggtcccc agcccaggcg cagtcgaacc tcctggggaa gtgccgccgg ccgcgcaccg      1620
     ccttcaccag ccagcagctg ctggagctgg agcaccagtt caagctcaac aagtacctgt      1680
     cgcggcccaa gcgcttcgag gtggccacct cgctcatgct caccgagacc caggtgcgcg      1740
     ccctccccgc ccccgacgca tcccggcctc ccaggggaca ctgttacctt tgcacttgtg      1800
     acccacgggc ggtctgaggc atctagcgct gcgcctcgac ggttcagacg gcgggcgcac      1860
     gggttcatct aaggtgccca gagcgccgat tcagtagctt cgggtggggc ccaagaatca      1920
     gcacttaacc acccctcctt tcattctgaa gaaggtgatc cccaggccgc attcgagaaa      1980
     ttttgttcca gaaagagagg agggaacatc ctgagattta ccgcgacgta gccagctgcc      2040
     ctgacccttc ctccgcagac ggagggcgcg ggtagaaaag tccccggcct gggtcgttgg      2100
     ggacatagtc ctagctccca cggagctcca gcccagctct ggggtttgct gctgagtggg      2160
     gggttgcggg gaggaggaag ctacgagccc cctccccatt ccgcttctaa gtctcaccct      2220
     gaggccattc cagggccgac ccaatggggc ccaggcgcac gcggggggac tccggggaca      2280
     ggaagccctg gggtggcggt ggccggtttc tcacgcccgc ttgtgcccgc aggtgaagat      2340
     ttggttccag aaccggcgga tgaaatggaa acgcagcaaa aaggccaaag agcaggcggc      2400
     gcaggaagcg gagaaacaga agggcggcgg cgggggcgcg gggaagggcg gcgcggagga      2460
     gccgggagcc gaggagctgc tggggccgcc agcgcccgga gacaagggca gcggacsccg      2520
     cctgcgggac ttgagggaca gtgaccccga ggaggacgag gacgaggacg acgaggacca      2580
     tttcccctac agcaacggcg ccagcgtcca cgccgcctcc tccgactgct cctcggagga      2640
     cgactcgccg cccccgcggc ccagccacca gcccgcgccc cagtaggagc cccgcggccc      2700
     agcaggtgcg gcgcgcacgg agcgccccgg ccggcggctt ctcccggagg ccccggcgcc      2760
     cgcacccacc cggcccggcc ccgagagcag gctcgaccgc cgccccatgg acccctcgcc      2820
     caggccgggg ctggagggat tcggccgcgg cctccggtcc tgggcgcttc ccttttaagc      2880
     aagggcgcct cacctgctct tcaagaaaca gcgagaggga gacccagggg gctgaaactt      2940
     gaactctggt tcttttaaaa ttaattttgg ttggtgttgg gggaggcgcg agtgcgtgtg      3000
     agaagaaccg acccaccccg cgcaagggga agcctcctgt ctcccctttc cccgcgtccg      3060
     agaaggcgga aacccacagt gttacctgac ttatgaaact tgaaaccgcc tctggagccg      3120
     ccattctgca gagtatttgg aaaaagaaaa aagggtttat gcttacgtct ctggggtcgg      3180
     ggggattatg tcacgagcgt tcaaactgct ggaaatctca aaactgtact gtctttattt      3240
     ttgtatattg tatttatata taaaaagaaa cgtctacgta tgcatgctaa attattattt      3300
     agcttctccc atcgcccacg atggaatgta aaataaattg gttttgtact ggatcagcgt      3360
     gcacgagttt tgggggatta tgcccgcggc attacaattt gcttgtagaa atgatgggga      3420
     gggtgtctac tcggcggttg gcagctgagg gtgaaaatcg gagtc                      3465
//

If you have problems or comments...

PBIL Back to PBIL home page