(data stored in ACNUC4482 zone)

EMBL: AF112345

ID   AF112345; SV 1; linear; mRNA; STD; HUM; 5189 BP.
XX
AC   AF112345;
XX
DT   02-JAN-2000 (Rel. 62, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens integrin alpha 10 subunit (ITGA10) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5189
RX   PUBMED; 10702680.
RA   Lehnert K., Ni J., Leung E., Gough S., Morris C.M., Liu D., Wang S.-X.,
RA   Langley R., Krissansen G.W.;
RT   "The integrin alpha10 subunit: expression pattern, partial gene structure,
RT   and chromosomal localization";
RL   Cytogenet. Cell Genet. 87(3-4):238-244(1999).
XX
RN   [2]
RP   1-5189
RA   Lehnert K., Yang Y., Ni J., Leung E., Langley R., Liu D., Wang S.-X.,
RA   Krissansen G.W.;
RT   ;
RL   Submitted (08-DEC-1998) to the INSDC.
RL   Molecular Medicine, University of Auckland, Park Rd., Grafton, Auckland,
RL   New Zealand
XX
DR   MD5; 3831d858ed7b0352e66fc23f89b546e2.
DR   Ensembl-Gn; ENSG00000143127; homo_sapiens.
DR   Ensembl-Tr; ENST00000369304; homo_sapiens.
DR   Ensembl-Tr; ENST00000539363; homo_sapiens.
DR   EuropePMC; PMC1557667; 16704738.
DR   EuropePMC; PMC1803772; 17306030.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5189
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="1q21"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        77..3580
FT                   /codon_start=1
FT                   /gene="ITGA10"
FT                   /product="integrin alpha 10 subunit"
FT                   /note="cell adhesion molecule; similar to the product
FT                   encoded by GenBank Accession Number AF074015"
FT                   /db_xref="GOA:O75578"
FT                   /db_xref="H-InvDB:HIT000069731.14"
FT                   /db_xref="HGNC:HGNC:6135"
FT                   /db_xref="InterPro:IPR000413"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013649"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR032695"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:O75578"
FT                   /protein_id="AAF21944.1"
FT                   /translation="MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSV
FT                   LQHVGGGQRWMLVGAPWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAV
FT                   NMHLGMSLLETDGDGGFMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCP
FT                   TYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDF
FT                   RTKEEVVRAAKNLSRREGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHD
FT                   GEELPAALKACEAGRVTRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDE
FT                   AALTDIVDALGDRIFGLEGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGS
FT                   VLWLEGGHRLFPPRMALEDEFPPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRG
FT                   KVIAFQLKKDGAVRVAQSLQGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNK
FT                   ETGRVYVYLVGQQSLLTLQGTLQPEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDG
FT                   HQGALYLYHGTQSGVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQG
FT                   AAILLSSRPIVHLTPSLEVTPQAISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDH
FT                   QFYMRFTASLDEWTAGARAAFDGSGQRLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPV
FT                   ALTVTFALDNTTKPGPVLNEGSPTSIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRK
FT                   APFVVRGGRRKVLVSTTLENRKENAYNTSLSLIFSRNLHLASLTPQRESPIKVECAAPS
FT                   AHARLCSVGHPVFQTGAKVTFLLEFEFSCSSLLSQVFVKLTASSDSLERNGTLQDNTAQ
FT                   TSAYIQYEPHLLFSSESTLHRYEVHPYGTLPVGPGPEFKTTLRVQNLGCYVVSGLIISA
FT                   LLPAVAHGGNYFLSLSQVITNNASCIVQNLTEPPGPPVHPEELQHTNRLNGSNTQCQVV
FT                   RCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFKSLTVVSTFELGTEEGSVLQLTEASRWS
FT                   ESLLEVVQTRPILISLWILIGSVLGGLLLLALLVFCLWKLGFFAHKKIPEEEKREEKLE
FT                   Q"
XX
SQ   Sequence 5189 BP; 1189 A; 1337 C; 1412 G; 1251 T; 0 other;
     gggaaagtga agaaaacaga aaaggagagg gacagaggcc agaggacttc tcatactgga        60
     cagaaaccga tcaggcatgg aactcccctt cgtcactcac ctgttcttgc ccctggtgtt       120
     cctgacaggt ctctgctccc cctttaacct ggatgaacat cacccacgcc tattcccagg       180
     gccaccagaa gctgaatttg gatacagtgt cttacaacat gttgggggtg gacagcgatg       240
     gatgctggtg ggcgccccct gggatgggcc ttcaggcgac cggagggggg acgtttatcg       300
     ctgccctgta gggggggccc acaatgcccc atgtgccaag ggccacttag gtgactacca       360
     actgggaaat tcatctcatc ctgctgtgaa tatgcacctg gggatgtctc tgttagagac       420
     agatggtgat gggggattca tggcctgtgc ccctctctgg tctcgtgctt gtggcagctc       480
     tgtcttcagt tctgggatat gtgcccgtgt ggatgcttca ttccagcctc agggaagcct       540
     ggcacccact gcccaacgct gcccaacata catggatgtt gtcattgtct tggatggctc       600
     caacagcatc tacccctggt ctgaagttca gaccttccta cgaagactgg tagggaaact       660
     gtttattgac ccagaacaga tacaggtggg actggtacag tatggggaga gccctgtaca       720
     tgagtggtcc ctgggagatt tccgaacgaa ggaagaagtg gtgagagcag caaagaacct       780
     cagtcggcgg gagggacgag aaacaaagac tgcccaagca ataatggtgg cctgcacaga       840
     agggttcagt cagtcccatg ggggccgacc cgaggctgcc aggctactgg tggttgtcac       900
     tgatggagag tcccatgatg gagaggagct tcctgcagca ctaaaggcct gtgaggctgg       960
     aagagtgaca cgctatggga ttgcagtcct tggtcactac ctccggcggc agcgagatcc      1020
     cagctctttc ctgagagaaa ttagaactat tgccagtgat ccagatgagc gattcttctt      1080
     caatgtcaca gatgaagctg ctctgactga cattgtggat gcactaggag atcggatttt      1140
     tggccttgaa gggtcccatg cagaaaacga aagctccttt gggctggaaa tgtctcagat      1200
     tggtttctcc actcatcggc taaaggatgg gattcttttt gggatggtgg gggcctatga      1260
     ctggggaggc tctgtgctat ggcttgaagg aggccaccgc cttttccccc cacgaatggc      1320
     actggaagac gagttccccc ctgcactgca gaaccatgca gcctacctgg gttactctgt      1380
     ttcttccatg cttttgcggg gtggacgccg cctgtttctc tctggggctc ctcgatttag      1440
     acatcgagga aaagtcatcg ccttccagct taagaaagat ggggctgtga gggttgccca      1500
     gagcctccag ggggagcaga ttggttcata ctttggcagt gagctctgcc cattggatac      1560
     agatagggat ggaacaactg atgtcttact tgtggctgcc cccatgttcc tgggacccca      1620
     gaacaaggaa acaggacgtg tttatgtgta tctggtaggc cagcagtcct tgctgaccct      1680
     ccaaggaaca cttcagccag aaccccccca ggatgctcgg tttggctttg ccatgggagc      1740
     tcttcctgat ctgaaccaag atggttttgc tgatgtggct gtgggggcgc ctctggaaga      1800
     tgggcaccag ggagcactgt acctgtacca tggaacccag agtggagtca ggccccatcc      1860
     tgcccagagg attgctgctg cctccatgcc acatgccctc agctactttg gccgaagtgt      1920
     ggatggtcgg ctagatctgg atggagatga tctggtcgat gtggctgtgg gtgcccaggg      1980
     ggcagccatc ctgctcagct cccggcccat tgtccatctg accccatcac tggaggtgac      2040
     cccacaggcc atcagtgtgg ttcagaggga ctgtaggcgg cgaggccaag aggcagtctg      2100
     tctgactgca gccctttgct tccaagtgac ctcccgtact cctggtcgct gggatcacca      2160
     attctacatg aggttcaccg catcactgga tgaatggact gctggggcac gtgcagcatt      2220
     tgatggctct ggccagaggt tgtcccctcg gaggctccgg ctcagtgtgg ggaatgtcac      2280
     ttgtgagcag ctacacttcc atgtgctgga tacatcagat tacctccggc cagtggcctt      2340
     gactgtgacc tttgccttgg acaatactac aaagccaggg cctgtgctga atgagggctc      2400
     acccacctct atacaaaagc tggtcccctt ctcaaaggat tgtggccctg acaatgaatg      2460
     tgtcacagac ctggtgcttc aagtgaatat ggacatcaga ggctccagga aggccccatt      2520
     tgtggttcga ggtggccggc ggaaagtgct ggtatctaca actctggaga acagaaagga      2580
     aaatgcttac aatacgagcc tgagtctcat cttctctaga aacctccacc tggccagtct      2640
     cactcctcag agagagagcc caataaaggt ggaatgtgcc gccccttctg ctcatgcccg      2700
     gctctgcagt gtggggcatc ctgtcttcca gactggagcc aaggtgacct ttctgctaga      2760
     gtttgagttt agctgctcct ctctcctgag ccaggtcttc gtgaagctga ctgccagcag      2820
     tgacagcctg gagagaaatg ggacccttca agataacaca gcccagacct cagcctacat      2880
     ccaatatgag ccccacctcc tgttctctag tgagtctacc ctgcaccgct atgaggttca      2940
     cccatatggg accctcccag tgggtcctgg cccagaattc aaaaccactc tcagggttca      3000
     gaacctaggc tgctatgtgg tcagtggcct catcatctca gccctccttc cagctgtggc      3060
     ccatgggggc aattacttcc tatcactgtc tcaagtcatc actaacaatg caagctgcat      3120
     agtgcagaac ctgactgaac ccccaggccc acctgtgcat ccagaggagc ttcaacacac      3180
     aaacagactg aatgggagca atactcagtg tcaggtggtg aggtgccacc ttgggcagct      3240
     ggcaaagggg actgaggtct ctgttggact attgaggctg gttcacaatg aatttttccg      3300
     aagagccaag ttcaagtccc tgacggtggt cagcaccttt gagctgggaa ccgaagaggg      3360
     cagtgtccta cagctgactg aagcctcccg ttggagtgag agcctcttgg aggtggttca      3420
     gacccggcct atcctcatct ccctgtggat cctcataggc agtgtcctgg gagggttgct      3480
     cctgcttgct ctccttgtct tctgcctgtg gaagcttggc ttctttgccc ataagaaaat      3540
     ccctgaggaa gaaaaaagag aagagaagtt ggagcaatga atgtagaata agggtctaga      3600
     aagtcctccc tggcagcttc ttcaagagac ttgcataaaa gcagaggttt gggggctcag      3660
     atgggacaag aagccgcctc tggactatct ccccagacca gcagcctgac ttgacttttg      3720
     agtcctaggg atgctgctgg ctagagatga ggctttacct cagacaagaa gagctggcac      3780
     caaaactagc catgctccca ccctctgctt ccctcctcct cgtgatcctg gttccatagc      3840
     caacactggg gcttttgttt ggggtccttt tatccccagg aatcaataat ttttttgcct      3900
     aggtgcctga ctcctttcag attccctctt tatcttccct cacagtttgg aaaggatgag      3960
     ggttatcttc ctcgattctt ccaccctctc actttcctgc ctgttcccca ctccacagga      4020
     gggagctgac gttggcttga aaggagtaaa gtcaacatct gctgctttcc tgtggactct      4080
     ggtgattcat agagccggat ggggagagtc aacaggaaaa aaggagggag gaggaaaagc      4140
     cacaagagac attctgtaca attccaagga acagagaagc ctttagacag gcaactgcca      4200
     tcccccctga aacctgagac ctgtagtgca ctcgaccgcc ctcaggtgtt ggtgaaacag      4260
     agctgccccc aggctcgctg ggcataggct tcctgattcc aagccttttc tgggagcaaa      4320
     gccagggcct ggtgcctgat tttctgaagc caggagccct caggtggctg gagctggaat      4380
     agcagggagg actgggtgta cctaggcagt attttctcta cttctctcaa gtcttatact      4440
     cactcttgag ccctccttgg ggcctgctta gaaagcagac aggagagaga gtactgctac      4500
     ttgatgatgg gaaatgcttt cactttacca gctttgggaa gcagcagccc catgggatct      4560
     aaaagtgtgg agtctgcatt aagaaaccta catgggtggc atggggctct ggggagcaag      4620
     cccttacttg ctcagcactg gttatgtagc acaaatagct cctaggaaaa tgtttctggg      4680
     gcaaccctag aaccctggtc atattttgca gggtttctct ggtggaatca gtttgccagc      4740
     ccttgcttga tgcttactgg aaatctccag gttaatttct atctctgatc cctccccaac      4800
     ccactccata tttgggtcat ggacagtaaa ggcagttgga ttctcataga caactgggta      4860
     acttatattt ctttgtaatc aagacttgag atatcgaagt cagttattgg tctccagagt      4920
     gcagctctgg gagccttttg aagaatcagc actcattaag agctgagaag agagaagacc      4980
     tgattgggtg gttgactagc agtcacagaa cctgtcctcc caggctgttc ctgaggcctg      5040
     accacagtat ttattttggc atgtctctgg ccttctgcag aggcccaccc tcatgggcat      5100
     tgtctctgtt tcccagtggg gtggacagta tatcagatgg tcagaacaaa taaagttcag      5160
     tgtcaaatga aaaaaaaaaa aaaaaaaaa                                        5189
//

If you have problems or comments...

PBIL Back to PBIL home page