(data stored in ACNUC7421 zone)

EMBL: AF117227

ID   AF117227; SV 3; linear; genomic DNA; STD; PRO; 5806 BP.
XX
AC   AF117227;
XX
DT   26-APR-1999 (Rel. 59, Created)
DT   07-SEP-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Salmonella typhimurium fructose phosphotransferase system repressor FruR
DE   (fruR) gene, complete cds; acetohydroxy acid synthase small subunit IlvH
DE   (ilvH) gene, complete cds; acetohydroxy acid synthase large subunit (ilvI)
DE   pseudogene, complete sequence; isopropylmalate synthase (leuA) gene,
DE   partial cds; and sites of Tn10-derived transposon insertions.
XX
KW   .
XX
OS   Salmonella enterica subsp. enterica serovar Typhimurium
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
XX
RN   [1]
RP   5481-5486,5504-5509,5652-5676,5714-5715
RX   DOI; 10.1016/S0022-2836(83)80226-5.
RX   PUBMED; 6195343.
RA   Gemmill R.M., Jones J.W., Haughn G.W., Calvo J.M.;
RT   "Transcription initiation sites of the leucine operons of Salmonella
RT   typhimurium and Escherichia coli";
RL   J. Mol. Biol. 170(1):39-59(1983).
XX
RN   [2]
RP   1-5806
RX   PUBMED; 6327652.
RA   Gemmill R.M., Tripp M., Friedman S.B., Calvo J.M.;
RT   "Promoter mutation causing catabolite repression of the Salmonella
RT   typhimurium leucine operon";
RL   J. Bacteriol. 158(3):948-953(1984).
XX
RN   [3]
RP   4687-4687,4705-4706,4866-4866
RX   PUBMED; 3519576.
RA   Haughn G.W., Wessler S.R., Gemmill R.M., Calvo J.M.;
RT   "High A + T content conserved in DNA sequences upstream of leuABCD in
RT   Escherichia coli and Salmonella typhimurium";
RL   J. Bacteriol. 166(3):1113-1117(1986).
XX
RN   [4]
RP   1157-1162,1180-1185,1621-1622
RX   DOI; 10.1007/BF00273623.
RX   PUBMED; 1851954.
RA   Jahreis K., Postma P.W., Lengeler J.W.;
RT   "Nucleotide sequence of the ilvH-fruR gene region of Escherichia coli K12
RT   and Salmonella typhimurium LT2";
RL   Mol. Gen. Genet. 226(1-2):332-336(1991).
XX
RN   [5]
RP   3663-3668,3687-3692,3843-3843,3850-3851
RX   DOI; 10.1111/j.1365-2958.1993.tb01179.x.
RX   PUBMED; 8483418.
RA   Wang Q., Sacco M., Ricca E., Lago C.T., De Felice M., Calvo J.M.;
RT   "Organization of Lrp-binding sites upstream of ilvIH in Salmonella
RT   typhimurium";
RL   Mol. Microbiol. 7(6):883-891(1993).
XX
RN   [6]
RP   5103-5108,5127-5131
RX   PUBMED; 9457867.
RA   Fang M., Wu H.Y.;
RT   "A promoter relay mechanism for sequential gene activation";
RL   J. Bacteriol. 180(3):626-633(1998).
XX
RN   [7]
RP   1-5806
RX   DOI; 10.1046/j.1365-2958.2000.02015.x.
RX   PUBMED; 10931352.
RA   El Hanafi D., Bossi L.;
RT   "Activation and silencing of leu-500 promoter by transcription-induced DNA
RT   supercoiling in the Salmonella chromosome";
RL   Mol. Microbiol. 37(3):583-594(2000).
XX
RN   [8]
RP   1-5806
RA   El Hanafi D., Maloriol D., Figueroa-Bossi N., Bossi L.;
RT   ;
RL   Submitted (30-DEC-1998) to the INSDC.
RL   Centre de Genetique Moleculaire, Centre National de la Recherche
RL   Scientifique, Gif-sur-Yvette 91198, France
XX
RN   [9]
RC   Sequence update by submitter
RP   1-5806
RA   El Hanafi D., Maloriol D., Figueroa-Bossi N., Bossi L.;
RT   ;
RL   Submitted (20-APR-2000) to the INSDC.
RL   Centre de Genetique Moleculaire, Centre National de la Recherche
RL   Scientifique, Gif-sur-Yvette 91198, France
XX
DR   MD5; 723a0f0329e48961cfa1396a89f8a3ec.
DR   RFAM; RF00512; Leu_leader.
XX
CC   On Apr 21, 2000 this sequence version replaced gi:4689437.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5806
FT                   /organism="Salmonella enterica subsp. enterica serovar
FT                   Typhimurium"
FT                   /sub_species="enterica"
FT                   /strain="LT2"
FT                   /mol_type="genomic DNA"
FT                   /serovar="Typhimurium"
FT                   /db_xref="taxon:90371"
FT   gene            complement(115..1119)
FT                   /gene="fruR"
FT   CDS_pept        complement(115..1119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /product="FruR"
FT                   /note="fructose phosphotransferase system repressor"
FT                   /db_xref="GOA:P0A2P8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A2P8"
FT                   /protein_id="AAF65176.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVNFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDHELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIRRNLYRRGILSRS"
FT   misc_feature    163..171
FT                   /note="Tn10 transposase target sequence; insertion
FT                   fruR436::Tn10dTac-tet"
FT   misc_feature    661..662
FT                   /note="site of in vitro-made insertion: alleles
FT                   fruR441::Tn10dTc* and fruR444::Tn10dTc*"
FT   regulatory      complement(1157..1162)
FT                   /note="fruR gene promoter"
FT                   /citation=[4]
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(1180..1185)
FT                   /note="fruR gene promoter"
FT                   /citation=[4]
FT                   /regulatory_class="minus_35_signal"
FT   operon          complement(1246..3692)
FT                   /operon="ilv"
FT   regulatory      complement(1246..1280)
FT                   /operon="ilv"
FT                   /note="ilvIH operon transcription terminator"
FT                   /regulatory_class="terminator"
FT   misc_feature    1377..1385
FT                   /note="Tn10 transposase target sequence; insertion
FT                   ilvIH3302::Tn10dTc"
FT   misc_feature    1402..1403
FT                   /note="site of in vitro-made insertion; allele
FT                   ilvH3306::SGS(pSC101)"
FT   gene            complement(1403..1897)
FT                   /operon="ilv"
FT                   /gene="ilvH"
FT   CDS_pept        complement(1403..1897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="ilv"
FT                   /gene="ilvH"
FT                   /product="IlvH"
FT                   /note="acetohydroxy acid synthase III, small subunit"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="AAF65177.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
FT   misc_difference 1621..1622
FT                   /citation=[4]
FT   gene            complement(1897..3621)
FT                   /pseudo
FT                   /operon="ilv"
FT                   /gene="ilvI"
FT                   /note="acetohydroxy acid synthase III, large subunit;
FT                   inactive gene due to nonsense (UGA) mutation at position
FT                   corresponding to the 12th codon"
FT   misc_feature    2163..2171
FT                   /note="Tn10 transposase target sequence; insertion
FT                   ilvI3304::Tn10dlacZKn"
FT   misc_difference 2172..3762
FT                   /note="deletion; allele D(ilvI)3271"
FT   misc_feature    2805..2813
FT                   /note="Tn10 transposase target sequence; insertion
FT                   ilvI3303::Tn10dTac-tet"
FT   misc_feature    2886..2894
FT                   /note="Tn10 transposase target sequence; insertion
FT                   ilvI3305::Tn10dTac-cat"
FT   regulatory      complement(3663..3668)
FT                   /operon="ilv"
FT                   /note="ilvIH operon promoter"
FT                   /citation=[5]
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(3687..3692)
FT                   /operon="ilv"
FT                   /note="ilvIH operon promoter"
FT                   /citation=[5]
FT                   /regulatory_class="minus_35_signal"
FT   misc_feature    3763..3771
FT                   /note="Tn10 transposase target sequence; insertion
FT                   ilvI3301::Tn10dTc"
FT   misc_difference 3772..4422
FT                   /note="deletion; allele D(leuO)3281"
FT   misc_difference 3843
FT                   /citation=[5]
FT   gene            complement(3850..4967)
FT                   /gene="leuO"
FT   misc_difference 3850..3851
FT                   /citation=[5]
FT   CDS_pept        complement(3942..4967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /product="LeuO"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="GOA:Q9X4P8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q9X4P8"
FT                   /protein_id="AAD26693.1"
FT                   /translation="MHGKSYFQELFLPSARKRELSVTVELNMPEVKTEKPHLLDMGKPQ
FT                   LRMVDLNLLTVFDAVMQEQNITRAAHTLGMSQPAVSNAVARLKVMFNDELFVRYGRGIQ
FT                   PTARAFQLFGSVRQALQLVQNELPGSGFEPTSSERVFNLCVCSPLDNILTSQIYNRVEK
FT                   IAPNIHVVFKASLNQNTEHQLRYQETEFVISYEEFRRPEFTSVPLFKDEMVLVASRKHP
FT                   RISGPLLEGDVYNEQHAVVSLDRYASFSQPWYDTPDKQSSVAYQGMALISVLNVVSQTH
FT                   LVAIAPRWLAEEFAESLDLQILPLPLKLNSRTCYLSWHEAAGRDKGHQWMEDLLVSVCK
FT                   R"
FT   misc_feature    3997..4005
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leuO3257::Tn10dTac-tet"
FT   misc_feature    4423..4431
FT                   /note="Tn10 transposase target sequence; insertions
FT                   leuO3263::Tn10dCm and leuO3249::Tn10dTc"
FT   misc_difference 4432..4825
FT                   /note="deletion; allele D(leuO)3268"
FT   misc_feature    4568..4576
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leuO3278::Tn10dTac-tet"
FT   variation       4664..4666
FT                   /gene="leuO"
FT                   /replace=""
FT                   /note="as compared to GenBank Accession Number AF106956"
FT   misc_difference 4687
FT                   /citation=[3]
FT   misc_difference 4705..4706
FT                   /citation=[3]
FT   misc_feature    4826..4834
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leuO3258::Tn10dCm"
FT   variation       4832..4833
FT                   /gene="leuO"
FT                   /replace="cg"
FT                   /note="as compared to GenBank Accession Number AF106956"
FT   misc_difference 4835..5300
FT                   /note="deletion; allele D(leuO)3265"
FT   misc_difference 4866
FT                   /citation=[3]
FT   misc_feature    4877..4885
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leuO3277::Tn1OdTac-cat"
FT   misc_feature    4904..4912
FT                   /note="Tn10 transposase target sequence; insertions
FT                   leuO3255::Tn10dTac-tet,
FT                   leuO3259::Tn10dTc,leuO3264::Tn10dTac-tet,
FT                   leuO3280::Tn10dTac-cat"
FT   misc_difference 4913..5515
FT                   /note="deletion; allele D(leu)3276"
FT   regulatory      complement(5103..5108)
FT                   /note="leuO gene promoter"
FT                   /citation=[6]
FT                   /regulatory_class="minus_10_signal"
FT   regulatory      complement(5127..5132)
FT                   /note="leuO gene promoter"
FT                   /citation=[6]
FT                   /regulatory_class="minus_35_signal"
FT   misc_feature    5301..5309
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leu-3253::Tn10dTc"
FT   regulatory      5481..5486
FT                   /note="leuABCD operon promoter"
FT                   /citation=[1]
FT                   /regulatory_class="minus_35_signal"
FT   regulatory      5504..5509
FT                   /note="leuABCD operon promoter"
FT                   /citation=[1]
FT                   /regulatory_class="minus_10_signal"
FT   misc_difference 5505
FT                   /note="A/T to G/C: allele leu-500; promoter mutation"
FT                   /citation=[2]
FT   misc_feature    5516..5524
FT                   /note="Tn10 transposase target sequence; insertion
FT                   leu-3254::Tn10dTc"
FT   regulatory      5652..5676
FT                   /note="leuABCD operon transcription attenuator"
FT                   /citation=[1]
FT                   /regulatory_class="attenuator"
FT   misc_difference 5669
FT                   /note="G/C to T/A; allele leu-3242; attenuator mutation"
FT   misc_difference 5714..5715
FT                   /citation=[1]
FT   gene            5717..>5806
FT                   /gene="leuA"
FT   CDS_pept        5717..>5806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /product="LeuA"
FT                   /note="isopropylmalate synthase"
FT                   /db_xref="GOA:Q9JP75"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JP75"
FT                   /protein_id="AAD26694.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSAKEKLQ"
XX
SQ   Sequence 5806 BP; 1526 A; 1572 C; 1320 G; 1388 T; 0 other;
     aaaaaagaat tttcggataa ttttaaggaa taatcttaat tatttaaggg atatttttac        60
     tgatacgcat ttgtttgacg gcggcagaag agagagtctt ttaccgccgg tcctttagct       120
     acggctcaga atgccgcgac gataaaggtt tcgccgaata cgcgttaagc cgggtttcgg       180
     tttacgcggt tcatcaagac ttgccagcac aatctccagc acgcgttccg cgacatcacg       240
     atgacgctgc gccaccgcca gtaccgggca ttgcagaaaa tccagcagct catgatcgcc       300
     gaaggtcgca atcgctaaat ccgaaggcag ttttccatcg cgccgcagcg ttacgtccat       360
     cacgccctgt aatagcgcga acgatgtcgt aaagagcgcc tgcggcatag gatgcgtttc       420
     cagccatttc tcaaacaact gcgcggcggc ttcgcgctca tagctgttgg catataagaa       480
     attcacctcc cgcggatcgt ctttccatgc ggtgcggaac ccctgctcgc gcaggaaact       540
     gacggacaac tccggcagcg cgcccaaata aagcaccgtt tccgccggga atttacgcag       600
     ctcttccgcc aacatctcgg catcatcctg atcggcgccg accacgctgg tgaaatgttc       660
     gcgatccagc gcgcggtcga gcgcgacgat ggggaacgga tcgttggccc agcgctgata       720
     gaagggatgc tccggcggta acgaagttga aacaatgatt gcatccacct ggcgttgcaa       780
     aaggtgctca atgcagcgca tttcgttatc cggctgatct tcagaacagg cgatcagcag       840
     ttggtagcca cgctggcgtg cctggcgctc aagatagttt gcgatacggg tgtagctcgt       900
     gttttcaagg tccgggatca ccagaccaat ggaacgtgtg cgtccagcac gcagcccggc       960
     agccacagcg ttaggatggt aattgtgctc acgcactacc gccatgactt tttctacggt      1020
     tttgtcgctc acgcggtatt gctttgcttt accgtttata acgtagcttg cagttgtgcg      1080
     cgagacaccg gccagccgag cgatttcatc cagtttcaca attgcccctt gtgtaaattg      1140
     tacaaaccat aacctttatg tcggcatggg ttaaaatcgt taacatctaa gcgcagtttg      1200
     atcactccgg caaccgcttt tattccgggt taccacggat ttcgcaaaaa aaagcccaac      1260
     cgatgatatt gggttgggcg ataattcctg ttggctgata tccggcaaac ctgcctgatg      1320
     gcgctacgct tatcggacct gggccagata tcagccagta gaccggataa aacgcacgcg      1380
     cgtcgtcatc cggcgaatct gctcagcgca taatcttatc gccgcgcgaa agcccgacga      1440
     cgcctgaacg cgccacttca acaattttcg ccacgtcgcg cagcgaggcc agaaaagcat      1500
     ccagtttatc gctggtgccc gccagttgaa cggtatacag cgttggcgta acgtcaataa      1560
     tctgaccacg gaaaatttcc gtattacgct tcacctcttc ccgtccgtag ccgctggcct      1620
     ggattttcac cagcatgatt tcccgctcaa cgtgcgctcc ctgtcccagc tcgctgacgc      1680
     gcagcacatc aaccagcttg tgcagttgct tttcaatttg ctcaagcact ttttcatcgc      1740
     ctaccgtctg gatagtcatg cgcgacaacg tcggatcgtc tgtcggcgcg acggtcaggc      1800
     tttcaatatt atatccgcgt tgcgaaaaga ggccgataac ccgcgataac gccccagatt      1860
     cgttttccag taataccgat aaaatccggc gcatcatcag gtcctctccg ttttgcttaa      1920
     ccacatttcg tccatcccgc ccccgcgaat ctgcatcgga tagacatgct cgctgccatc      1980
     aacggtgaca tcgacgaaca ccagtcggtt attacgcaca tgctcaaggg cttcgctgag      2040
     tttactttcc agctcatccg gacggttaat ctgcagcccg acatggccat atgcttccgc      2100
     caggcgcaca aaatccggta acgactgcat ataagactga gaatggcgac cggaatagat      2160
     catatcctgc cactgtttca ccatccccag ataacggttg ttcaggttca aaaccagtac      2220
     cggcagttca tactgtaagg ctgtcgacag ctcctgaatg ttcatctgta tactgccatc      2280
     gccggtcacg cagaccacca tttctttcgg cagggccatt ttaacgccca gcgcagccgg      2340
     taagccaaaa cccatcgtgc cgagcccgcc ggaattaatc cagcgacgtg gcttatcgaa      2400
     cgggtaatag agggcggcaa acatctggtg ttgtcctaca tcggacgtca cgtacgcatc      2460
     gcccttcgtc agacgccaga aggtttcaat caccgcctgg ggtttaatgc tttcgctttc      2520
     cgcgtcatat ttcaggcact gacgggcgcg ccagctctct atctgctgcc accagtcacg      2580
     aatatcatcc tgcggctgag acggcgcatc ctgcgccagt agctccatca tttgttccag      2640
     taccaggcgg gcatcgccca ccaccgggat atcagcgtta accgttttgg atatggacgt      2700
     cgggtcaatg tcgatgtgta ataccgtcgc gttcggacaa tatttagcga gattattcgt      2760
     cgtgcggtcg tcaaatcgta cgccaacagc gaaaatcacg tcggcgttat gcatggtcat      2820
     attggcttca taagtgccat gcattcccag cattcctaac gactggcgat gagtagcagg      2880
     aaacgcgccc agtcccatta atgaagagac caccggcagg ttaaaggttt caatgatgtg      2940
     gcgcaacggc gcatagcagg ccgcgcttat cgcccctccc ccaacgtaga ccaccggctt      3000
     ttttgccgac gccagcgttt gcaaggcacg cttaatttgt cctttatgtc ctgatgttgt      3060
     gggattgtaa gagcgcatac tgaccgtctc cggccaggca tacggcattt ttttcgccgg      3120
     attcaaaata tctttcggca aatccacgac caccggccca ggacgtccgc ttgccgccag      3180
     ccagaaggcc tttttaagca ccaggggaat atcttccgtc tgttggacca ggaagctatg      3240
     tttgaccacc ggtcgggaaa tccccaccat gtcgcactcc tgaaaggcat catagccaat      3300
     caatgaggtg gcgacctggc cggaaagaat caccagcgga atggaatcca tataggccgt      3360
     agcaatcccg gtaatcgcat tggtcgctcc cggtccggaa gtcaccagca ccacgccaac      3420
     gtcgccagtg gctcgcgcca ggccatccgc catatgcacc gcggcctgct catgacgcac      3480
     cagcacatga tcgatccctc caacggtatg tagcgcatca taaatatcaa gcactgcgcc      3540
     tccaggatag ccgaacacct gctttacgcc ttgatcgata agcgatcaga cgaccatctc      3600
     ggctccagac aacatttcca cggcttgcct ccactttata cctgtcatac ggtttgacgg      3660
     acaccttaac cgctcgctat cacgcctggc aattgggtgg aatgacgtaa agatggggaa      3720
     ggttagaata atcaggaggc aagaagagaa gaaatggaga aatactccgt ctgaatcaca      3780
     cctggtaata aataatcgct tataaatgca gacttacagc aattcatcta tttttcacag      3840
     cgacgaaaag catcgctcac cgttaattca gcataaaatt tttgatatac gctaaaaagc      3900
     agaataaacc agaatttgtt tctgatttat tctgcccggt tttatcgctt acaaacagag      3960
     actaataaat cttccatcca ttgatgccct ttatcacgcc cagccgcttc atgccaggaa      4020
     aggtagcatg tccggctatt cagttttaaa ggcaacggca atatttgcag atccagcgat      4080
     tccgcaaact cttccgccag ccagcgcggg gcaatagcga ccaaatgcgt ctgcgaaacc      4140
     acgttcagaa cgctgataag cgccatgccc tgataagcca cgctcgactg tttatccggc      4200
     gtgtcatacc acggctgact aaatgacgca taacgatcga gggaaacaac cgcatgttgt      4260
     tcattataaa catcgccttc cagtagcggg ccgctaatac gcgggtgttt tcggctggcg      4320
     actaaaacca tttcatcttt aaatagcggt acgctggtaa actcaggacg acggaattct      4380
     tcataactaa taacgaactc ggtttcctga tagcgtaact gatgctcagt attctgattc      4440
     aacgacgctt taaaaacgac atgaatattt ggcgcaattt tttctacacg attataaatc      4500
     tgtgacgtca ggatattatc cagcggactg cacacgcaaa gattgaatac acgttcgctg      4560
     ctggtcggct caaaccccga tcccggcaat tcattttgca ccaattgcaa cgcctgacgg      4620
     actgaaccaa ataactgaaa tgcacgggca gtcggctgaa ttcctcgtcc atatcgaaca      4680
     aaaagttcgt cattaaacat aaccttcaga cgcgctacgg cgttactgac cgcaggctgc      4740
     gacattccca gcgtgtgggc ggcgcgcgta atattctgct cttgcattac cgcatcgaac      4800
     acggtcaata ggttcaaatc aaccatgcga agctgtggtt tgcccatatc taaaagatgc      4860
     ggcttttcgg ttttgacctc tggcatattt aactccactg tcacgcttaa ctcccttttt      4920
     ctggctgaag gcagaaataa ttcctgaaaa tatgatttac catgcatata aaataagaaa      4980
     aagggaaagc gttaaaattc ggaaaacata aagacgctga cagagacaaa tagaatgcca      5040
     gcgcaagcgt aatgtgtcct gagtcacacc attgcgattc ataatgttta aattacgcaa      5100
     gcaatataac cataactatg gcgaatacac aatcatacac caagtgaatg atcatttaag      5160
     tttcaattaa atgtttatat tattaatagc taaaaagtta acattaattt atcaataact      5220
     ttatccttat ccattaagca aacaaggtta tttgttaaaa tataaaacaa atcaaaaaga      5280
     taaaccaaac ctttagcata cctttaacag gccattcccc taaccaattt gcaaacaaaa      5340
     atgcctaaat atttcaaaca atgaaaagta tgaatgtcca ctcgttcttt tatcctttat      5400
     tggacgcgca gcccagcaca attagctaaa gtacgtatcc ggatatcgtc aacaaaatgc      5460
     aatggcgaca gaaaatagag ttgacattaa acggcatatc cagtaccact aaaagcataa      5520
     cgcattcgct ggagctgaat taatgtcaca tatcgttcgt ttcactgggc tactactact      5580
     caacgcattt attgtgcgcg gtagaccggt gggcggcatt caacattaag tcagctcgaa      5640
     gtcaaacaaa acccgcgccg ttgcgcgggt ttttttatgc ctgacgcaag gcgcccctgg      5700
     agacaaggac cacatcatga gccagcaagt cattattttt gatacgacct tacgcgacgg      5760
     cgaacaagcg ttacaggcca gcctgagcgc gaaagagaag ctgcag                     5806
//

If you have problems or comments...

PBIL Back to PBIL home page