(data stored in ACNUC27125 zone)

EMBL: AF120716

ID   AF120716; SV 1; linear; genomic DNA; STD; FUN; 1333 BP.
XX
AC   AF120716;
XX
DT   10-MAY-1999 (Rel. 59, Created)
DT   16-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Kluyveromyces lactis cytochrome c oxidase subunit III (COX3) gene,
DE   mitochondrial gene encoding mitochondrial protein, complete cds.
XX
KW   .
XX
OS   Kluyveromyces lactis
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
OG   Mitochondrion
XX
RN   [1]
RP   1-1333
RX   PUBMED; 10757749.
RA   Costanzo M.C., Bonnefoy N., Williams E.H., Clark-Walker G.D., Fox T.D.;
RT   "Highly diverged homologs of Saccharomyces cerevisiae mitochondrial
RT   mRNA-specific translational activators have orthologous functions in other
RT   budding yeasts";
RL   Genetics 154(3):999-1012(2000).
XX
RN   [2]
RP   1-1333
RA   Costanzo M.C., Bonnefoy N., Williams E.H., Fox T.D.;
RT   ;
RL   Submitted (15-JAN-1999) to the INSDC.
RL   Section of Genetics and Development, Cornell University, Biotechnology
RL   Bldg., Ithaca, NY 14853-2703, USA
XX
DR   MD5; 94aa353457363b795fe40cbeb5f6ebdd.
DR   CABRI; CBS 2359.
DR   StrainInfo; 194087; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1333
FT                   /organism="Kluyveromyces lactis"
FT                   /organelle="mitochondrion"
FT                   /strain="CBS2359"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:28985"
FT   CDS_pept        352..1161
FT                   /codon_start=1
FT                   /transl_table=3
FT                   /gene="COX3"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="Cox3p"
FT                   /db_xref="GOA:Q9XLW9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9XLW9"
FT                   /protein_id="AAD29123.1"
FT                   /translation="MTHLERSRHQQFPFHLVAPSPWPIVVSFALMALALSLALTMHGYI
FT                   GHMYLIYLSILTVTLSATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEILIFAA
FT                   LFWAYFHSAMSPNIELGGVWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHGLVGGN
FT                   RKNALSGLLITFWLIVIFVTCQYIEYTNATFTITDGVYGSVFYAGTGLHFLHMVMLAAM
FT                   LGINYWRLRNYHLTATHHVGYETTVLYCHILDIIWLFLYIVFYWWGV"
XX
SQ   Sequence 1333 BP; 462 A; 173 C; 183 G; 514 T; 1 other;
     gggaattgta tttatttata tagatctatt atatataata atataattat taatcgccaa        60
     atacccctat tataggggta tttggcgata ctagatatat atttaatatt actaataata       120
     tactatatat aaatagtttt cataattaac ttttccccat tgcggactcc tcccttcggg       180
     ggggggggag tccgcaatgg ggtttataag taagnataag tataataata attatattaa       240
     aatataaata ttatcatata tatatatatt atatatatat attaagtaat attatttcta       300
     taaattaaat taacatttaa atttataaat gtatagatta taaaaatatt tatgacacat       360
     ttagaaagaa gtagacatca acaatttccc tttcatttag tagctccatc accatgacca       420
     attgtagtat catttgcatt aatggcatta gcattatcat tagctttaac tatgcatgga       480
     tatattggac atatgtattt aatttattta tcaattttaa cagtaacatt aagtgctaca       540
     ttatgattta gagatattat tgctgaagca acatatttag gagatcatac aattgctgtt       600
     agaaaaggta ttaatttagg tttcttatta ttcgtagtat cagaaatttt aattttcgct       660
     gcattattct gagcttattt ccattcagct atgagcccta atattgaatt aggtggtgta       720
     tgacctccag ttggtattca agctgtacaa cctacagaat tacctttatt aaatactatt       780
     atcttattat cttcaggtgc tactattaca tatagtcatc atggattagt aggtggtaat       840
     agaaaaaatg cattatcagg attattaatt acattctgat taattgttat ttttgttact       900
     tgtcaatata tcgaatatac taatgctact ttcacaatta ctgatggtgt atatggatca       960
     gtattctatg ctggtacagg attacatttc ttacatatgg ttatgttagc agcaatgtta      1020
     ggtattaatt attgaagatt aagaaactat catttaacag ctactcatca tgtaggttat      1080
     gaaacaacag tgttgtactg ccatatttta gatatcattt gattattctt atatattgta      1140
     ttctactgat gaggtgtata actcatcagt acaatatata agaatatctt taaacaataa      1200
     tattcttacc ttttttatat taaatatata aataaatata taatataata ttaatataat      1260
     actattataa gtattgcccg cggcaatcct aaataggatt gccgcgggat tagaactacc      1320
     cgtggcacct ccc                                                         1333
//

If you have problems or comments...

PBIL Back to PBIL home page