(data stored in ACNUC7820 zone)

EMBL: AF127848

ID   AF127848; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AF127848;
XX
DT   14-MAR-2000 (Rel. 63, Created)
DT   22-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Gorilla gorilla olfactory receptor (GGO3) gene, partial cds.
XX
KW   .
XX
OS   Gorilla gorilla (western gorilla)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Gorilla.
XX
RN   [1]
RP   1-649
RX   DOI; 10.1073/pnas.040580197.
RX   PUBMED; 10706615.
RA   Rouquier S., Blancher A., Giorgi D.;
RT   "The olfactory receptor gene repertoire in primates and mouse: evidence for
RT   reduction of the functional fraction in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 97(6):2870-2874(2000).
XX
RN   [2]
RP   1-649
RA   Giorgi D.G., Rouquier S.P.;
RT   ;
RL   Submitted (17-NOV-1999) to the INSDC.
RL   IGH, CNRS UPR, 141 rue dec la Cardonille, Montpellier Cedex 5 34396, France
XX
DR   MD5; f1e4f19555c59aeb3f3eededecbe8f23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Gorilla gorilla"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9593"
FT   gene            <1..>649
FT                   /gene="GGO3"
FT   mRNA            <1..>649
FT                   /gene="GGO3"
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="GGO3"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q9N222"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9N222"
FT                   /protein_id="AAF40263.1"
FT                   /translation="FVDTSFISTTVPKMLVNIQARIKDISYMGCLTQVYFLMMFAGMDT
FT                   FLLAVMAYDRFVAICHPLHYTVIMNPCLCGLLVLASWFIIFWFSLVHILLMKKLTFSTG
FT                   TEIPHFFCEPAQVLKVACSNTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMRTSS
FT                   TEGKYKAFSTLWISLCVVSLFYGTGLGVYLSSAVTHSSQSSSMASVMYAVVTP"
XX
SQ   Sequence 649 BP; 117 A; 194 C; 143 G; 195 T; 0 other;
     ctttgtggac acctctttca tctccaccac agtccccaag atgctagtga acatccaggc        60
     acggatcaaa gacatctcct acatggggtg cctcactcag gtgtattttt taatgatgtt       120
     tgctggaatg gatactttcc tactggccgt gatggcctat gaccggtttg tggccatctg       180
     ccaccccctg cactacacgg tcatcatgaa cccctgcctc tgtggcctcc tggttctggc       240
     atcttggttc atcattttct ggttctccct ggttcatatt ctactgatga agaagttgac       300
     cttctccaca ggcactgaga ttccgcattt cttctgtgaa ccggctcagg tcctcaaggt       360
     ggcctgctct aacaccctcc tcaataacat tgtcttgtat gtggccacgg cactgctggg       420
     tgtgtttcct gtagctggga tcctcttctc ctactctcag attgtctcct ccttaatgag       480
     aacgtcctcc accgagggca agtacaaagc cttttccacg ctgtggatct ccctctgtgt       540
     ggtctccttg ttctatggaa caggacttgg ggtctatctg agttctgctg tgacccactc       600
     ttcccagagc agctccatgg cctcagtgat gtacgccgtg gtcaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page