(data stored in ACNUC7820 zone)

EMBL: AF127877

ID   AF127877; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AF127877;
XX
DT   14-MAR-2000 (Rel. 63, Created)
DT   22-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Callithrix jacchus olfactory receptor (CJA23) gene, partial cds.
XX
KW   .
XX
OS   Callithrix jacchus (white-tufted-ear marmoset)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Platyrrhini; Cebidae;
OC   Callitrichinae; Callithrix; Callithrix.
XX
RN   [1]
RP   1-649
RX   DOI; 10.1073/pnas.040580197.
RX   PUBMED; 10706615.
RA   Rouquier S., Blancher A., Giorgi D.;
RT   "The olfactory receptor gene repertoire in primates and mouse: evidence for
RT   reduction of the functional fraction in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 97(6):2870-2874(2000).
XX
RN   [2]
RP   1-649
RA   Giorgi D.G., Rouquier S.P.;
RT   ;
RL   Submitted (17-NOV-1999) to the INSDC.
RL   IGH, CNRS UPR, 141 rue dec la Cardonille, Montpellier Cedex 5 34396, France
XX
DR   MD5; 7c4a8a04c5ebe3098e268603a2e0fc6c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Callithrix jacchus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9483"
FT   gene            <1..>649
FT                   /gene="CJA23"
FT   mRNA            <1..>649
FT                   /gene="CJA23"
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="CJA23"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q9N206"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9N206"
FT                   /protein_id="AAF40279.1"
FT                   /translation="FTDICFTTVIVPRMLVNFLSGTKVIPYMGCLVQMYFFMAFGNTDS
FT                   YLLASMAIDRLVAICNPLHYDVAMNPRHCLLMLLGSCSISHLHSLFRVLLMSHLSFCAS
FT                   HVIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCIIFSYLRIIITVLRIPF
FT                   AAGKWRAFSTCGSHLTVVALFYGSIYYVYFRPLSMYSVVKDRVATVMYTVVTP"
XX
SQ   Sequence 649 BP; 126 A; 192 C; 139 G; 192 T; 0 other;
     tttcacggat atctgcttca caacagtcat agtgcccagg atgctggtga attttctatc        60
     agggacaaag gttatcccct acatgggctg cctggtccaa atgtacttct tcatggcctt       120
     tgggaacact gacagctacc tgctggcctc tatggccatc gaccggctgg tggccatctg       180
     caacccctta cactatgatg tggctatgaa cccccggcat tgcctactca tgctattggg       240
     ttcttgcagc atctcccacc tacattccct gttccgggtg ctacttatgt ctcacctgtc       300
     tttctgtgcc tcccacgtca ttaagcactt tttctgtgac acccagcctg tgctaaagct       360
     gtcctgctct gacacgtcct ccagccagat ggtggtcatg actgagactt tagctgtcat       420
     tgtgaccccc ttcctgtgta tcatcttctc ctacctgcga atcatcatca ctgtgctcag       480
     aatccccttt gcagctggga agtggagggc cttctctacc tgtggctccc acctcactgt       540
     agtagccctt ttctacggga gtatatatta tgtctatttt aggcccctgt ccatgtactc       600
     agtggtgaag gaccgagtag ccacagttat gtacacagta gtgacaccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page