(data stored in ACNUC7820 zone)

EMBL: AF127888

ID   AF127888; SV 1; linear; genomic DNA; STD; MAM; 649 BP.
XX
AC   AF127888;
XX
DT   14-MAR-2000 (Rel. 63, Created)
DT   22-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Pongo pygmaeus olfactory receptor (PPY49) gene, partial cds.
XX
KW   .
XX
OS   Pongo pygmaeus (Bornean orangutan)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Pongo.
XX
RN   [1]
RP   1-649
RX   DOI; 10.1073/pnas.040580197.
RX   PUBMED; 10706615.
RA   Rouquier S., Blancher A., Giorgi D.;
RT   "The olfactory receptor gene repertoire in primates and mouse: evidence for
RT   reduction of the functional fraction in primates";
RL   Proc. Natl. Acad. Sci. U.S.A. 97(6):2870-2874(2000).
XX
RN   [2]
RP   1-649
RA   Giorgi D.G., Rouquier S.P.;
RT   ;
RL   Submitted (17-NOV-1999) to the INSDC.
RL   IGH, CNRS UPR, 141 rue dec la Cardonille, Montpellier Cedex 5 34396, France
XX
DR   MD5; 8884ad78cdd3a5ae27349dbb61716b59.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Pongo pygmaeus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9600"
FT   gene            <1..>649
FT                   /gene="PPY49"
FT   mRNA            <1..>649
FT                   /gene="PPY49"
FT                   /product="olfactory receptor"
FT   CDS_pept        <1..>649
FT                   /codon_start=2
FT                   /gene="PPY49"
FT                   /product="olfactory receptor"
FT                   /db_xref="GOA:Q9N1Z7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q9N1Z7"
FT                   /protein_id="AAF40288.1"
FT                   /translation="FVDTCFISTTVPKMLVNIQARSKEISYMGCLTQVYFLMMFAGMDT
FT                   FLLAVMAYDRFVAICHPLQYAVIMNPHLCGLLVLASWFIIFWVSLVHILLMKRLTFSTG
FT                   TEIPHFFCELAQVLKVARSDTLLNNIVLYVATALLGVFPVAGILFSYSQIVSSLMRMSS
FT                   TEGKYKAFSTCGSHLCVVSLFNGTGLGVYLSSAVTHSSQSSSMASVMYAMVTP"
XX
SQ   Sequence 649 BP; 119 A; 187 C; 146 G; 197 T; 0 other;
     ctttgtggac acctgtttca tctccaccac agtccccaag atgctagtga acatccaggc        60
     acggagcaaa gaaatctcct acatggggtg cctcactcag gtgtattttt taatgatgtt       120
     tgctggaatg gatactttcc tactggctgt gatggcttat gaccggtttg tggccatctg       180
     ccaccccctt cagtacgcgg tcatcatgaa cccccatctc tgtggcctgc tggttctggc       240
     atcttggttc atcattttct gggtctccct ggttcatatt ctactgatga agaggctgac       300
     cttctccaca ggcactgaga ttccgcattt cttctgtgaa ctggctcagg tcctcaaggt       360
     ggcccgctct gataccctcc tcaataacat tgtcttgtat gtggccacgg cactgctggg       420
     tgtgtttcct gtagctggga tcctcttctc ctactctcag atcgtctcct ccttaatgag       480
     aatgtcctcc accgagggca agtacaaagc cttttccacc tgtggatctc acctctgtgt       540
     ggtctccttg ttcaatggaa caggacttgg ggtctatctc agttctgctg tgacccattc       600
     ttcccagagc agctccatgg cctcagtgat gtatgccatg gtcaccccc                   649
//

If you have problems or comments...

PBIL Back to PBIL home page