(data stored in ACNUC31108 zone)

EMBL: AF133425

ID   AF133425; SV 1; linear; mRNA; STD; HUM; 1044 BP.
XX
AC   AF133425;
XX
DT   16-NOV-1999 (Rel. 61, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens tetraspanin TM4-C mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1044
RA   Puls K.L., Ni J., Liu D., Morahan G., Wright M.D.;
RT   "The molecular characterization of four tetraspanins";
RL   Unpublished.
XX
RN   [2]
RP   1-1044
RA   Puls K.L., Ni J., Liu D., Wright M.D.;
RT   ;
RL   Submitted (08-MAR-1999) to the INSDC.
RL   Immunology, The Walter & Eliza Hall Institute, Royal Parade, Parkville,
RL   Victoria 3031, Australia
XX
DR   MD5; 9247e0ec6977f5ae63c71c48d3c8b1d8.
DR   Ensembl-Gn; ENSG00000117472; homo_sapiens.
DR   Ensembl-Tr; ENST00000372003; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1044
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        124..849
FT                   /codon_start=1
FT                   /product="tetraspanin TM4-C"
FT                   /note="transmembrane 4 superfamily member"
FT                   /db_xref="GOA:O60635"
FT                   /db_xref="H-InvDB:HIT000070978.12"
FT                   /db_xref="HGNC:HGNC:20657"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O60635"
FT                   /protein_id="AAF08364.1"
FT                   /translation="MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGP
FT                   LSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAA
FT                   VVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPY
FT                   FKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGI
FT                   GGLELAAMIVSMYLYCNLQ"
XX
SQ   Sequence 1044 BP; 220 A; 283 C; 266 G; 275 T; 0 other;
     cacgagggcg tccctctgcc tgcccactca gtggcaacac ccgggagctg ttttgtcctt        60
     tgtggagcct cagcagttcc ctctttcaga actcactgcc aagagccctg aacaggagcc       120
     accatgcagt gcttcagctt cattaagacc atgatgatcc tcttcaattt gctcatcttt       180
     ctgtgtggtg cagccctgtt ggcagtgggc atctgggtgt caatcgatgg ggcatccttt       240
     ctgaagatct tcgggccact gtcgtccagt gccatgcagt ttgtcaacgt gggctacttc       300
     ctcatcgcag ccggcgttgt ggtctttgct cttggtttcc tgggctgcta tggtgctaag       360
     actgagagca agtgtgccct cgtgacgttc ttcttcatcc tcctcctcat cttcattgct       420
     gaggttgcag ctgctgtggt cgccttggtg tacaccacaa tggctgagca cttcctgacg       480
     ttgctggtag tgcctgccat caagaaagat tatggttccc aggaagactt cactcaagtg       540
     tggaacacca ccatgaaagg gctcaagtgc tgtggcttca ccaactatac ggattttgag       600
     gactcaccct acttcaaaga gaacagtgcc tttcccccat tctgttgcaa tgacaacgtc       660
     accaacacag ccaatgaaac ctgcaccaag caaaaggctc acgaccaaaa agtagagggt       720
     tgcttcaatc agcttttgta tgacatccga actaatgcag tcaccgtggg tggtgtggca       780
     gctggaattg ggggcctcga gctggctgcc atgattgttt ccatgtatct gtactgcaat       840
     ctacaataag tccacttctg cctctgccac tactgctgcc acatgggaaa ctgtgaagag       900
     gcaccctggg caagcagcag tgattggggg aggggacagg atctaacaat gtcacttggg       960
     ccagaatgga cctggccttt ctgctcccag acttgggggc tagattaggg accactcctt      1020
     ttaggcgatg cctgactttg cctt                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page